Você está na página 1de 129

Tradução da

6ª Edição
Americana

Manual de Bioquímica com


Correlações Clínicas
Thomas M. Devlin

Lançamento 2007

ISBN: 9788521204060
Páginas: 1216
Formato: 21x28 cm
Peso: 2.948 kg
CONTEÚDO | VII

RESUMO DO
CONTEÚDO

| |
PARTE I ESTRUTURA DE PARTE IV VIAS METABÓLICAS E SEU
MACROMOLÉCULAS CONTROLE

1 Estrutura da Célula Eucariótica, 1


2 DNA e RNA: Composição e Estrutura, 23 14 Bioenergética e Metabolismo Oxidativo, 521
3 Proteínas I: Composição e Estrutura, 73 15 Metabolismo de Carboidratos I: Principais Vias
Metabólicas e Seu Controle, 572
16 Metabolismo de Carboidratos II: Vias Especiais
e Glicoconjugados, 626

|
PARTE II TRANSMISSÃO DA 17 Metabolismo de Lipídeos I: Síntese, Armazena-
INFORMAÇÃO mento e Utilização de ácidos Graxos e Triacilgli-
ceróis, 650
18 Metabolismo de Lipídeos II: Vias do Metabolis-
4 Replicação, Recombinação e Reparo do DNA, 132 mo de Lipídeos Especiais, 683
5 RNA: Transcrição e Processamento, 172 19 Metabolismo de aminoácidos, 725
6 Síntese de Proteínas: Tradução e Modificações 20 Metabolismo de Purina e Pirimidina Nucletíde-
Pós-Tradução, 197 os, 770
7 DNA Recombinante e Biotecnologia, 241 21 Metabolismo do Heme e do Ferro, 803
8 Regulação da Expressão Gênica, 287 22 Inter-Relações Metabólicas, 829

|
PARTE V PROCESSOS
PARTE III
| FUNÇÕES
DE PROTEÍNAS
FISIOLÓGICOS

9 Proteínas II: Relações Estrutura-Função em 23 Bioquímica de Hormônios, 870


Famílias de Proteínas, 315 24 Biologia Molecular das Células, 925
10 Enzimas: Classificação, Cinética e Controle, 358 25 Ciclo Celular, Morte Celular Programada e Cân-
11 Citocromos P450 e Óxido Nítrico Sintases, 407 cer, 987
12 Membranas Biológicas: Estruturas e Transporte 26 Digestão e Absorção de Constituintes Nutricio-
em Membranas, 436 nais Básicos, 1009
13 Fundamentos da Transdução de Sinal, 483 27 Princípios de Nutrição I: Macronutrientes, 1043
28 Princípios de Nutrição II: Micronutrientes, 1063

APÊNDICE REVISÃO DE QUÍMICA


ORGÂNICA, 1094
GLOSSÁRIO, 1107
ÍNDICE, 1134

BioQ.00 7 22.01.07 16:25:01


CONTEÚDO | IX

CONTEÚDO
PREFÁCIO, XXI BIBLIOGRAFIA, 69
PREFÁCIO PARA A EDIÇÃO BRASILEIRA, XXIII QUESTÕES E RESPOSTAS, 70
AGRADECIMENTOS, XXV CORRELAÇÕES CLÍNICAS
TRADUTOR E CO-AUTORES, XXVII 2.1 Vacinas de DNA, 25
2.2 Uso Diagnóstico de Matrizes (Ar-
rays) de DNA em Medicina e Gené-

|
PARTE I ESTRUTURA DE
MACROMOLÉCULAS
tica, 38
2.3 Antibióticos Antitumorais que Mu-
dam a Forma do DNA, 42
2.4 Persistência Hereditária de Hemo-
1 | ESTRUTURA DA CÉLULA EUCARIÓTICA, 1 globina Fetal, 45
2.5 Telomerase como Alvo para Agen-
1.1 VISÃO GERAL: CÉLULAS E COMPARTI- tes Anticâncer, 46
MENTOS CELULARES, 2 2.6 Expansão de Tripletes de DNA re-
1.2 ÁGUA, PH E SOLUTOS: O AMBIENTE petitivos em Doença Humana, 48
AQUOSO DAS CÉLULAS, 3 2.7 Topoisomerases no Tratamento de
1.3 COMPOSIÇÃO DE CÉLULAS EUCARIÓTI- Doença, 52
CAS: PAPÉIS FUNCIONAIS DE ORGANE- 2.8 Resistência de Staphylococcus à
LAS SUBCELULARES E SISTEMAS DE Eritromicina, 65
MEMBRANAS, 11
1.4 INTEGRAÇÃO E CONTROLE DAS FUN-
ÇÕES CELURES, 19
BIBLIOGRAFIA, 20
3
| 73PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA,
QUESTÕES E RESPOSTAS, 20
CORRELAÇÕES CLÍNICAS 3.1 PAPÉIS FUNCIONAIS DE PROTEÍNAS NO
1.1 Concentração Sangüínea de Bicar- HOMEM, 74
bonato na Acidose Metabólica, 10 3.2 COMPOSIÇÃO EM AMINOÁCIDOS DE
1.2 Doenças Mitocondriais, 15 PROTEÍNAS, 75
1.3 Enzimas Lisossomais e Gota, 16 3.3 PROPRIEDADES DE CARGAS E QUÍMICAS
1.4 Deficiência de Lipase Ácida DE AMINOÁCIDOS E PROTEÍNAS, 81
Lisossomal, 18 3.4 ESTRUTURA PRIMÁRIA DE PROTEÍNAS, 88
1.5 Doenças da Biogênese de Peroxis- 3.5 NÍVEIS SUPERIORES DE ORGANIZAÇÃO
somos (PBDs), 19 PROTEÍCA, 90
3.6 OUTROS TIPOS DE PROTEÍNAS, 97
3.7 DOBRAMENTO (FOLDING) DE PROTEÍ-
2
| DNA
23
E RNA: COMPOSIÇÃO E ESTRUTURA,
NAS DE ESTRUTURAS ALEATÓRIAS
PARA SINGULARES: ESTABILIDADE DA
PROTEÍNA, 108
2.1 VISÃO GERAL, 24 3.8 ASPECTOS DINÂMICOS DA ESTRUTURA
2.2 COMPONENTES ESTRUTURAIS DOS ÁCI- DE PROTEÍNAS, 115
DOS NUCLÉICOS: NUCLEOBASES, NU- 3.9 CARACTERIZAÇÃO, PURIFICAÇÃO E
CLEOSÍDEOS E NUCLEOTÍDEOS, 26 DETERMINAÇÃO DA ESTRUTURA E OR-
2.3 ESTRUTURA DO DNA, 28 GANIZAÇÃO DE PROTEÍNAS, 116
2.4 ORDEM SUPERIOR DA ESTRUTURA DO BIBLIOGRAFIA, 128
DNA, 47 QUESTÕES E RESPOSTAS, 129
2.5 SEQÜÊNCIA E FUNÇÃO DO DNA, 57 CORRELAÇÕES CLÍNICAS
2.6 ESTRUTURA DO RNA, 61 3.1 Proteínas Plasmáticas no Diagnósti-
2.7 TIPOS DE RNA, 64 co de Doenças, 86

BioQ.00 9 22.01.07 16:25:01


X | CONTEÚDO

3.2 Diferenças em Insulinas Usadas em


Tratamento de Diabetes Mellitus,
89
5
| RNA: TRANSCRIÇÃO E PROCESSAMENTO,
172

3.3 Uma Mutação Não-Conservativa


Ocorre em Anemia Falciforme, 90 5.1 VISÃO GERAL, 173
3.4 Doenças de síntese de Colágeno, 98 5.2 MECANISMOS DE TRANSCRIÇÃO, 173
3.5 Hiperlipidemias, 103 5.3 TRANSCRIÇÃO EM EUCARIOTOS, 178
3.6 Hipolipoproteinemias, 105 5.4 PROCESSAMENTO DE RNA, 184
3.7 Hemoglobina Glicosilada, HbA1c , 5.5 EXPORTAÇÃO DO RNA E CONTROLE DE
108 QUALIDADE, 191
3.8 Proteínas Como Agentes Infeccio- 5.6 RNAs PEQUENOS INIBITÓRIOS, 192
sos: Príons e Encefalopatias Espon- 5.7 REPARO DO DNA ACOPLADO À TRANS-
giformes Transmissíveis Humanas CRIÇÃO, 192
(TSEs), 110 5.8 NUCLEASES E TURNOVER DO RNA, 193
3.9 Uso de Análise de Aminoácidos em BIBLIOGRAFIA, 194
Diagnóstico de Doenças, 121 QUESTÕES E RESPOSTAS, 195
CORRELAÇÕES CLÍNICAS
5.1 Antibióticos e Toxinas Que Têm

INFORMAÇÃO|
PARTE II TRANSMISSÃO DA RNA Polimerase Como Alvo, 176
5.2 Síndrome do X Frágil: Uma Doença
de RNA-Cromatina?, 179
5.3 Envolvimento de Fatores Transcrip-
cionais em Carcinogênese, 182
4
| REPLICAÇÃO, RECOMBINAÇÃO E REPARO
DO DNA, 132
5.4 Talassemia Devido a Defeitos na
Síntese de RNA Mensageiro, 188
5.5 Auto-Imunidade em Doença
4.1 CARACTERÍSTICAS COMUNS DA REPLI- do Tecico Conjuntivo, 189
CAÇÃO, RECOMBINAÇÃO E REPARO, 5.6 Síndrome de Cockayne, 193
133
4.2 REPLICAÇÃO DO DNA, 133
4.3 RECOMBINAÇÃO, 151
4.4 REPARO, 156
6
| SÍNTESE DE PROTEÍNAS: TRADUÇÃO E
MODIFICAÇÕES PÓS-TRADUÇÃO, 197

BIBLIOGRAFIA, 169 6.1 VISÃO GERAL, 198


QUESTÕES E RESPOSTAS, 169 6.2 COMPONENTES DO APARELHO DE TRA-
CORRELAÇÕES CLÍNICAS DUÇÃO, 198
4.1 Quimioterapia Pode Ter Como Al- 6.3 BIOSSÍNTESE DE PROTEÍNAS, 209
vos Precursores da Síntese do DNA, 6.4 AMADURECIMENTO DE PROTEÍNAS:
135 DOBRAMENTO, MODIFICAÇÃO, SECRE-
4.2 Topoisomerases Como Alvos Para ÇÃO E DIRECIONAMENTO, 218
Drogas, 144 6.5 DIRECIONAMENTO PARA MEMBRANA E
4.3 Câncer e o Ciclo Celular, 149 ORGANELAS, 224
4.4 Análogos de Nucleosídeos e Resis- 6.6 MAIS MODIFICAÇÕES PÓS-TRADUÇÃO,
tência a Drogas na Terapia do HIV, 227
149 6.7 REGULAÇÃO DA TRADUÇÃO, 234
4.5 Terapia Gênica, 156 6.8 DEGRADAÇÃO E TURNOVER DE PROTEÍ-
4.6 Quimioterapia, Lesão do DNA e NAS, 235
Reparo, 157 BIBLIOGRAFIA, 237
4.7 Análogos de Nucleosídeos Como QUESTÕES E RESPOSTAS, 239
Drogas: Tiopurinas, 158 CORRELAÇÕES CLÍNICAS
4.8 Medicina Individualizada, 159 6.1 Mutações Com Sentido Errado:
4.9 Xeroderma Pigmentoso, 162 Hemoglobina, 202
4.10 Reparo de Pareamento Errado e 6.2 Mutação Gerando Códon de Ter-
Câncer, 164 minação, 202
6.3 α-Talassemia, 203
6.4 Mudança na Fase de Leitura (Fra-
meshifting) Programada na Bios-
síntese das Proteínas de HIV, 204

BioQ.00 10 22.01.07 16:25:02


CONTEÚDO | XI
6.5 Mutação em RNA Ribossômico 7.2 Mapas de Restrição e Evolução, 246
Mitocondrial Resulta em Surdez 7.3 Seqüenciamento Direto de DNA
Induzida por Antibiótico, 217 para o Diagnóstico de Doenças
6.6 Deleção de um Códon, Modifica- Genéticas, 248
ção Pós-Tradução Incorreta e de 7.4 Análise por PCR Multiplex de
Gradação Prematura de Proteína: Defeitos no Gene de HGPRTase
Fibrose Cística, 219 na Síndrome de Lesch-Nyhan, 252
6.7 Dobramento Errado e Agregação 7.5 Polimorfismo de Comprimento de
de Proteína: Doença de Creuz- Fragmentos de Restrição Determina
feldt-Jacob, Doença da Vaca Lou- a Origem Clonal de Tumores, 257
ca, Doença de Alzheimer e Doen- 7.6 Polimorfismo de Conformação
ça de Huntington, 220 de Cadeia-Única para Detecção
6.8 Doenças de Função de Lisosso- de Mutações Espontâneas que
mos, 226 Podem Levar a SIDS, 259
6.9 Hiperproinsulinemia Familiar, 229 7.7 Mutagênese Sítio-Dirigida de
6.10 Ausência de modificação Pós-Tra- HSV IgD, 271
dução: Deficiência Múltipla de 7.8 Inibição de HIV Mediada por RNA,
Sulfatases, 230 274
6.11 Defeitos na Síntese de Colágeno, 7.9 Terapia Gênica: Genes Normais
233 Podem Ser Introduzidos em Células
com Genes Defectivos, 276
7
| DNA
241
RECOMBINANTE E BIOTECNOLOGIA, 7.10 Modelos de Animais Transgênicos,
277
7.11 Camundongos Knockout para
Definir um Papel para o
7.1 VISÃO GERAL, 242
Purinoceptor P2Y1, 279
7.2 A REAÇÃO DE POLIMERASE EM CADEIA 7.12 Análise por Microarray de Câncer
(POLYMERASE CHAIN REACTION), 243 de Mama, 280
7.3 ENDONUCLEASES DE RESTRIÇÃO E
MAPAS DE RESTRIÇÃO, 243
8 | REGULAÇÃO DA EXPRESSÃO GÊNICA, 287
7.4 SEQÜENCIAMENTO DE DNA, 245
7.5 DNA RECOMBINANTE E CLONAGEM,
248 8.1 VISÃO GERAL, 288
7.6 SELEÇÃO DE UM DNA ESPECÍFICO 8.2 UNIDADE DE TRANSCRIÇÃO EM
CLONADO EM BIBLIOTECAS, 252 BACTÉRIAS: O OPERON, 288
7.7 DETECÇÃO E IDENTIFICAÇÃO DE 8.3 OPERON LACTOSE DE E. COLI, 288
ÁCIDOS NUCLÉICOS E PROTEÍNAS QUE 8.4 OPERON TRIPTOFANO DE E. COLI, 293
LIGAM DNA, 254 8.5 OUTROS OPERONS BACTERIANOS, 297
7.8 DNA COMPLEMENTAR E BIBLIOTECAS 8.6 TRANSPOSONS BACTERIANOS, 299
DE DNA COMPLEMENTAR, 260 8.7 EXPRESSÃO GÊNICA EM EUCARIOTOS,
7.9 BACTERIÓFAGO, COSMÍDEO E VETORES 300
DE CLONAGEM EM LEVEDURA, 262 8.8 COMPLEXO DE PRÉ-INICIAÇÃO EM
7.10 ANÁLISE DE LONGAS SEQÜÊNCIAS DE EUCARIOTOS: FATORES DE TRANSCRI-
DNA, 265 ÇÃO, RNA POLIMERASE II E DNA, 303
7.11 VETORES DE EXPRESSÃO E PROTEÍNAS 8.9 REGULAÇÃO DA EXPRESSÃO GÊNICA
DE FUSÃO, 265 EUCARIÓTICA, 308
7.12 VETORES DE EXPRESSÃO EM CÉLULAS BIBLIOGRAFIA, 312
EUCARIÓTICAS, 267 QUESTÕES E RESPOSTAS, 312
7.13 MUTAGÊNESE SÍTIO-DIRIGIDA, 269 CORRELAÇÕES CLÍNICAS
7.14 APLICAÇÕES DA TECNOLOGIA DO DNA 8.1 Resistência Transmissível a Múltiplas
RECOMBINANTE, 272 Drogas, 300
7.15 GENÔMICA, PROTEÔMICA E ANÁLISE 8.2 Síndrome de Rubstein-Taybi, 302
MICROARRAY, 279 8.3 Tamoxifeno e Receptor de
BIBLIOGRAFIA, 283 Estrógeno como Alvo, 309
QUESTÕES E RESPOSTAS, 284 8.4 Fatores de Transcrição e Doença
CORRELAÇÕES CLÍNICAS Cardiovascular, 310
7.1 Reação de Polimerase em Cadeia
(Polymerase Chain Reaction), 245

BioQ.00 11 22.01.07 16:25:02


XII | CONTEÚDO

PARTE III | FUNÇÕES DE PROTEÍNAS CORRELAÇÕES CLÍNICAS


10.1 Mutação de um Sítio de Ligação de
Coenzima Resulta em Doença Clínica,
371

|
9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-
10.2 Um Caso de Gota Demonstra Duas Fases
FUNÇÃO EM FAMÍLIAS DE PROTEÍNAS, no Mecanismo de Ação Enzimática, 382
315 10.3 Efeito Fisiológico de Mudanças nos
Valores de Km de Enzimas, 383
10.4 Labilidade Térmica da Glicose-6-
9.1 VISÃO GERAL, 316 Fosfato Desidrogenase Resulta em
9.2 MOLÉCULAS DE ANTICORPOS: Anemia Hemolítica, 386
SUPERFAMÍLIA DE PROTEÍNAS 10.5 Isoenzimas da Álcool Desidrogenase
IMUNOGLOBULINAS, 316
com Diferentes pHs Ótimos, 386
9.3 PROTEÍNAS COM UM MECANISMO
10.6 Inibidores de Xantina Oxidase Isolados
CATALÍTICO COMUM: SERINO
de Plantas, 388
PROTEASES, 324
10.7 Planejamento de um Inibidor Seletivo,
9.4 HEMOGLOBINA E MIOGLOBINA, 334
390
9.5 O COMPLEXO PROTÉICO DA LÂMINA
10.8 Um Caso de Envenenamento, 393
BASAL, 347
10.9 Cogumelos e Metabolismo de Álcool,
BIBLIOGRAFIA, 355
393
QUESTÕES E RESPOSTAS, 355
10.10 Um Caso de Gota Demonstra a Dife-
CORRELAÇÕES CLÍNICAS
9.1 As Proteínas do Complemento, 319 rença entre um Sítio Alostérico e um
9.2 Funções de Diferentes Classes de Sítio de Ligação de Substrato, 394
Anticorpos, 319 10.11 Identificação e Tratamento de uma
9.3 Imunização, 320 Deficiência Enzimática, 400
9.4 Formação de Fibrina em um Infarto do 10.12 Ambigüidade no Ensaio de Enzimas
Miocárdio e Uso de Ativador de Mutadas, 401
Plasminogênio Tecidual Recombinante
(rt-PA), 326
9.5 Envolvimento de Serino Proteases em
Metástase de Células Tumorais, 326
11
| SINTASES,
CITOCROMOS P450 E ÓXIDO NÍTRICO
407
9.6 Hemoglobinopatias, 335
11.1 VISÃO GERAL, 408
11.2 CITOCROMOS P450: PROPRIEDADES E
10
| CONTROLE,
ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E
358
FUNÇÃO, 408
11.3 CICLO DE REAÇÃO DO CITOCROMO
P450, 409
10.1 VISÃO GERAL, 359 11.4 SISTEMAS DE TRANSPORTE DE
10.2 CLASSIFICAÇÃO DE ENZIMAS, 360 ELÉTRONS DOS CITOCROMOS P450, 410
10.3 CONCEITOS GERAIS DE MECANISMOS 11.5 CITOCROMO P450: NOMENCLATURA E
ENZIMÁTICOS, 363 ISOFORMAS, 412
10.4 SÍTIO ATIVO DE UMA ENZIMA, 368 11.6 CITOCROMOS P450: SUBSTRATOS E
10.5 COENZIMAS, CO-SUBSTRATOS E FUNÇÕES FISIOLÓGICAS, 413
COFATORES, 371 11.7 CITOCROMOS P450 PARTICIPAM DE
10.6 CINÉTICA DE REAÇÕES QUÍMICAS, 376 SÍNTESE DE HORMÔNIOS ESTERÓIDES
10.7 CINÉTICA ENZIMÁTICA DE REAÇÕES DE E DE OXIGENAÇÃO DE COMPOSTOS
UM SUBSTRATO, 379 ENDÓGENOS, 414
10.8 CINÉTICA DE REAÇÕES DE DOIS 11.8 INDUÇÃO E INIBIÇÃO DE CITOCROMO
SUBSTRATOS, 387 P450, 423
10.9 INIBIDORES, 388 11.9 AS ÓXIDO NÍTRICO SINTASES:
10.10 REGULAÇÃO DE ATIVIDADE ENZIMÁ- PROPRIEDADES E FUNÇÃO, 425
TICA, 394 11.10 ISOFORMAS DE ÓXIDO NÍTRICO
10.11 REGULAÇÃO DE VIAS METABÓLICAS, SINTASES E FUNÇÕES FISIOLÓGICAS
398 428
10.12 APLICAÇÕES CLÍNICAS DE ENZIMAS, 399 BIBLIOGRAFIA, 432
BIBLIOGRAFIA, 404 QUESTÕES E RESPOSTAS, 434
QUESTÕES E RESPOSTAS, 404

BioQ.00 12 22.01.07 16:25:03


CONTEÚDO | XIII
CORRELAÇÕES CLÍNICAS
11.1 Hiperplasia Adrenal Congênita:
Deficiência de CYP21A2, 416
13
| SINAL,
FUNDAMENTOS DA TRANSDUÇÃO DE
483

11.2 Produção de Hormônios Esteróides 13.1 VISÃO GERAL, 484


Durante a Gestação, 418 13.2 TRANSDUÇÃO DE SINAL INTERCELULAR,
11.3 Inibição de Citocromo P450: 485
Interações Droga-Droga e Efeitos 13.3 RECEPTORES PARA MOLÉCULAS
Adversos, 420 SECRETADAS, 487
11.4 Papel de CYP2E1 em Toxicidade 13.4 TRANSDUÇÃO DE SINAL INTRACELULAR
Hepática Induzida por POR RECEPTORES DE SUPERFÍCIE
Acetaminofen, 422 CELULAR, 488
11.5 Indução de Citocromo P450: 13.5 RECEPTORES CANAIS IÔNICOS LIGANTE-
Interações Droga-Droga e Efeitos DEPENDENTES, 493
Adversos, 423 13.6 RECEPTORES LIGADOS A ENZIMAS, 496
11.6 Polimorfismos Genéticos das 13.7 RECEPTORES DE CITOCINAS, 500
Enzimas P450, 426 13.8 RECEPTORES ACOPLADOS A PROTEÍNA
11.7 Mecanismo de Ação de Sildenafil, G, 500
430 13.9 TRANSDUÇÃO DE SINAL BASEADA EM
11.8 Aspectos Clínicos da Produção de AMP CÍCLICO, 506
Óxido Nítrico, 431 13.10 TRANSDUÇÃO DE SINAL BASEADA EM
11.9 História da Nitroglicerina, 432 GMP CÍCLICO, 509
13.11 TRANSDUÇÃO DE SINAL BASEADA EM
CÁLCIO, 512
12
| TRANSPORTE
MEMBRANAS BIOLÓGICAS: ESTRUTURA E
EM MEMBRANAS, 436
13.12 TRANSDUÇÃO DE SINAL BASEADA EM
FOSFOLIPÍDEOS, 514
BIBLIOGRAFIA, 517
12.1 VISÃO GERAL, 437 QUESTÕES E RESPOSTAS, 518
12.2 COMPOSIÇÃO QUÍMICA DE CORRELAÇÕES CLÍNICAS
MEMBRANAS, 438 13.1 Família de Receptores Tirosina
12.3 MICELAS, BICAMADAS LIPÍDICAS E Quinases ErbB/HER como Alvos
LIPOSSOMOS, 445 para Quimioterapia do Câncer, 498
12.4 ESTRUTURA DE MEMBRANAS 13.2 Receptores de Quimiocinas
BIOLÓGICAS, 447 Acoplados a Proteína G como Alvos
12.5 MOVIMENTO DE MOLÉCULAS ATRAVÉS para o Vírus da Imunodeficiência
DE MEMBRANAS, 456 Humana (HIV), 502
12.6 CANAIS DE MEMBRANAS, 458 13.3 Mutações em Proteína G Gsα em
12.7 TRANSPORTADORES DE MEMBRANA, Tumores de Glândula Pituitária e
466 Doenças Endócrinas, 504
12.8 TRANSPORTE PASSIVO, 468 13.4 Alterações em Proteínas
12.9 TRANSPORTE ATIVO, 469 Sinalizadoras de Receptor β-
12.10 IONÓFOROS, 478 Adrenérgico em Insuficiência
BIBLIOGRAFIA, 479 Cardíaca Congestiva, 507
QUESTÕES E RESPOSTAS, 480 13.5 Eixos Sinalizadores Óxido Nítrico/
CORRELAÇÕES CLÍNICAS cGMP como Alvos Terapêuticos em
12.1 Lipossomos como Carregadores de Doenças Cardíacas e Vasculares, 511
Drogas e Enzimas, 447
12.2 Anomalias na Fluidez de
Membranas Celulares em Doenças,
454
12.3 Fibrose Cística e o Canal de Cl –, 460
12.4 O Rim de Mamíferos e
Aquaporinas, 462
12.5 Doenças Envolvendo a Superfamília
de Transportadores ABC, 475
12.6 Doenças que se Devem à Perda de
Sistemas de Transporte de
Membranas, 476

BioQ.00 13 22.01.07 16:25:03


XIV | CONTEÚDO

|
PARTE IV VIAS METABÓLICAS E SEU 15.6 GLICOGENÓLISE E GLICOGÊNESE, 609
BIBLIOGRAFIA, 623
CONTROLE QUESTÕES E RESPOSTAS, 623
CORRELAÇÕES CLÍNICAS
15.1 Álcool e Barbituratos, 584
14
| BIOENERGÉTICA
OXIDATIVO, 521
E METABOLISMO 15.2 Envenenamento por Arsênico, 585
15.3 Intolerância à Frutose, 587
15.4 Diabetes Mellitus, 589
14.1 SISTEMAS DE PRODUÇÃO E DE 15.5 Acidose Láctica, 591
UTILIZAÇÃO DE ENERGIA, 522 15.6 “Picles” de Porco e Hipertermia
14.2 RELAÇÕES TERMODINÂMICAS E Maligna, 592
COMPONENTES RICOS EM ENERGIA, 524 15.7 Angina Pectoris e Infarto do
14.3 FONTES E DESTINOS DA ACETIL- Miocárdio, 593
COENZIMA A, 529 15.8 Deficiência de Piruvato Quinase e
14.4 CICLO DOS ÁCIDOS TRICARBOXÍLICOS, Anemia Hemolítica, 598
534 15.9 Hipoglicemia e Crianças Prematu-
14.5 ESTRUTURA E COMPARTIMENTALI- ras, 599
ZAÇÃO POR MEMBRANAS MITOCON- 15.10 Hipoglicemia e Intoxicação
DRIAIS, 540 Alcoólica, 608
14.6 CADEIA DE TRANSPORTE DE ELÉTRONS, 15.11 Doenças de Armazenamento de
542 Glicogênio, 612
14.7 FOSFORILAÇÃO OXIDATIVA, 553
14.8 MEMBRANA MITOCONDRIAL INTERNA

|
CONTÉM SISTEMAS DE TRANSPORTE DE 16 METABOLISMO DE CARBOIDRATOS II:
SUBSTRATO 559 VIAS ESPECIAIS E GLICOCONJUGADOS,
14.9 GENES MITOCONDRIAIS E DOENÇAS, 626
563
14.10 ESPÉCIES REATIVAS DE OXIGÊNIO (ROS), 16.1 VISÃO GERAL, 627
565 16.2 VIA DAS PENTOSES FOSFATO, 627
BIBLIOGRAFIA, 568 16.3 INTERCONVERSÕES DE AÇÚCARES
QUESTÕES E RESPOSTAS, 569 E FORMAÇÃO DE NUCLEOTÍDEO-
CORRELAÇÕES CLÍNICAS AÇÚCAR, 631
14.1 Deficiência de Piruvato 16.4 BIOSSÍNTESE DE CARBOIDRATOS
Desidrogenase, 533 COMPLEXOS, 637
14.2 Deficiência de Fumarase, 537 16.5 GLICOPROTEÍNAS, 638
14.3 Envenenamento por Cianeto, 552 16.6 PROTEOGLICANOS, 642
14.4 Neuropatia Óptica Hereditária de BIBLIOGRAFIA, 647
Leber, 564 QUESTÕES E RESPOSTAS, 647
14.5 Miopatias Mitocondriais Devido a CORRELAÇÕES CLÍNICAS
Mutações em Genes de tRNA, 564 16.1 Glicose 6-Fosfato Desidrogenase:
14.6 Intolerância a Exercício Deficiência Genética ou presença
em Pacientes com Mutações no de Variantes Genéticas em
Citocromo b, 565 Eritrócitos, 629
14.7 Lesão por Isquemia/Reperfusão, 16.2 Síndrome de Wernicke-Korsakoff:
567 Deficiência ou Presença de Varian-
tes Genéticos de Transcetolase,
629

|
15 METABOLISMO DE CARBOIDRATOS I: 16.3 Síndromes de Glicoproteínas
PRINCIPAIS VIAS METABÓLICAS E SEU Deficientes em Carboidratos
CONTROLE, 572 (CDGS), 632
16.4 Frutosúria Essencial e Intolerância
à Frutose: Deficiência de Frutoqui-
15.1 VISÃO GERAL, 573 nase e de Frutose 1-Fosfato Aldo-
15.2 GLICÓLISE, 574 lase, 633
15.3 VIA GLICOLÍTICA, 577 16.5 Galactosemia: Incapacidade de
15.4 REGULAÇÃO DA GLICÓLISE, 584 Transformar Galactose em Glicose,
15.5 GLUCONEOGÊNESE, 597 634

BioQ.00 14 22.01.07 16:25:04


CONTEÚDO | XV

|
16.6 Pentosúria: Deficiência de Xilitol 18 METABOLISMO DE LIPÍDEOS II: VIAS DO
Desidrogenase, 635 METABOLISMO DE LIPÍDEOS ESPECIAIS,
16.7 Ácido Glucurônico: Significado 683
Fisiológico da Formação de
Glucuronídeos, 635
18.1 VISÃO GERAL, 684
16.8 Substâncias dos Grupos Sangüí-
18.2 FOSFOLIPÍDEOS, 684
neos, 638
18.3 COLESTEROL, 694
16.9 Carboidrato Marcador Comum do
18.4 ESFINGOLIPÍDEOS, 706
Direcionamento Lisossomal e
18.5 PROSTAGLANDINAS E TROMBOXANES,
Doença da Célula I, 640
714
16.10 Aspartilglicosilaminúria: Ausência
18.6 LIPOXIGENASE E ÁCIDOS
de 4-L-Aspartilglicosamina Amido-
OXIEICOSATETRAENÓICOS, 718
hidrolase, 641
BIBLIOGRAFIA, 721
16.11 Doenças de Glicolipídeos, 642
QUESTÕES E RESPOSTAS, 722
16.12 Heparina é um Anticoagulante,
CORRELAÇÕES CLÍNICAS
643
18.1 Síndrome do Desconforto
16.13 Condrodistrofias Devidas a
Respiratório, 687
Defeitos de Sulfatação, 645
18.2 Tratamento da Hipercolesterolemia,
16.14 Mucopolissacaridoses, 646
703
18.3 Aterosclerose, 704

|
18.4 Diagnóstico da Doença de Gaucher
17 METABOLISMO DE LIPÍDEOS I: SÍNTESE,
em um Adulto, 713
ARMAZENAMENTO E UTILIZAÇÃO DE
ÁCIDOS GRAXOS E TRIACILGLICERÓIS, 650 19 | METABOLISMO DE AMINOÁCIDOS, 725
17.1 VISÃO GERAL, 651
17.2 NATUREZA QUÍMICA DE ÁCIDOS 19.1 VISÃO GERAL, 726
GRAXOS E ACILGLICERÓIS, 652 19.2 INCORPORAÇÃO DE NITROGÊNIO EM
17.3 TRANSPORTE INTERÓRGÃOS DE ÁCIDOS AMINOÁCIDOS, 727
19.3 TRANSPORTE DE NITROGÊNIO PARA
GRAXOS E SEUS PRODUTOS PRIMÁRIOS,
FÍGADO E RIM, 732
656
19.4 CICLO DA URÉIA, 733
17.4 SÍNTESE DE ÁCIDOS GRAXOS:
19.5 SÍNTESE E DEGRADAÇÃO DE
LIPOGÊNESE, 657 AMINOÁCIDOS INDIVIDUAIS, 736
17.5 ARMAZENAMENTO DE ÁCIDOS GRAXOS BIBLIOGRAFIA, 766
COMO TRIACILGLICERÓIS, 665 QUESTÕES E RESPOSTAS, 767
17.6 UTILIZAÇÃO DE ÁCIDOS GRAXOS PARA CORRELAÇÕES CLÍNICAS
PRODUÇÃO DE ENERGIA, 667 19.1 Deficiências de Carbamoil Fosfato
17.7 REGULAÇÃO DO METABOLISMO DE Sintetase e N-Acetilglutamato
LIPÍDEOS, 679 Sintetase, 736
BIBLIOGRAFIA, 680 19.2 Deficiências de Enzimas do Ciclo
QUESTÕES E RESPOSTAS, 681 da Uréia, 738
CORRELAÇÕES CLÍNICAS 19.3 Doenças do Metabolismo de
17.1 Obesidade, 654 Prolina, 739
17.2 Papel do Metabolismo de Ácidos 19.4 Selenoproteínas, 740
Graxos em Diabetes Tipo 2, 655 19.5 Hiperglicinemia Não-Cetótica, 741
17.3 Ciclo Triacilglicerol/Ácido Graxo, 19.6 Deficiência de Ácido Fólico, 743
668 19.7 Fenilcetonúria, 745
17.4 Deficiências Genéticas no 19.8 Doenças do Metabolismo de
Transporte por Carnitina ou na Tirosina, 747
Carnitina Palmitoil Transferase, 670 19.9 Mal de Parkinson, 748
19.10 Hiper-homocisteinemia e
17.5 Deficiências Genéticas das Acil-CoA
Aterogênese, 751
Desidrogenases, 672
19.11 Doenças de Aminoácidos
17.6 Doença de Refsum, 675
que Contêm Enxofre, 752
17.7 Corpos Cetônicos como Combustí- 19.12 Acidúria Glutárica, 756
veis: A Dieta Atkins, 677 19.13 Esquizofrenia e Outras Doenças
Associadas a Neurotransmissores
Derivados de Triptofano, 757

BioQ.00 15 22.01.07 16:25:04


XVI | CONTEÚDO

19.14 Doenças do Metabolismo de


Aminoácidos de Cadeia Ramifi-
cada, 757
21
| 803
METABOLISMO DO HEME E DO FERRO,

19.15 Doenças do Metabolismo de


Propionato e Metilmalonato, 760 21.1 METABOLISMO DO FERRO: VISÃO
19.16 Doenças Envolvendo Lisina e GERAL, 804
Ornitina, 762 21.2 PROTEÍNAS QUE CONTÊM FERRO, 804
19.17 Histidinemia, 762 21.3 ABSORÇÃO INTESTINAL DE FERRO, 807
19.18 Doenças do Metabolismo de 21.4 REGULAÇÃO MOLECULAR DA
Folato, 764 UTILIZAÇÃO DE FERRO, 808
21.5 DISTRIBUIÇÃO E CINÉTICA DO FERRO,
811
21.6 BIOSSÍNTESE DE HEME, 813
20
| METABOLISMO DE PURINA E PIRIMIDINA
NUCLEOTÍDEOS, 770
21.7 CATABOLISMO DE HEME, 821
BIBLIOGRAFIA, 826
QUESTÕES E RESPOSTAS, 827
20.1 VISÃO GERAL, 771 CORRELAÇÕES CLÍNICAS
20.2 FUNÇÕES METABÓLICAS DOS 21.1 Sobrecarga de Ferro e Infecção,
NUCLEOTÍDEOS, 771 805
20.3 METABOLISMO DE PURINA 21.2 Patogenicidade Microbiana e
NUCLEOTÍDEOS, 772 Ferro, 805
20.4 METABOLISMO DE PIRIMIDINA 21.3 Síntese do Grupo Ferro-Enxofre e
NUCLEOTÍDEOS, 783 Doença Humana, 807
20.5 FORMAÇÃO DE DESOXIRRIBONUCLEO- 21.4 Ataxia de Friedreich, 807
TÍDEOS, 786 21.5 Absorção Duodenal de Ferro, 809
20.6 NUCLEOSÍDEO E NUCLEOTÍDEO 21.6 Elementos de Resposta ao Ferro
QUINASES, 789 Mutante, 811
20.7 ENZIMAS QUE METABOLIZAM 21.7 Deficiência de Ceruloplasmina, 812
NUCLEOTÍDEOS COM UMA FUNÇÃO 21.8 Anemia por Deficiência de Ferro,
EM CICLO CELULAR E TAXA DE DIVISÃO 812
CELULAR, 790 21.9 Hemocromatose Tipo I: Genética
20.8 SÍNTESE DE COENZIMAS NUCLEOTÍDEOS, Molecular e a Questão das Dietas
791 Enriquecidas em Ferro, 814
20.9 SÍNTESE E UTILIZAÇÃO DE 5-FOSFOR- 21.10 Hemocromatose Tipo III, 814
RIBOSIL-1-PIROFOSFATO, 791 21.11 Porfiria Intermitente Aguda, 817
20.10 AGENTES QUIMIOTERÁPICOS QUE 21.12 Papel Citoprotetor de Heme
INTERFEREM COM METABOLISMO DE Oxigenase, 822
PURINA E PIRIMIDINA NUCLEOTÍDEOS, 21.13 Hemólise Isoimune Neonatal, 824
793 21.14 Deficiência de Bilirrubina UDP-
BIBLIOGRAFIA, 799 Glucuronosiltransferase, 824
QUESTÕES E RESPOSTAS, 800 21.15 Elevação de Bilirrubina Conjugada
CORRELAÇÕES CLÍNICAS no Soro, 825
20.1 Gota, 777
20.2 Síndrome de Lesch-Nyhan, 779
20.3 Atividade Aumentada da 5’- 22 | INTER-RELAÇÕES METABÓLICAS, 829
Nucleotidase Citosólica, 781
20.4 Doenças com Imunodeficiências 22.1 VISÃO GERAL, 830
Associadas com Defeitos na 22.2 CICLO JEJUM-ALIMENTAÇÃO, 830
Degradação de Purina Nucleo- 22.3 MECANISMOS ENVOLVIDOS NA
sídeos, 782 MUDANÇA DO METABOLISMO HEPÁ-
20.5 Pacientes com Câncer em TICO ENTRE OS ESTADOS BEM-
Tratamento por Radiações ou ALIMENTADO E DE JEJUM, 843
Quimioterapia, 783 22.4 INTER-RELAÇÕES METABÓLICAS DE
20.6 Subclasses de Pacientes com TECIDOS EM VÁRIOS ESTADOS
Autismo, 783 NUTRICIONAIS E HORMONAIS, 852
20.7 Acidúria Orótica Hereditária, 785 BIBLIOGRAFIA, 866
QUESTÕES E RESPOSTAS, 868

BioQ.00 16 22.01.07 16:25:05


CONTEÚDO | XVII
CORRELAÇÕES CLÍNICAS
22.1 Obesidade, 831
22.2 Subnutrição Protéica, 832
24
| 925
BIOLOGIA MOLECULAR DAS CÉLULAS,

22.3 Jejum, 833


22.4 Síndrome de Reye, 837 24.1 VISÃO GERAL, 926
22.5 Coma Hiperglicêmico, 24.2 TECIDO NERVOSO: METABOLISMO E
Hiperosmolar, 841 FUNÇÃO, 926
22.6 Hiperglicemia e Glicação de 24.3 OLHO: METABOLISMO E VISÃO, 938
Proteínas, 841 24.4 MOTORES MOLECULARES E PROTEÍNAS
22.7 Diabetes Mellitus Tipo 2, 855 ASSOCIADAS, 952
22.8 Diabetes Mellitus Tipo 1, 857 24.5 MECANISMO DA COAGULAÇÃO DO
22.9 Via do Poliol e Complicações do SANGUE, 967
Diabetes, 857 BIBLIOGRAFIA, 983
22.10 Caquexia do Câncer, 858 QUESTÕES E RESPOSTAS, 984
CORRELAÇÕES CLÍNICAS

|
24.1 Síndrome Miastênica de Lambert-
PARTE V PROCESSOS Eaton, 933
FISIOLÓGICOS 24.2 Miastenia Gravis: Uma Doença
Neuromuscular, 935
24.3 Degeneração da Mácula e Perda
23 | BIOQUÍMICA DE HORMÔNIOS, 870 de Visão, 942
24.4 Doença de Niemann-Pick e
Retinite Pigmentosa, 942
23.1 VISÃO GERAL, 871
23.2 HORMÔNIOS E O SISTEMA DE CASCATA 24.5 Retinite Pigmentosa por Mutação
HORMONAL, 872 do Gene da Periferina, 944
23.3 SÍNTESE DE HORMÔNIOS 24.6 Amaurose Congênita de Leber:
POLIPEPTÍDICOS E HORMÔNIOS DERI- Distrofia da Retina Levando a
VADOS DE AMINOÁCIDOS, 875 Cegueira, 949
23.4 PROTEÍNAS DE SINALIZAÇÃO 24.7 Glicação e Estrutura e Função de
HORMONAL, 883 Miosina, 956
23.5 RECEPTORES DE HORMÔNIOS DE 24.8 Cardiomiopatias Hipertróficas
MEMBRANA, 891 Familiares e Mutações em
23.6 CASCATA HORMONAL INTRACELULAR: Proteínas Musculares, 957
PROTEÍNAS QUINASES, 894 24.9 Cardiomiopatia Dilatada e
23.7 HORMÔNIOS ESTERÓIDES, 902 Mutações em Actina, 958
23.8 RECEPTORES DE HORMÔNIOS 24.10 Subunidades da Troponina como
ESTERÓIDES, 914 Marcadores de Infarto do
BIBLIOGRAFIA, 921 Miocárdio, 961
QUESTÕES E RESPOSTAS, 922 24.11 Canelopatias de Íons Voltagem-
CORRELAÇÕES CLÍNICAS Dependentes, 962
23.1 Testando a Atividade da Pituitária 24.12 Canais Iônicos e Doença do
Anterior, 875 Músculo Cardíaco, 962
23.2 Hipopituitarismo, 879 24.13 Mutações Afetando Pigmentação:
23.3 Atividade Reduzida do Receptor Existe uma Conexão com Motor
de Insulina Quinase no Diabetes Molecular?, 965
Mellitus Gestacional, 897 24.14 Defeitos da Via Intrínseca:
23.4 Contracepção Oral, 913 Deficiência de Pré-calicreína, 970
23.5 Síndrome do Excesso Aparente de 24.15 Hemofilia Clássica, 974
Mineralocorticóide, 917 24.16 Uso de Fator VIIa Recombinante
23.6 Mutação no Receptor de para Controlar Sangramento, 975
Mineralocorticóide Resulta em 24.17 Trombose: Defeitos na Via da
Hipertensão e Toxemia da Gravidez, Proteína C e Níveis Aumentados
919 de Fatores da Coagulação, 979

BioQ.00 17 22.01.07 16:25:05


XVIII | CONTEÚDO

25
| CICLO CELULAR, MORTE CELULAR
PROGRAMADA E CÂNCER, 987
27
| PRINCÍPIO DE NUTRIÇÃO I:
MACRONUTRIENTES, 1043

25.1 VISÃO GERAL, 988 27.1 VISÃO GERAL, 1044


25.2 CICLO CELULAR, 988 27.2 METABOLISMO ENERGÉTICO, 1044
25.3 APOPTOSE: MORTE CELULAR 27.3 METABOLISMO DE PROTEÍNAS, 1045
PROGRAMADA, 993 27.4 DESNUTRIÇÃO PROTÉICO-ENERGÉTICA,
25.4 CÂNCER, 997 1048
BIBLIOGRAFIA, 1005 27.5 EXCESSIVA INGESTÃO PROTÉICO-
QUESTÕES E RESPOSTAS, 1007 ENERGÉTICA, 1050
CORRELAÇÕES CLÍNICAS 27.6 CARBOIDRATOS, 1051
25.1 Vírus Oncogênicos de DNA, 999 27.7 GORDURAS, 1051
25.2 Droga Anti-Câncer Molecularmente 27.8 FIBRAS, 1052
Dirigida, 1002 27.9 COMPOSIÇÃO DOS MACRONUTRIENTES
25.3 Causa Ambiental de Cânceres DA DIETA, 1054
Humanos, 1003 BIBLIOGRAFIA, 1059
QUESTÕES E RESPOSTAS, 1060

|
26 DIGESTÃO E ABSORÇÃO DE CORRELAÇÕES CLÍNICAS
CONSTITUINTES NUTRICIONAIS BÁSICOS, 27.1 Dietas Vegetarianas e Necessidades
1009 Protéico-Energéticas para Crianças,
1047
27.2 Ingestão de Proteínas na Dieta e
26.1 VISÃO GERAL, 1010
Doença Renal, 1048
26.2 CONSIDERAÇÕES GERAIS, 1012
27.3 Oferecendo Proteínas e Calorias
26.3 TRANSPORTE EPITELIAL, 1016
Adequadas a Pacientes Hospitali-
26.4 DIGESTÃO E ABSORÇÃO DE PROTEÍNAS,
zados, 1049
1024
27.4 Carga de Carboidratos e Resistência
26.5 DIGESTÃO E ABSORÇÃO DE
Atlética, 1052
CARBOIDRATOS, 1028
27.5 Dietas Ricas em Carboidratos Versus
26.6 DIGESTÃO E ABSORÇÃO DE LIPÍDEOS,
Dietas Ricas em Gorduras para
1031
Diabéticos, 1053
26.7 METABOLISMO DE ÁCIDOS BILIARES,
27.6 Ácidos Graxos Poliinsaturados e
1037
Fatores de Risco para Doença
BIBLIOGRAFIA, 1040
Cardíaca, 1055
QUESTÕES E RESPOSTAS, 1040
27.7 Adaptação Metabólica:
CORRELAÇÕES CLÍNICAS
Relação entre Ingestão de Carboi-
26.1 Cloridorréia Familiar Causa Alcalose
dratos e Triacilgliceróis no Soro,
Metabólica, 1017
1059
26.2 Fibrose Cística, 1020
26.3 Diarréias Toxigênicas Bacterianas e
Terapia de Reposição de Eletrólitos,
1021
26.4 Aminoacidúria Neutra: Doença de
28
| PRINCÍPIO DE NUTRIÇÃO II:
MICRONUTRIENTES, 1063
Hartnup, 1026
26.5 Deficiência de Dissacaridases, 1030 28.1 VISÃO GERAL, 1064
26.6 Intervenções Farmacológicas para 28.2 AVALIAÇÃO DE MÁ NUTRIÇÃO, 1064
Evitar Absorção de Gordura e 28.3 INGESTÃO DIETÉTICAS DE REFERÊNCIAS,
Obesidade, 1033 1064
26.7 Cálculos de Colesterol, 1036 28.4 VITAMINAS LIPOSSOLÚVEIS, 1066
26.8 A-β-Lipoproteinemia, 1038 28.5 VITAMINAS HIDROSSOLÚVEIS, 1073
28.6 VITAMINAS HIDROSSOLÚVEIS
LIBERADORAS DE ENERGIA, 1074
28.7 VITAMINAS HIDROSSOLÚVEIS
HEMATOPOIÉTICAS, 1079
28.8 OUTRAS VITAMINAS HIDROSSOLÚVEIS,
1082
28.9 MACROMINERAIS, 1084
28.10 MINERAIS TRAÇOS, 1084

BioQ.00 18 22.01.07 16:25:05


CONTEÚDO | XIX
28.11 DIETA AMERICANA: FATO E FALÁCIA, 28.5 Considerações Nutricionais em
1087 Alcoólatras, 1076
28.12 AVALIAÇÃO DO ESTADO NUTRICIONAL 28.6 Necessidades de Vitamina B6 em
NA PRÁTICA CLÍNICA, 1087 Usuários de Contraceptivos Orais,
BIBLIOGRAFIA, 1089 1078
QUESTÕES E RESPOSTAS, 1091 28.7 Polimorfirmos Genéticos e
CORRELAÇÕES CLÍNICAS Necessidades de Ácido Fólico, 1081
28.1 Considerações Nutricionais na 28.8 Dieta e Osteoporose, 1085
Fibrose Cística, 1068 28.9 Necessidades Nutricionais de
28.2 Osteodistrofia Renal, 1069 Idosos, 1089
28.3 Considerações Nutricionais em
Recém-Nascidos, 1073 APÊNDICE
28.4 Drogas Anticonvulsivantes e REVISÃO DE QUÍMICA ORGÂNICA, 1094
Necessidades Vitamínicas, 1074 GLOSSÁRIO, 1107
ÍNDICE, 1134

BioQ.00 19 22.01.07 16:25:06


CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA | 1

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS

1
�–

H H

�+
104.5o �+

ESTRUTURA DA CÉLULA
EUCARIÓTICA
Thomas M. Devlin

1.1 VISÃO GERAL: CÉLULAS E COMPARTIMENTOS Retículo endoplasmático participa da síntese


CELULARES, 2 protéica e de muitas vias de síntese, 13
Complexo de Golgi está envolvido na secreção de
1.2 ÁGUA, pH E SOLUTOS: O AMBIENTE AQUOSO proteínas, 14
DAS CÉLULAS, 3 Mitocôndria fornece a maior parte do ATP de que
Pontes de hidrogênio formam-se entre moléculas a célula necessita, 14
de água, 3 Lisossomos são necessários para digestão intrace-
Água tem propriedades singulares como solvente, lular, 15
4 Peroxissomos desempenham papel importante
Algumas moléculas dissociam-se formando cátions no metabolismo de lipídeos, 17
e ânions, 5 Citoesqueleto organiza o conteúdo intracelular,
Água é um eletrólito fraco, 6 18
Muitas moléculas biologicamente importantes são Citosol contém componentes celulares solúveis,
ácidos ou bases fracos, 6 18
Ácido carbônico, 7
Equação de Henderson-Hasselbalch define a rela- 1.4 INTEGRAÇÃO E CONTROLE DAS FUNÇÕES
ção entre pH e concentrações de ácido e base CELULARES, 19
conjugados, 8
Tamponamento é importante para controlar o pH, BIBLIOGRAFIA, 20
9
QUESTÕES E RESPOSTAS, 20
1.3 COMPOSIÇÃO DE CÉLULAS EUCARIÓTICAS:
PAPÉIS FUNCIONAIS DE ORGANELAS SUBCE- CORRELAÇÕES CLÍNICAS
LULARES E SISTEMAS DE MEMBRANAS, 11 1.1 Concentração Sangüínea de Bicarbonato na
Composição química geral das células, 12 Acidose Metabólica, 10
Papel funcional de organelas subcelulares e siste- 1.2 Doenças Mitocondriais, 15
mas de membranas, 13 1.3 Enzimas Lisossomais e Gota, 16
Membrana Plasmática é a fronteira de uma 1.4 Deficiência de Lipase Ácida Lisossomal, 18
célula, 13 1.5 Doenças da Biogênese de Peroxissomos
Núcleo é local de síntese de DNA e RNA, 13 (PBDs), 19

BioQ.01 1 22.01.07 16:09:40


|
CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA | 11

1.3 COMPOSIÇÃO Partição de atividades e componentes em espaços


delimitados por membranas tem muitas vantagens para
DE CÉLULAS a economia da célula, incluindo (a) seqüestro de subs-
EUCARIÓTICAS: tratos, cofatores e enzimas para maior eficiência me-
tabólica e (b) ajuste de pH e composição iônica para
PAPÉIS FUNCIONAIS máxima atividade de processos biológicos.
DE ORGANELAS As atividades e a composição de estruturas e organe-
ER
las celulares são determinadas em células intactas por
SUBCELULARES métodos histoquímicos, imunológicos Pe de coloração
E SISTEMAS DE fluorescente. Observações contínuas em tempo real de
eventos celulares em células intactas viáveis são possí-
MEMBRANAS veis. Por exemplo, mudanças de pH e de concentração
M
de íon cálcio podem ser estudadas no citosol pelo uso
de indicadores íon-específicos. Organelas individuais,
ER
Células eucarióticas contêm organelas celulares membranas e componentes do citosol podem ser isola-
bem definidas, como núcleo, mitocôndrias, lisossomos dos eG analisados após rompimento da membrana plas-
e peroxissomos, todos delimitados por uma membrana mática. Técnicas
Ly para romper membranas Núcleo
incluem uso
(Figura 1.9). Membranas formam uma rede tubular por de detergentes, choque osmótico ou homogeneização de
toda a célula, o retículo endoplasmático e o complexo tecidos, onde o atrito quebra a membrana plasmática.
de Golgi, englobando um espaço interconectado ou cis- Em meios de isolamento apropriados, organelas celula-
Nucléolo
ternas, respectivamente. A natureza lipídeo-proteína res e sistemas de membranas podem ser separados por
das membranas celulares (ver p. 455) impede rápi- centrifugação, graças a diferenças em tamanho e densi-
do movimento de muitas moléculas, incluindo água, de dade. Essas técnicas permitiram isolamento de frações
um compartimento para outro. Mecanismos específicos celulares da maioria dos tecidos de mamíferos. Além
para deslocamento de moléculas pequenas e grandes, M
disso, componentes de organelas, como mitocôndrias e
carregadas ou não-carregadas, permitem que as várias peroxissomos, podem ser isolados após rompimento da
membranas modulem concentrações de substâncias em membrana da organela. Pelo uso dessas várias técnicas,
seus compartimentos. Citosol e compartimento fluido as atividades e as funções dos vários compartimentos
de organelas têm composição distinta em íons inorgâni- (a)
celulares foram estudadas.
cos, moléculas orgânicas, proteínas e ácidos nucléicos.
Membrana nuclear
Centríolos
Núcleo
Complexo
de Golgi
Nucléolo

Cromatina
ER

Ribossomos
livres Vacúolo

M Retículo
endoplasmático

ER Mitocôndria

G (b) Lisossomos Membrana celular


Ly Núcleo
FIGURA 1.9
(a) Micrografia eletrônica de uma célula de fígado de rato,
marcada para indicar os principais componentes estruturais de
células eucarióticas e (b) desenho esquemático de uma célula
Nucléolo animal. Note o número e a variedade de organelas subcelulares
e a rede de membranas interconectadas que delimitam
canais ou cisternas. Nem todas as células eucarióticas são
tão complexas em sua aparência, mas a maioria contém as
principais estruturas mostradas. ER, retículo endoplasmático;
G, zona do Golgi; Ly, lisossomo; P, peroxissomo; M,
M mitocôndria.
Fotografia (a) reimpressa com permissão de Dr. K. R. Porter
de Porter, K. R., e Bonneville, M. A. Em: Fine Structure of
Cells and Tissues. Philadelphia: Lea & Febiger, 1972; esquema
(b) reimpresso com permissão de Voet, D., e Voet, J. G.
Biochemistry, 2ª ed., New York, Wiley, 1995. © (1995) John
(a)
Wiley & Sons, Inc.

Membrana nuclear
Centríolos
Núcleo
BioQ.01 11 Complexo 22.01.07 16:09:57
CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA | 15
pendência mútua. Estima-se que esse evento possa ter no-enxofre e oxigênio-fósforo em proteínas, lipídeos,
ocorrido há cerca de três bilhões de anos. A herança carboidratos e ácidos nucléicos. Uma lista parcial das
mitocondrial ocorre por transmissão materna e tem enzimas lisossomais é apresentada na Tabela 1.7. Hi-
sido possível estudar o movimento global humano por drolases lisossomais são mais ativas em pHs ácidos e
avaliação das variações em mtDNA. Mitocôndrias tam- quebram moléculas complexas em compostos simples
bém têm os RNAs (ver p. 66) e enzimas necessárias de baixo peso molecular que podem ser reutilizados. A
para catalisar a síntese de algumas proteínas. A maioria relação entre pH e atividade enzimática é discutida na
das proteínas mitocondriais, entretanto, derivaram de p. 368.
genes presentes no DNA nuclear e são sintetizadas em O conteúdo enzimático dos lisossomos varia em di-
ribossomos livres no citosol, depois importadas para a ferentes tecidos e depende das funções específicas do
organela. Há várias centenas de doenças genéticas de tecido. A membrana lisossomal contém mediadores e
atividades mitocondriais; algumas resultam de muta- receptores protéicos específicos, bem como transporta-
ções no DNA nuclear que codifica proteínas mitocon- dores para deslocamento de substâncias através dela.
driais, enquanto outras resultam de mutações no DNA Lisossomos isolados só catalisam hidrólise de subs-
mitocondrial (ver Corr. Clín. 1.2). tratos adicionados quando a membrana lisossomal é
rompida. Rompimento da membrana em células leva à
Lisossomos São Necessários para Digestão digestão celular. Várias condições patológicas têm sido
atribuídas à liberação de enzimas lisossomais, incluin-
Intracelular do artrite, respostas alérgicas, várias doenças muscula-
Lisossomos são responsáveis pela digestão intrace- res e destruição tecidual induzida por drogas (ver Corr.
lular de substâncias extracelulares e intracelulares. Clín. 1.3).
Com uma única membrana delimitante, mantêm uma
matriz com pH ácido de cerca de 5. Encapsulada nes-
sas organelas está uma classe de enzimas glicoprotéi-
cas – hidrolases – que catalisam clivagem hidrolítica de
ligações carbono-oxigênio, carbono-nitrogênio, carbo-

CORRELAÇÃO CLÍNICA 1.2


Doenças Mitocondriais
A primeira doença (doença de Luft) envolvendo es- tia Óptica Hereditária de Leber, que leva a ceguei-
pecificamente transdução de energia mitocondrial ra súbita no início da idade adulta. Muitas doenças
foi relatada em 1962. Uma paciente de 30 anos de mitocondriais envolvem músculo esquelético e sis-
idade apresentava fraqueza generalizada, transpi- tema nervoso central. Lesões no DNA mitocondrial
ração excessiva, alta ingesta calórica sem ganho podem ocorrer, devido a radicais livres (superóxi-
de peso e taxa de metabolismo basal muito elevada dos) formados nas mitocôndrias. Anomalias nas
(uma medida da utilização de oxigênio). Ela tinha mitocôndrias têm sido implicadas na patofisiologia
um defeito no mecanismo que controla a utilização de esquisofrenia, doença bipolar e doenças dege-
de oxigênio pela mitocôndria (ver Capítulo 14). nerativas relacionadas com idade, como a doença
Desde então, várias centenas de anomalias gené- de Parkinson, de Alzheimer e cardiomiopatias. Re-
ticas foram identificadas que levam a alterações centemente, sugeriu-se que uma única mutação em
em enzimas, ácidos ribonucléicos, componentes um tRNA mitocondrial levaria a uma constelação
do transporte de elétrons e sistemas de transporte de sintomas, incluindo hipertensão, colesterol ele-
de membranas mitocondriais. Mutações no mtDNA vado no sangue e níveis baixos de Mg 2+ no plasma.
bem como no DNA nuclear levam a doenças gené- Ver as seguintes Correlações Clínicas para detalhes
ticas mitocondriais. A primeira doença identificada de doenças mitocondriais: 6.5, p. 217; 14.4, p. 564;
que se deve a uma mutação no mtDNA foi Neuropa- 14.5, p. 564; 14.6, p. 565; e 14.7, p. 567.

Fonte: Luft, R. The development of mitochondrial medicine. Proc. Natl. Acad. Sci. USA 91:8731, 1994; Chalmers,
R.M. e Schapira, A.H.V. Clinical, biochemical and molecular genetic features of Leber’s hereditary optic neuropathy.
Biochim. Biophys. Acta 1410:147, 1999; Wallace, D.C. Mitochondrial DNA in aging and disease. Sci. Am. 280:40, 1997;
e Wallace, D.C. Mitochondrial diseases in man and mouse. Science 283:1482, 1999.

BioQ.01 15 22.01.07 16:10:00


CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA | 19

CORRELAÇÃO CLÍNICA 1.5


Doenças de Biogênese de Peroxissomos (PBDs)

Peroxissomos são responsáveis por várias reações doenças podem afetar fígado, rim, cérebro e sistema
metabólicas importantes, incluindo síntese de glice- esquelético. A mais grave é síndrome de Zellweger,
rol éteres, encurtamento de ácidos graxos de cadeia que se deve à ausência de peroxissomos funcionais;
muito longa para que as mitocôndrias possam oxi- morte freqüentemente ocorre por volta dos 6 meses
dá-los completamente, e oxidação da cadeia lateral de idade. Nessa condição, o defeito genético está no
do colesterol necessária à síntese de ácidos bilia- mecanismo para importar enzimas para a matriz
res. Doenças de biogênese de peroxissomos (PBDs) dos peroxissomos. Algumas condições PBD são cau-
compreendem mais de 25 doenças genética e fenoti- sadas por mutações de splice doador ou de sentido
picamente relacionadas que envolvem atividades en- errado (missense) (ver p. 158); em algumas, há au-
zimáticas de peroxissomos. São doenças autossômi- sência de uma única enzima metabólica ou defeito
cas recessivas raras que se caracterizam por níveis em um componente do transporte de membranas.
diminuídos de lipídeos glicerol-éteres (plasmalo- Em alguns casos, a doença pode ser diagnosticada
gênios), níveis aumentados de ácidos graxos de ca- antes do nascimento por ensaio de enzimas de pero-
deias muito longas (C24 e C26) e de derivados do áci- xissomos ou de ácidos graxos em células do líquido
do colestanóico (precursores de ácidos biliares). As amniótico.

Fonte: Wanders, R. J., Schutgens, R. B., e Barth, P. G. Peroxissomal disorders: A review. J. Neuropathol. Exp. Neu-
rol. 54: 726, 1995; FitzPatrick, D. R., Zellweger syndrome and associated phenotypes. J. Med. Genet. 33:863, 1996; e
Warren, D.S., Wolfe, B. D. e Gould, S. J. Phenotype-genotype relationships in PEX10-deficient peroxisome biogenesis
disorder patients. Hum. Mutat. 15:509, 2000.

|
1.4 INTEGRAÇÃO E CON- celular em células normais só ocorre quando os pro-
cessos necessários à divisão celular são ativados (ver
TROLE DAS FUNÇÕES p. 989). Então, e somente então, ocorre uma série de
CELULARES reações ordenadas e integradas, culminando na divisão
de uma célula em duas células filhas. Um processo fas-
cinante é apoptose, morte celular programada, tam-
Uma célula eucariótica é uma estrutura complexa que bém chamada suicídio celular (ver p. 993). Esse pro-
mantém um ambiente intracelular que permite que cesso cuidadosamente regulado ocorre em células de
muitas reações complexas e funções ocorram com a todos os tecidos de mamíferos, mas etapas individuais
máxima eficiência possível. Células de organismos mul- do processo variam de tecido para tecido. Muitas doen-
ticelulares também participam da manutenção do bem- ças devem-se a erro em mecanismos específicos de con-
estar de todo o organismo, exercendo influências umas trole. À medida que alguém amplia sua compreensão
sobre as outras para manter equilíbrio entre atividades da complexidade de células biológicas, esse alguém fica
tissulares e celulares. Processos intracelulares e vias admirado de que não ocorram muito mais erros e de
metabólicas são muito bem controlados e integrados que não existam muito mais indivíduos com condições
para conseguir esse equilíbrio. Pouquíssimas funções anormais. Assim, à medida que prosseguimos para o es-
operam de modo totalmente independente; mudanças tudo de componentes químicos separados e atividades
em uma função podem exercer uma influência, positiva de células em capítulos subseqüentes, é importante não
ou negativa, sobre outras funções. Como será descrito esquecer as atividades concomitantes e vizinhas, limi-
ao longo deste livro, controles de função são mediados tações e influência do ambiente. Só conciliando todas
em muitos níveis, desde a expressão de um gene para as partes e atividades de uma célula – isto é, montando
alterar a concentração de uma enzima ou proteína efe- o quebra-cabeça – é que apreciaremos a maravilha das
tora, até mudanças em níveis de substrato ou coenzi- células vivas.
ma para ajustar a velocidade de uma reação enzimática
específica. A integração de muitos processos celulares
é controlada por proteínas que funcionam como ativa-
dores ou inibidores, que mantêm homeostase celular.
Muitos processos celulares são programados para ocor-
rerem em condições específicas; por exemplo, divisão

BioQ.01 19 22.01.07 16:10:03


CAPÍTULO 2 DNA E RNA: COMPOSIÇÃO E ESTRUTURA | 23

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS

2
DNA E RNA: COMPOSIÇÃO
E ESTRUTURA
Stephen A. Woski e Francis J. Schmidt

2.1 VISÃO GERAL, 24 Empacotamento do DNA procariótico, 51


Dogma central da biologia molecular, 24 Organização da cromatina eucariótica, 54
DNA pode transformar células, 24 Nucleossomos e polinucleossomos, 55
Capacidade de informação do DNA é enorme, 25 Empacotamento de polinucleossomos em
estruturas superiores, 56
2.2 COMPONENTES ESTRUTURAIS DOS ÁCIDOS
NUCLÉICOS: NUCLEOBASES, NUCLEOSÍDEOS E 2.5 SEQÜÊNCIA E FUNÇÃO DO DNA, 57
NUCLEOTÍDEOS, 26 Endonucleases de restrição e palíndromes, 57
Propriedades físicas de nucleosídeos e nucleotí- A maior parte do DNA procariótico codifica pro-
deos, 26 teínas específicas, 58
Propriedades estruturais de nucleosídeos e nu- Apenas uma pequena percentagem do DNA euca-
cleotídeos, 27 riótico consisde de genes funcionais, 59
Seqüências repetidas, 60
2.3 ESTRUTURA DO DNA, 28
Estrutura polinucleotídica, 28 2.6 ESTRUTURA DO RNA, 61
Conformações dos polinucleotídeos, 29 RNA é um polímero de ribonucleosídeos 5-mono
Estabilidade do Esqueleto polinucleotídico, fosfato, 61
30 Estrutura secundária do RNA envolve pareamen-
DNA dupla-hélice, 31 to de bases intramolecular, 61
Fatores que estabilizam DNA dupla-hélice, Moléculas de RNA têm estruturas terciárias, 62
34
Desnaturação e renaturação, 35 2.7 TIPOS DE RNA, 64
Hibridização, 36 RNA transportador tem duas funções: ativar
Conformações do DNA dupla-hélice, 39 aminoácidos e reconhecer códons no mRNA,
Estruturas não-canônicas de DNA, 40 64
DNA dobrado, 41 RNA ribossômico é parte do aparelho de síntese
DNA cruciforme, 41 protéica, 65
DNA tripla-fita, 43 RNAs mensageiros carregam a informação para a
DNA quatro-fitas, 44 estrutura primária de proteínas, 66
DNA deslocado, 46 Mitocôndrias contêm espécies peculiares de
RNA, 66
2.4 ORDEM SUPERIOR DA ESTRUTURA DO DNA, 47 RNA em partículas ribonucleoprotéicas, 67
DNA genômico pode ser linear ou circular, 47 RNA catalítico: ribozimas, 67
DNA é super-hélice, 49 RNAs podem ligar outras moléculas, 68
Topoisomerases, 50 RNAs controlam tradução, 69

BioQ.02 23 22.01.07 16:20:49


28 | PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

os átomos de carbono desse arranjo lembram a letra S; H NH2 NH2


por isso, essa conformação é às vezes chamada confor- N
6 2
mação-Sul. Na segunda torção comum, C3’ é deslocada H N O H
HO HO
em direção à face endo e é chamada C3’-endo. Os car- O
N
O
N
O H
bonos da pentose desenham uma letra N, produzindo
a conformação-Norte. É notável que os grupos ligados
ao açúcar fiquem em orientações muito diferentes em OH OH
cada uma dessas conformações. Por exemplo, grupos anti syn
5’- e 3’-fosfatos ficam muito mais afastados na torção H
O
C2’-endo do que na C3’-endo. A orientação da ligação O N
glicosídica também muda significativamente nas duas N H H 2N
N N
conformações. H
8
N
Conformações C2’-endo e C3’-endo estão em rápido HO N NH2 HO N H
O N O
equilíbrio. Um substituinte eletronegativo na posição 2’
da pentose favorece a conformação C3’-endo. Portan-
to, ribonucleosídeos em RNA preferem essa torção do HO OH HO OH
açúcar. Fatores adicionais como pontes de hidrogênio
anti syn
entre o grupo 2’-OH e o átomo O4’ do resíduo vizinho
deslocam o equilíbrio para a conformação C3’-endo. FIGURA 2.7
Entretanto, os 2’-desoxinucleosídeos do DNA contêm Conformações glicosídicas de purinas e pirimidinas.
Em pirimidinas, fatores estéricos entre o açúcar e O2 da base
um hidrogênio em lugar do grupo 2’-OH, e a conforma- desfavorecem fortemente a conformação syn. Em purinas, as
ção C2’-endo é preferida. conformações anti e syn se interconvertem facilmente, com
As bases em nucleosídeos são planas. Embora rota- anti sendo mais estável na maioria dos casos. A conformação
syn é estabilizada em guanosina 5’-fosfato, devido a interações
ção livre em torno da ligação glicosídica seja possível, favoráveis entre o grupo 2-NH2 e os oxigênios do fosfato.
duas orientações da base em relação ao açúcar predo-
minam (Figura 2.7). Em purinas, a conformação anti
coloca H8 sobre o açúcar, enquanto a conformação syn dica syn. Essa preferência também foi observada em
posiciona esse átomo longe do açúcar e a maior parte da DNA fita-dupla com seqüências de Gs e Cs alternados.
purina bicíclica sobre o açúcar. Em pirimidinas, o áto- A conformação syn dos resíduos G nesses DNAs resulta
mo H6 fica acima do anel de pentose na conformação na formação de uma hélice pouco usual, que gira para a
anti, e o átomo O2, maior, fica acima do anel na confor- esquerda (ver p. 40).
mação glicosídica syn. Pirimidinas, portanto, mostram
uma grande preferência pela conformação com menos
impedimento estérico anti. Purinas rapidamente se
2.3 | ESTRUTURA DO DNA
interconvertem entre as duas conformações, mas favo-
recem a orientação anti. Contudo, guanina 5’-nucleotí- Estrutura Polinucleotídica
deos são exceções. Nesses casos, interações favoráveis
entre o grupo 2-NH2 e o grupo 5’-fosfato estabilizam a Ácidos nucléicos são fitas de nucleotídeos ligados por
conformação syn. 2’-Desoxiguanosina 5’-monofosfato ligações fosfodiéster (Figura 2.8). O comprimento
(dGMP), por exemplo, prefere a conformação glicosí- dessas fitas varia consideravelmente, de dois resíduos a
centenas de milhões de resíduos. Tipicamente, fitas de
P O
O base
ácidos nucléicos contendo ≤50 nucleotídeos são chama-
dos oligonucleotídeos, enquanto os mais longos são
polinucleotídeos. A ligação fosfodiéster liga o grupo
7.0 Å C-2� ���� 5’-hidroxila de um resíduo ao grupo 3’-hidroxila do se-
P O “Sul”
guinte. Ligações entre dois 5’-OHs ou dois 3’-OHs não
são vistas em DNA de ocorrência natural. A direcio-
base nalidade dessa ligação significa que oligo- e polinu-
P O O
cleotídeos lineares têm uma extremidade que termi-
5.9 Å P O
na em um 5’-OH e outra que termina em 3’-OH. Essas
extremidades são extremidade 5’ e extremidade 3’,
C-3� ���� respectivamente. Em muitos polinucleotídeos, uma ou
“Norte”
ambas as extremidades são quimicamente modificadas
FIGURA 2.6 com resíduos de grupos fosfatos ou aminoácidos. Poli-
Conformações preferenciais de açúcares pentoses. nucleotídeos circulares não têm nenhuma extremidade
Duas conformações produzem variações na orientação relativa livre, e são formados unindo-se a extremidade 5’ de um
da base (com relação ao açúcar) e na distância entre os grupos
3’- e 5’-fosfato (P). Finalmente, essas diferenças afetam a polinucleotídeo linear com sua própria extremidade 3’
conformação geral do complexo dupla-hélice. por uma ligação fosfodiéster.

BioQ.02 28 22.01.07 16:20:54


42 | PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

CORRELAÇÃO CLÍNICA 2.3


Antibióticos Antitumorais que Mudam a Forma do DNA

A estrutura local tridimensional do DNA é impor- citotoxicidade da cisplatina é um processo compli-


tante em interações com proteínas envolvidas em cado mediado por interações específicas com essas
reparo, transcrição, recombinação e condensação proteínas. Processos celulares como transcrição e
da cromatina. Foi proposto que antibióticos possam apoptose são afetados e os complexos aducto-pro-
induzir formação de estruturas de DNA que podem teína provavelmente interferem com transcrição.
recrutar essas proteínas com resultados citotóxicos. Proteínas NER são recrutadas para reparar a lesão,
O exemplo melhor estudado é a droga antitumoral mas reparo por excisão está sujeito a introduzir que-
cisplatina, um complexo tetracoordenado de plati- bras de fita no DNA. Acúmulo dessas quebras indu-
na [cis-Pt(NH2)2CL2]. Cisplatina é usada sozinha zirá, finalmente, apoptose, quando o DNA se tornar
ou em combinação com outros agentes antitumorais danificado demais para funcionar. Mecanismos se-
para tratar uma variedade de tumores, incluindo melhantes foram propostos como responsáveis pela
câncer testicular, ovariano, ósseo e pulmonar. For- citotoxicidade de outras drogas que ligam ao DNA,
ma ligações cruzadas inter- e intra-fitas em DNA como ditercalinium, uma molécula bifuncional que
dupla-fita com o último aducto compreendendo 90% forma aductos não-covalentes com DNA que tam-
das lesões do DNA. Essas ligações surgem do deslo- bém fica fortemente dobrado. Acredita-se que cito-
camento de cloretos ligados à platina por átomos N7 toxicidade surja da indução da via de reparo aborti-
de duas guaninas vizinhas. Estudos estruturais de vo, que leva a quebras da fita de DNA. Interações do
DNA com aducto fazendo ligação cruzada intra-fita aducto cisplatina-DNA com proteínas HMG também
mostra que a dupla hélice é fortemente dobrada em podem contribuir para sua citotoxicidade. Ligação
direção à fenda maior. de proteínas HMG pode sinalizar incorretamente
Estruturas dobradas de aductos DNA-cisplatina que a região danificada do DNA é transcripcional-
são reconhecidas especificamente por várias proteí- mente ativa e impedir condensação em estruturas
nas que se ligam ao DNA, tais como proteínas do re- de cromatina enovelada. Esses complexos também
paro por excisão de nucleotídeos (NER) e proteínas perpetuam a lesão, porque bloqueiam o aducto DNA-
não-histonas que se ligam ao DNA como HMG-1. A cisplatina impedindo reparo.

��

��� ���

Fonte: Zamble, D.B. e Lippard, S.J. The response of cellular proteins to cisplatin-damaged DNA. In: B. Lippert
(Ed.) Cisplatin: Chemistry and Biochemistry of a Leading Anticancer Drug. New York: Wiley-VCH, 1999, pp. 73-
134; e Lambert, B., Segal-Bendirjian, E., Esnault, C., Le Pecq, J.-B., Roques, B.P., Jones, B. e Yeunf, A.T. Recognition
by the DNA repair system of DNA structural alterations induced by reversible drug-DNA interactions. Anti-Cancer
Drug Des. 5:43, 1990.

BioQ.02 42 22.01.07 16:21:15


CAPÍTULO 2 DNA E RNA: COMPOSIÇÃO E ESTRUTURA | 61
mente 300 pb de comprimento e são repetidas mais de
500.000 vezes. As estruturas das repetições dispersas
2.6 | ESTRUTURA DO RNA
curtas, incluindo família Alu, são remanescentes de
transposons.
Aproximadamente 1-15% do DNA genômico eucari- RNA é um Polímero de
ótico consiste de seqüências tipicamente menores do Ribonucleosídeo 5’-Monofosfatos
que 20 nucleotídeos reiteradas milhares ou milhões
de vezes. A maioria das seqüências altamente reite- RNA é um polímero linear de ribosídeos monofosfatos.
radas tem uma composição em bases característica, As bases púricas do RNA são adenina e guanina; as piri-
e elas podem ser isoladas fragmentando-se o DNA em mídicas são citosina e uracil. Exceto por uracil, que subs-
segmentos de algumas centenas de nucleotídeos e se- titui timina, são as mesmas bases encontradas no DNA.
parando-se os fragmentos por centrifugação em gra- Nucleotídeos de A, C, G e U são incorporados no RNA
diente de densidade. Esses fragmentos são chamados durante transcrição. Muitos RNAs também contêm nu-
DNA satélite, porque aparecem como satélites das cleotídeos modificados, que são produzidos por proces-
bandas que contêm a maior parte do DNA após centri- samento. Nucleotídeos modificados são especialmente
fugação. Outras seqüências altamente reiteradas, que característicos de espécies de RNAs estáveis (i.é, tRNA
não podem ser isoladas por centrifugação, podem ser e rRNA); contudo, alguns nucleotídeos metilados estão
identificadas por sua propriedade de rápido reanela- também presentes em mRNA eucariótico. Na sua maior
mento. Esses DNAs altamente reiterados são também parte, nucleotídeos modificados no RNA têm papel no
chamados DNAs de seqüência simples. Seqüências “ajuste fino”, e não funções indispensáveis na célula.
simples estão tipicamente presentes no DNA da maio- As ligações 3’,5’-fosfodiéster do RNA formam um es-
ria dos eucariotos, se não de todos. Em algumas espé- queleto, a partir do qual as bases se estendem (Figura
cies, uma seqüência principal está presente, enquanto 2.51). RNAs eucarióticos variam de aproximadamente
em outras, várias seqüências simples são repetidas até 20 nucleotídeos de comprimento a mais de 200.000 nu-
um milhão de vezes. DNAs de seqüência simples po- cleotídeos. Cada RNA é complementar à seqüência de
dem freqüentemente ser isolados, como DNA satélite. bases de porções específicas de apenas uma das fitas do
O encontrado no centrômero de eucariotos superiores DNA. Portanto, ao contrário da composição em bases do
consiste de milhares de cópias em seqüência de uma DNA, as relações molares (A + U) e (G + C) no RNA não
ou de algumas poucas seqüências curtas. Seqüências são iguais. RNA celular é linear e de fita-única, mas RNA
satélites têm apenas 5-10 pb de comprimento e são um fita-dupla está presente em certos genomas virais.
constituinte dos telômeros, onde têm um papel bem Quimicamente, RNA é semelhante a DNA. Ambos
definido na replicação do DNA. Alguns DNAs de se- contêm ligações fosfodiéster carregadas negativamen-
qüência simples mais longos foram identificados. Por te, e as bases são quimicamente muito semelhantes. As
exemplo, no genoma do macaco verde africano, um diferenças químicas entre DNA e RNA devem-se prin-
segmento de 172 pb que contém algumas repetições cipalmente a dois fatores. Primeiro, RNA contém ribose
de seqüências é altamente reiterado. em lugar de 2’-desoxirribose como açúcar componente
Repetições invertidas são motivos estruturais do do nucleotídeo, e segundo, RNAs geralmente são fita-
DNA. Repetições invertidas curtas, consistindo de até única em lugar de dupla-fita.
seis nucleotídeos de comprimento (p. ex., a seqüência O grupo 2’-hidroxila torna as ligações fosfodiéster
palindrômica GAATTC), ocorrem por acaso uma vez a de uma molécula de RNA mais susceptível à hidrólise
cada 3.000 nucleotídeos. Tais repetições curtas não po- química, especialmente em soluções alcalinas, do que
dem formar uma estrutura cruciforme estável, como a as do DNA. A instabilidade química do RNA reflete-se
formada por seqüências palindrômicas mais longas. Se- em sua instabilidade metabólica. Alguns RNAs, como
qüências repetitivas invertidas que são suficientemente mRNA bacteriano, são sintetizados, usados e degrada-
longas para formar cruciformes estáveis, é pouco prová- dos em minutos. Outros, como rRNA humano, são mais
vel que ocorram por acaso, e deveriam ser classificadas estáveis metabolicamente, com tempo de vida medido
como uma classe separada de seqüências eucarióticas. em dias. Entretanto, mesmo os RNAs mais estáveis, são
No DNA humano, cerca de dois milhões de repetições menos estáveis que o DNA.
invertidas estão presentes, com um comprimento mé-
dio de cerca de 200 pb; entretanto, seqüências inverti-
das com mais de 1.000 pb já foram detectadas. A maio-
Estrutura Secundária do RNA
ria das seqüências repetidas invertidas é repetida 1.000 Envolve Pareamento de Bases
ou mais vezes por célula. Intramolecular
Como moléculas de RNA são fita-única, geralmente
não formam extensas duplas-hélices. Em vez disso, a
estrutura secundária de uma molécula de RNA resul-
ta de regiões relativamente curtas com pareamento de

BioQ.02 61 22.01.07 16:21:40


CAPÍTULO 3 PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA | 73

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS

3
PROTEÍNAS I: COMPOSIÇÃO
E ESTRUTURA
Richard M. Schultz e Michael N. Liebman

3.1 PAPÉIS FUNCIONAIS DE PROTEÍNAS NO HO- 3.5 NÍVEIS SUPERIORES DE ORGANIZAÇÃO PRO-
MEM, 74 TÉICA, 90
3.2 COMPOSIÇÃO EM AMINOÁCIDOS DE PROTEÍ- Estrutura secundária, 90
NAS, 75 Estrutura em α-hélice, 91
Aminoácidos comuns, 75 Estrutura-β, 92
Cadeias laterais definem a natureza química e Motivos estruturais e dobras das proteínas,
as estruturas de α-aminoácidos, 76 92
Cistina é um aminoácido derivado, 78 Estrutura terciária, 93
Aminoácidos têm um centro de assimetria, Estrutura quaternária, 94
78 Bioinformática relaciona estrutura e função das
Aminoácidos São Polimerizados em Peptídeos e proteínas como produtos gênicos, 95
Proteínas, 78 Estruturas de dobras homólogas são freqüente-
mente formadas a partir de seqüências de
3.3 PROPRIEDADES DE CARGAS E QUÍMICAS DE aminoácidos não-homólogas, 96
AMINOÁCIDOS E PROTEÍNAS, 81
Grupos ionizáveis de aminoácidos e proteínas são 3.6 OUTROS TIPOS DE PROTEÍNAS, 97
críticos para a função biológica, 81 Proteínas fibrosas: colágeno, elastina, queratina e
Forma iônica de um aminoácido ou uma pro- tropomiosina, 98
teína pode ser determinada em dado pH, Colágeno, 98
82 Composição em aminoácido do colágeno, 98
Titulação de um ácido monoamino-monocar- Seqüência de aminoácido do colágeno, 98
boxílico: determinação do pH isoelétrico, Estrutura do colágeno, 99
82 Formação de ligações covalentes cruzadas no
Titulação de um ácido monoamino-dicarboxí- colágeno, 100
lico, 83 Elastina é uma proteína fibrosa com ligações cru-
Relação geral entre as propriedades de carga de zadas geradas por alisina, 100
aminoácidos e proteínas, e pH, 83 Queratina e tropomiosina, 102
Aminoácidos e proteínas podem ser separados Lipoproteínas plasmáticas são complexos de lipí-
com base em valores de pI, 84 deos com proteínas, 102
Cadeias laterais de aminoácidos têm proprieda- Glicoproteínas contêm carboidratos ligados cova-
des polares e apolares, 84 lentemente, 107
Aminoácidos sofrem várias reações químicas, 87 Ligações covalentes carboidrato-proteína, 107

3.4 ESTRUTURA PRIMÁRIA DE PROTEÍNAS, 88

BioQ.03 73 22.01.07 16:30:59


CAPÍTULO 3 PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA | 81

|
3.3 PROPRIEDADES DE plo, quando um grupo amônio carregado positivamente
(−NH3+) é colocado perto de um grupo carregado nega-
CARGAS E QUÍMICAS tivamente em uma proteína, a carga negativa estabiliza
DE AMINOÁCIDOS E a forma ácida carregada positivamente, tornando mais
difícil a dissociação do seu próton. O pKa do −NH3+ terá
PROTEÍNAS um valor maior do que o normal para um grupo amônio
na ausência de uma estabilização por uma carga nega-
tiva próxima.
Outros fatores, além da carga, que afetam o pKa
Grupos Ionizáveis de Aminoácidos e incluem polaridade do meio, ausência ou presença de
Proteínas São Críticos para a Função água e potencial para formação de pontes de hidrogê-
Biológica nio. Além disso, grupos ácidos (α-COOH ou α-NH3+)
nas extremidades dos polipeptídeos tipicamente têm
Grupos ionizáveis comuns a proteínas e aminoácidos um valor de pKa mais baixo do que os mesmos tipos de
são mostrados na Tabela 3.3. As formas ácidas estão à grupos ácidos nas cadeias laterais (Tabela 3.4). Os ami-
esquerda do sinal de equilíbrio, e as formas básicas do noácidos cujos grupos R contêm átomos de nitrogênio
lado direito. Ao formar sua base conjugada, a forma áci- (Lys e Arg) são os aminoácidos básicos, uma vez que
da libera um próton. Ao contrário, a forma básica asso- suas cadeias laterais têm valores relativamente altos
cia-se com um próton para formar o respectivo ácido. A de pKa e funcionam como bases em pH fisiológico. Eles
dissociação de um ácido é caracterizada por uma cons- estão geralmente em sua forma ácida e carregada posi-
tante de dissociação ácida (Ka) e seu valor de pKa : pKa tivamente em pH fisiológico. Aminoácidos cujas cadeias
= log10 (1/Ka). Tabela 3.3 mostra a faixa de valores de laterais contêm um grupo carboxílico têm valores de
pK’a para cada grupo ácido, porque o pKa real depende pKa relativamente baixos que facilmente perdem seus
do meio no qual o grupo ácido está colocado. Por exem- prótons e são aminoácidos acídicos. Estão predomi-

TABELA 3.3 Valores de pKa característicos para os Grupos Ácidos Comuns em Proteínas
Onde o Grupo Ácido É Encontrado Forma Ácida Forma Básica Faixa Aproximada de pKa
Para o Grupo

NH2-terminal ou cadeia lateral de R—NH3 + R—NH2 + H +


↔ 7,6–10,6
lisina Amônia Amina

COOH-terminal ou cadeias laterais R—COOH R—COO – + H +


↔ 3,0–5,5
de glutamato e aspartato Ácido carboxílico Carboxilato
+
Cadeia lateral de arginina R—NH—C —… NH2 R—NH—C= NH + H
| |
↔ 11,5–12,5
NH2 NH2
Guanidínio Guanidino

Cadeia lateral de cisteína R—SH R—S – + H +


↔ 8,0–9,0
Tiol Tiolato

Cadeia lateral de histidina R—C=CH R—C=CH


| | | |
+
HN NH HN N+H +
↔ 6,0–7,0
C C
H H
Imidazólio Imidazol

Cadeia lateral de tirosina

R— —OH R— —OH – +H +
↔ 9,5–10,5

Fenol Fenolato

TABELA 3. 4 pKa da Cadeia Lateral e Grupos nantemente em sua forma desprotonada e carregada
Ácidos Terminais em Ribonuclease negativamente em pH fisiológico. Proteínas nas quais a
—NH3 + —COOH razão (∑Lys + ∑Arg)/(∑Glu + ∑Asp) é maior do que 1
são proteínas básicas. Proteínas, nas quais a razão é
Cadeia lateral Lisina  10,2 Glu e Asp  4,6
menor do que 1, são proteínas ácidas.
Final da cadeia N-terminal = 7,8 C-terminal = 3,8

BioQ.03 81 22.01.07 16:31:12


98 | PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

Proteínas Fibrosas: Colágeno, Composição em Aminoácidos do


Elastina, Queratina e Tropomiosina Colágeno
Proteínas fibrosas caracteristicamente têm quanti- A composição do colágeno tipo I de pele e das proteí-
dades maiores de estrutura secundária regular, uma nas globulares ribonuclease e hemoglobina são dadas
forma cilíndrica longa (tipo bastão), baixa solubilidade na Tabela 3.10. Colágeno de pele é rico em glicina (33%
em água e uma função estrutural em lugar de um papel de seus aminoácidos), prolina (13%) e aminoácidos de-
dinâmico. Exemplos de proteínas fibrosas com essas ca- rivados 4-hidroxiprolina (9%) e 5-hidroxilisina (0,6%)
racterísticas são colágeno, queratina e tropomiosina. (Figura 3.37). Hidroxiprolina é exclusiva de colágenos,
sendo formada enzimaticamente a partir de prolina. A
Colágeno maior parte das hidroxiprolinas tem o grupo hidroxila
na posição 4 (carbono γ), embora uma pequena quanti-
Colágeno é uma família de proteínas presente em to- dade de 3-hidroxiprolina também seja formada (Tabela
dos os tecidos e órgãos e fornece o arcabouço que dá 3.10). Colágenos são glicoproteínas com carboidratos
aos tecidos sua forma e resistência. A porcentagem de ligados a 5-hidroxilisina por uma ligação O-glicosídica
colágeno por peso para alguns tecidos e órgãos huma- por meio do grupo hidroxila do carbono-δ.
nos representativos é: fígado 4%, pulmão 10%, aorta
12-24%, cartilagem 50%, córnea 64%, osso cortical to- Seqüência de Aminoácidos do
tal 23% e pele 74% (ver Corr. Clín. 3.4).
Colágeno
A família colágeno é composta por polipeptídeos deriva-
dos de 40 genes conhecidos de cadeias de colágeno, que
produzem cerca de 20 tipos de colágeno. Cada molécula
de colágeno maduro ou tropocolágeno contém três ca-
CORRELAÇÃO CLÍNICA 3.4 deias polipeptídicas. Alguns tipos de colágeno contêm
Doenças de Síntese de três cadeias polipeptídicas idênticas. No tipo I (Tabela
Colágeno 3.11), há duas cadeias α1(I) e uma α2(I). Colágeno tipo
V contém α1(V), α2(V) e α3(V). Colágenos diferem em
Colágeno está presente em praticamente todos seqüência de aminoácidos, mas há grandes regiões de
os tecidos e é a mais abundante proteína do cor- seqüências homólogas entre todos os diferentes tipos
po. Certos órgãos dependem muito dele para de colágeno. Em todos os tipos de colágeno há regiões
funcionar fisiologicamente. Síntese ou estrutura com os tripeptídeos Gly-Pro-Y e Gly-X-Hyp (onde X e
anormal de colágeno causa disfunção em órgãos Y são quaisquer aminoácidos) repetidos em seguida vá-
cardiovasculares (aneurisma da aorta e arterial e
defeitos de válvulas cardíacas), ossos (fragilidade
e fratura fácil), pele (cicatrização difícil e disten- H H
N N
sibilidade incomum), articulações (hipermobili- H2C CH COOH H2C CH COOH
dade e artrite) e olhos (deslocamento do crista-
HC CH2 H2C CH
lino). Doenças causadas por síntese anormal de
colágeno incluem síndrome de Ehlers-Danlos, OH OH

osteogênese imperfeita e escorbuto. Essas do- 4-Hidroxiprolina 3-Hidroxiprolina


enças podem resultar de genes anormais de co-
lágeno, modificações pós-tradução anormais do
colágeno ou deficiência de cofatores necessários OH NH2
às enzimas responsáveis por modificações pós- NH2 CH2 CH CH2 CH2 C H
tradução de colágeno.
COOH
5-Hidroxilisina

Fonte: Aronson, D. Cross-linking of glycated colla- NH2


gen in the pathogenesis of arterial and myocardial stiff-
O C CH2 CH2 CH2 C H
ening of aging and diabetes. J. Hypertens. 21:3, 2003.
H COOH
Byers, P. H. Disorders of collagen biosynthesis and
structure. In: C. R. Scriver, et al. (Eds.), The Metabolic Alisina

and Molecular Bases of Inherited Disease, 8th ed.


McGraw-Hill, 2001, Chapter 205. Hudson, B. G., et al., FIGURA 3.37
Aminoácidos derivados encontrados no colágeno.
Alport’s syndrome, Goodpasture’s syndrome and type Carboidrato é ligado a 5-OH de hidroxilisina por uma ligação
IV collagen, N. Engl J Med 348:2543, 2003. glicosídica tipo III (ver Figura 3.45).

BioQ.03 98 22.01.07 16:31:51


116 | PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

tos de domínios e mudanças de estrutura quaternária,


como os observados em hemoglobina após ligação de O2
(ver p. 344). O comportamento dinâmico de proteínas 0.05 S F A A1c
é a base para (a) mudanças conformacionais induzidas A

Absorbância (415 nm)


A1c
por substrato, inibidor ou droga quando se liga a uma A2 F
enzima ou receptor, (b) geração de efeitos alostéricos
em hemoglobinas, (c) transferência de elétrons em cito- S
cromos, e (d) a formação de montagens supramolecula-
res como vírus. Os movimentos também podem ter um
papel funcional na ação catalítica de enzimas. A2

|
3.9 CARACTERIZAÇÃO, PU- 0

RIFICAÇÃO E DETERMI- 14 15 16 17
NAÇÃO DA ESTRUTURA Tempo (min)
E ORGANIZAÇÃO DE (a) (b)

PROTEÍNAS FIGURA 3.55


Focalização isoelétrica de hemoglobinas de um paciente hete-
rozigoto para HbS e β-talassemia.
Figura mostra separação por focalização isoelétrica de HbA1c
(HbA glicosilada na extremidade NH2, ver Corr. Clín. 3.7), HbA
Separação de Proteínas com Base de adulto normal, HbF fetal, HbS de anemia falciforme (ver
Corr. Clín 3.3) e HbA 2 minoritária de adulto. (a) Focalização
em Carga isoelétrica realizada por eletroforese capilar com anfólito na
faixa de pH entre 6,7 e 7,7 e detecção de bandas a 415 nm. (b)
Em eletroforese, proteína dissolvida em uma solução Focalização isoelétrica realizada em gel com Pharmacia Phast
System; anfólito na faixa de pH entre 6,7 e 7,7.
tampão em um pH em particular é colocada num campo De Molteni, S., Frischknecht, H. e Thormann, W. Electrophore-
elétrico. Dependendo da relação entre o pH do tampão e sis 15:22, 1994 (Figura 4, partes A e B).
o pI da proteína, a proteína move-se em direção ao cáto-
do (–) ou ao ânodo (+) ou permanece estacionária (pH
= pI). Suportes como géis poliméricos (p. ex., poliacri- R CH2 COO–
lamida), amido ou papel são usados. Os suportes iner-
tes são saturados com solução tampão, uma amostra de Ligante carregado negativamente: carboximetil
proteína é colocada sobre o suporte, um campo elétrico +
C2H5
é aplicado ao suporte, e a proteína carregada migra no R N
C2H5
suporte em direção ao pólo de carga oposta. H
Uma técnica de resolução extremamente alta é a fo- Ligante carregado positivamente: dietilamino
calização isoelétrica, na qual misturas de anfolitos
poliamino-ácidos policarboxílicos com uma faixa defi- FIGURA 3.56
Dois exemplos de ligantes carregados usados em cromatogra-
nida de valores de pI são usadas para estabelecer um fia de troca-iônica.
gradiente de pH ao longo do campo elétrico aplicado.
Uma proteína carregada migra pelo gradiente de pH
no campo elétrico até alcançar uma região de pH no
gradiente igual ao seu valor de pI. Nesse ponto, a pro- de mesma carga que a resina são eluídas primeiro, em
teína torna-se estacionária e pode ser visualizada (Fi- uma única banda, seguidas das que têm carga oposta à
gura 3.55). Proteínas que diferem por tão pouco quanto da resina, em uma ordem baseada na densidade de car-
0,0025 em seus valores de pI são separadas no gradien- gas da proteína (Figura 3.57). Quando é difícil remover
te apropriado de pH. uma molécula da resina, devido à força de interação
Cromatografia de troca-iônica em colunas é usada atrativa entre a molécula ligada e a resina, mudanças
para separação preparativa de proteínas por carga. Re- sistemáticas no pH ou na força iônica são usadas para
sinas de troca-iônica consistem de materiais insolúveis enfraquecer a interação.
(agarose, poliacrilamida, celulose e vidro) que contêm Por exemplo, um gradiente crescente de pH em uma
grupos carregados (Figura 3.56). Resinas carregadas resina de troca catiônica reduz a diferença entre o pH
negativamente ligam cátions fortemente e são resinas da solução e o pI da proteína ligada. Essa diminuição
de troca catiônica. Resinas carregadas positivamente entre pH e pI reduz a magnitude da carga final da prote-
ligam ânions fortemente e são resinas de troca aniô- ína e diminui a força da interação de cargas entre a pro-
nica. O grau de retardo de uma proteína (ou um amino- teína e a resina. Um gradiente crescente de força iônica
ácido) por uma resina depende da magnitude da carga também diminui a interação de cargas e elui eletrólitos
da proteína no pH particular do experimento. Moléculas fortemente ligados à resina.

BioQ.03 116 22.01.07 16:32:44


132 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

4
REPLICAÇÃO,
RECOMBINAÇÃO
E REPARO NO DNA
Howard J. Edenberg

4.1 CARACTERÍSTICAS COMUNS DA REPLICAÇÃO, 4.3 RECOMBINAÇÃO, 151


RECOMBINAÇÃO E REPARO, 133 Modelos de recombinação homóloga, 152
Modelo Holliday, 152
4.2 REPLICAÇÃO DO DNA, 133 Modelo de Meselson e Radding, 153
O básico, 133 Modelo de quebra da dupla fita, 153
A química da elongação da cadeia, 134 Enzimas-chaves da recombinação em E. coli,
DNA polimerases, 135 153
Separando as fitas parentais: a forquilha de RecA, 153
replicação, 137 RecBCD, RuvA, RuvC, 155
Resolvendo o problema da polaridade: síntese de Recombinação não-homóloga, 155
DNA semidescontínua, 138 Recombinação sítio-específica, 155
Movimento da forquilha de replicação, 138 Transposição, 155
Início, 138 Ligação de extremidades não-homólogas,
Elongação da fita, 138 155
Remoção do primer, 138
Preenchimento da falha, 138 4.4 REPARO, 156
Ligação, 139 Lesão no DNA, 156
Desenrolando as fitas parentais, 141 Mutações, 158
Braçadeiras corrediças (sliding clamps) e Reparo por excisão, 160
processividade, 142 Reparo por excisão de base, 160
Coreografia em três dimensões: o replissomo, Reparo por excisão de nucleotídeo, 161
142 Reparo acoplado à transcrição, 162
Enzimas procarióticas de replicação, 142 Reparo de pareamento errado, 162
Enzimas eucarióticas de replicação, 144 Desmetilação direta, 165
Início da replicação, 146 Fotorreativação, 165
O ciclo celular, 147
Lesões podem bloquear a replicação, 165
Término da replicação em genomas circulares,
Síntese bypass (translesão), 166
150
Reparo de falha na fita filha, 166
Término da replicação em genomas lineares: telô-
Enrolamento e reparo de forquilhas de replica-
meros, 150
ção, 167
Telomerase, 151
Reparo de quebra na dupla fita, 167
Replicação de genomas de RNA, 151
Regulação do reparo do DNA: o regulon SOS,
168

BioQ.04 132 22.01.07 16:37:06


CAPÍTULO 4 REPLICAÇÃO, RECOMBINAÇÃO E REPARO NO DNA | 151

Telomerase Replicação de Genomas de RNA


Telômeros são mantidos por telomerases, enzimas Alguns vírus têm um genoma de RNA. Tais genomas
que adicionam novas repetições de seis nucleotídeos são replicados com muito menor precisão e eles podem
à extremidade 3’ dos telômeros. Telomerases são com- acumular variações em período relativamente curto.
plexos ribonucleoprotéicos contendo um pequeno RNA Um exemplo particularmente importante disso é o ví-
que serve de molde para adição de uma nova repetição rus da imunodeficiência humano (HIV), que cau-
de seis nucleotídeos (Figura 4.18). Uma telomerase sa AIDS (síndrome da imunodeficiência adquirida). O
liga-se à extremidade da fita 3’, como parte do RNA da RNA viral do HIV é reversamente transcrito em DNA
telomerase ligado por pontes de hidrogênio aos últimos e, depois, o DNA integra-se ao cromossomo. A trans-
nucleotídeos do cromossomo. Uma repetição de seis criptase reversa do HIV é um alvo para quimioterapia
nucleotídeos é sintetizada, usando o RNA como molde. antiviral (Corr. Clín. 4.4).
Então, a telomerase pode se dissociar e reassociar para Transcrição reversa do RNA genômico do HIV é mui-
adicionar outro hexâmero. to menos precisa que síntese de DNA, e a precisão dimi-
Telômeros não precisam permanecer exatamente do nuída leva à rápida geração de uma coleção de vírus va-
mesmo tamanho; algum encurtamento não é problema riantes em um indivíduo. É provável que uma pequena
porque essas repetições não codificam proteínas. Telô- fração desses variantes seja resistente a qualquer droga
meros passam por ciclos de encurtamento das fitas tar- única que esteja sendo usada para tratar a infecção.
dias devido a incapacidade de síntese completa (Figura Essa fração pode continuar a replicar na presença do
4.17a) e adição de novas repetições de seis nucleotídeos agente terapêutico até se tornar a variante dominante,
à extremidade 3’ pela telomerase (Figura 4.18). Embo- o que leva à perda de eficácia da droga. Atuais terapias
ra o comprimento dos telômeros não permaneça cons- combinadas são projetadas para reduzir a probabilida-
tante, encurtamento progressivo é evitado por adição de de um vírus ser resistente simultaneamente a todas
de repetições. Telomerases também restabelecem os as drogas da combinação. Terapias combinadas atuais
excessos 3’, característicos dos telômeros. têm como alvos tanto a transcriptase reversa do HIV
Células que diferenciaram e se dividirão apenas um como a protease do HIV.
número limitado de vezes, não expressam telomerase.
Assim, os telômeros encurtam a cada divisão subse-
qüente; isso limita o número de vezes que tais células
4.3 | RECOMBINAÇÃO
podem se dividir antes que a perda dos telômeros dis-
pare apoptose – isto é, morte celular programada (ver p. Recombinação é a troca de informação genética. Há
1020). Expressão de telomerase é geralmente reativada dois tipos básicos: recombinação homóloga e re-
em células tumorais, o que lhes permite continuar as combinação não-homóloga. Recombinação homó-
divisões indefinidamente, sem encurtamento cromos- loga (também chamada recombinação geral) ocorre
sômico. Isso torna a telomerase um alvo atraente para entre seqüências idênticas ou quase idênticas – por
quimioterapia do câncer. Deve-se notar que inativação exemplo, entre os cromossomos paterno e materno de
da telomerase em um tumor não levaria a uma parada um par. Cromossomos não são passados intactos de ge-
rápida no crescimento do tumor; o efeito seria retarda- ração para geração (Figura 4.19); em vez disso, cada
do por muitos ciclos celulares, até que as extremidades cromossomo que você herda de seu pai contém porções
cromossômicas fossem encurtadas significativamente. de ambos os pais e, da mesma forma para os cromosso-
Portanto, é provável que inibidores da telomerase sejam mos herdados de sua mãe. Esta é uma parte normal do
úteis apenas em combinação com outras terapias. processo de alinhamento cromossômico e segregação

������������������
[TTAGGG]nTTAGGGTTAGGGTTAGGG 3�
��������� �
[AATCCC]nAATCCC 5�

��

������������������
���

��
3��

��
�–
5�

���������� k l m n o p q r
FIGURA 4.18
Telomerase. �
Telomerase é um complexo ribonucleoprotéico com uma � � � � � � � � � � KLMNOPQR
fita curta de RNA, como parte integral; catalisa a adição de
novas repetições teloméricas de 6-nt à extremidade 3’ de uma FIGURA 4.19
cadeia de DNA. O RNA da telomerase pareia parcialmente Recombinação homóloga.
pelas bases com a repetição telomérica e serve de molde (a) O cromossomo paterno é mostrado em cinza com os alelos
para a reação, enquanto o componente protéico funciona mostrados por letras maiúsculas. O cromossomo homólogo
como uma transcriptase reversa, sintetizando DNA usando o materno é mostrado em preto com os alelos mostrados por
RNA como molde. Depois da adição de uma repetição de seis letras minúsculas. (b) Depois da recombinação homóloga entre
nucleotídeos, a enzima pode se dissociar e se ligar novamente os genes j e k, ambos os cromossomos contêm DNA de ambos
e adicionar novas repetições de 6-nt. os pais. Houve uma troca igual, recíproca entre eles.

BioQ.04 151 22.01.07 16:37:33


158 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Mutações Inserções ou remoções de um ou mais pares de ba-


ses podem levar a mudanças na estrutura de leitu-
As mutações são alterações hereditárias na seqüência ra ( frameshifts) (se o número de pares de bases não
do DNA. Podem resultar de erros na replicação, de le- for múltiplo de 3), destruindo o código de uma pro-
sões no DNA ou de erros durante o reparo de lesões. teína (Figura 4.24c,d). Tradução de um mRNA não
Mutações que são trocas de um único par de bases são tem pontuação; ao contrário, uma vez que o código de
chamadas mutações puntuais. Mutações puntuais iniciação tenha sido determinado, tripletes sucessivos
podem ser classificadas pela natureza das bases altera- são lidos como códons. Portanto, adição (ou deleção)
das. Transições são mutações puntuais, nas quais uma de um múltiplo de três pares de bases em uma região
purina é substituída por outra (p. ex., A por G ou G por codificadora adicionaria (ou subtrairia) aminoácidos a
A) ou uma pirimidina é substituída por outra (p. ex., T uma proteína, mas adição de outros números de pares
por C ou C por T). Deaminação de C, se não reparada, de bases deslocaria a estrutura da leitura daquele pon-
levaria a uma transição. A freqüência de transições é to em diante. Mudança na estrutura de leitura ( fra-
aumentada por análogos de bases, incluindo 2-amino meshift) muda os aminoácidos codificados a partir do
purina (Corr. Clín. 4.7). Transversões são mutações ponto de inserção ou remoção. Frameshifts geralmen-
puntuais, nas quais uma purina é substituída por uma te levam à terminação prematura (ou, mais raramente,
pirimidina ou vice versa (p. ex., A por C ou C por A). à elongação) da cadeia polipeptídica codificada, quan-
Mutações puntuais também podem ser caracteriza- do códons de terminação (stop codons) são gerados
das por seu efeito sobre uma seqüência codificadora. ou removidos pela mudança na estrutura de leitura.
Mutações de sentido errado (missense) são mu- Alguns agentes químicos, incluindo acridinas e pro-
tações puntuais que trocam um único par de bases flavina, intercalam-se no DNA; isto é, inserem-se en-
em um códon, de modo que o códon agora codifica um tre pares de bases adjacentes. Isso geralmente leva a
aminoácido diferente (Figura 4.24a). Mutações sem inserções ou remoções de um único par de bases. Mu-
sentido (nonsense) são mutações puntuais que tro- tações também podem resultar de alterações em lar-
cam um único par de bases em um códon para um có- ga escala, incluindo inserção de transposons. Embora
don de terminação (stop codon) que termina a tradu- raras em uma geração qualquer, mutações acumula-
ção (Figura 4.24b). Mutações sem sentido geralmente ram-se em populações ao longo de milhões de anos,
têm efeitos mais graves do que mutações de sentido de modo que duas pessoas diferem em cerca de 1 pb
errado porque levam à síntese de polipeptídeos trun- por 1000 ao longo de seus genomas. Muitas dessas di-
cados (e geralmente instáveis). Mutações silenciosas ferenças genéticas não têm efeito, mas outras afetam
ou sinônimos não alteram o aminoácido codificado; nossa fisiologia, susceptibilidade a doenças e resposta
estas incluem muitas mudanças no terceiro nucleotí- a tratamentos (Corr. Clín. 4.8).
deo de um códon.

CORRELAÇÃO CLÍNICA 4.7


Análogos de Nucleosídeos como Drogas: Tiopurinas

6-Mercapto purina (6-MP) é um análogo de purina Outra enzima que metaboliza 6-MP (e o anti-
administrado oralmente que é útil na quimioterapia metabólito relacionado 6-tioguanina) é tiopurina
de leucemias agudas e para imunossupressão após metil transferase (TPMT). Alguns pacientes (cerca
transplante de órgãos. Age por vários mecanismos, de 10% da população) são heterozigotos para um
incluindo inibição da biossíntese de purinas e toxi- polimorfismo que inativa a enzima e, portanto, tem
cidade após incorporação no DNA. É metabolizado aproximadamente 50% da atividade, e 1/300 das
a 6-MP ribosina 5´-fosfato, que tem curta meia-vida, pessoas não têm atividade de TPMT e têm risco ex-
porque é degradada por xantina oxidase. A velocida- tremamente alto de imunossupressão grave e morte
de de degradação é muito reduzida em pacientes que se forem tratadas com 6-MP. Por outro lado, pessoas
estão sendo tratados com alopurinol (um inibidor da que metabolizam as drogas mais rapidamente po-
xantina oxidase) para hiperuricemia relacionada à dem não chegar a ter dose terapêutica suficiente.
gota, de modo que a dose deve ser drasticamente re- Essa diferença farmacogenética, portanto, tem sé-
duzida em tais pacientes. rias implicações para o tratamento com tiopurinas.

Fonte: Sanderson, J., Ansari, A., Marinaki, T. e Duley, J. Thiopurine methyltransferase: Should it be measured
before commencing thiopurine drug therapy? Ann. Clin. Biochem. 41:294, 2004.

BioQ.04 158 22.01.07 16:37:40


CAPÍTULO 4 REPLICAÇÃO, RECOMBINAÇÃO E REPARO NO DNA | 169

| BIBLIOGRAFIA |

Baynton, K. e Fuchs, R. P. P. Lesions in DNA: Hurdles for poly- recombination-dependent replication. Trends Biochem,
merases. Trends Biochem. Sci. 25:75, 2000. Sci. 25:156, 2000.
Berger, J. M., Gamblin, S. J., Harrison, S. C. e Wang, J. C. Struc- Lieber, M. R., Ma, Y., Pannicke, U. e Schwarz, K. Mechanism
ture and mechanism of DNA topoisomerase II. Nature and regulation of human non-homologous DNA end joining.
379:225, 1996. Nature Rev. Mol. Cell Biol. 4:712, 2003.
Blow, J. J. e Tada, S. A new check on issuing the license. Natu- Lindahl, T. e Wood, R. D. Quality control by DNA repair. Scien-
re 404:560, 2000. ce 286:1897, 1999.
Cooke, M. S., Evans, M. D., Dizdaroglu, M. e Lunec, J. Oxidative Modrich, P. Mismatch repair, genetic stability, and cancer.
DNA damage: Mechanisms, mutation, and disease. FASEB Science 266:1959, 1994.
J. 17:1995, 2003. Naktinis, V., Turner, J. e O’Donnell, M. A molecular switch in
Cox, M. M., Goodman, M. E., Kreuzer, K. N., Sherratt, D. J., a replication machine defined by internal competition for
Sandler, S. J. e Marians, K. J. The importance of repairing protein rings. Cell 84:137, 1996.
stalled replication forks. Nature 404:37, 2000. Online Mendelian Inheritance in Man (OMIM) http://www.
Evans, A. R., Limp-Foster, M. e Kelley, M. R. Going Ape over ncbi.nlm.\nih.gov/entrez/query.fcgi?db=OMIM
Ref-1. Mutat. Res. 461:83, 2000. Rattray, A. J. e Strathern, J. N. Error-prone DNA polymera-
Flores-Rozas, H. e Kolodner, R. D. Links between replication, ses: When making a mistake is the only way to get ahead.
recombination, and genome instability in eucaryotes. Annu. Rev. Genet. 37:31, 2003.
Trends Biochem. Sci. 25:196, 2000. Sancar, A. Excision repair in mammalian cells. J. Biol. Chem.
Friedberg, E. C. DNA damage and repair. Nature 421:436, 270:15915, 1995.
2003. Stillman, B. Cell cycle control of DNA replication. Science
Friedberg, E. C. How nucleotide excision repair protects 274:1659, 1996.
against cancer. Nature Rev. Cancer 1: 22, 2001. Stahl, F. Meiotic recombination in yeast: coronation of the dou-
Gerson, S. L. MGMT: Its role in cancer aetiology and cancer ble-strand-break repair model. Cell 87:965, 1996.
therapeutics. Nature Rev. Cancer 4: 296, 2004. Ulaner, G. A. Telomere maintenance in clinical medicine. Am.
Haber, J. E. DNA recombination: the replication connection. J. Med. 117:262, 2004.
Trends Biochem. Sci. 25:271, 2000. Von Hippel, P. H. e Jing, D. H. Bit players in the trombone or-
Hanawalt, P. C. Transcription-coupled repair and human dise- chestra. Science 287:2435, 2000.
ase. Science 266:1957, 1994. Waga, S. e Stillman, B. Anatomy of a DNA replication fork reve-
Hanawalt, P. C. The bases for Cockayne syndrome. Nature aled by reconstitution of SV40 replication in vitro. Nature
405:415, 2000. 369:207, 1994.
Hubscher, U., Maga, G. e Spadari, S. Eukaryotic DNA polyme- Watson, J. D. e Crick, F. H. C. Genetical implications of the
rases. Annu. Rev. Biochem. 71:133, 2002. structure of deoxyribonucleic acid. Nature 171:964, 1953.
Human genome project. http://www.nhgri.nih.gov/HGP/ Wood, R. D., Mitchell, M., Sgouros, J. e Lindahl, T. Human DNA
Human genome sequencing. http://www.ncbi.nih.gov/genome/ repair genes. Science 291:1284, 2001.
seq/ Yu, Z., Chen, J., Ford, B. N., Brackley, M. E. e Glickman, B. W.
Johnson, R. E., Washington, M. T., Haracska, L., Prakash, S. Human DNA repair systems: an overview. Environ. Mol.
e Prakash, L. Eucaryotic polymerases ι and ζ act sequen- Mutagen. 33:3, 1999.
tially to bypass DNA lesion. Nature 406:1015, 2000. Zakian, V. A. Telomeres: beginning to understand the end.
Kowalczykowski, S. C. Initiation of genetic recombination and Science 270:1601, 1995.

| QUESTÕES | Carol N. Angstadt


Questões de Múltipla Escolha. D. FEN 1 ( flap endonuclease 1) está envolvida na re-
1. Replicação: moção do primer.
A. é semiconservativa. E. o processo ocorre ao longo de todo o ciclo celular.
B. requer apenas proteínas com atividade de DNA poli- 3. Todas as afirmativas seguintes sobre a telomerase são
merase. corretas, exceto:
C. usa atividade de polimerase 5’ para 3’ para sintetizar A. o componente RNA age como molde para a síntese de
uma fita, e atividade de polimerase 3’ para 5’ para sin- um segmento de DNA.
tetizar a fita complementar. B. adiciona telômeros às extremidades 5’ das fitas de
D. requer um primer em eucariotos, mas não em proca- DNA.
riotos. C. fornece um mecanismo para replicar as extremidades
E. deve começar com uma etapa de quebra. de cromossomos lineares.
2. Na replicação de DNA eucariótica: D. reconhece uma fita única do DNA rica em G.
A. só um replissomo se forma, porque há uma única ori- E. é uma transcriptase reversa.
gem de replicação. 4. Uma mutação por transição:
B. os fragmentos de Okasaki têm 1000 a 2000 nucleotíde- A. ocorre quando uma purina é substituída por uma piri-
os de comprimento. midina ou vice-versa.
C. helicase se dissocia do DNA assim que as bolhas de B. resulta da inserção de uma ou duas bases na cadeia de
iniciação se formam. DNA.

BioQ.04 169 22.01.07 16:37:56


172 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

PA
IIB
IID

IIA
IIF

TATA INR DPE


Pol II

IIE
IIH

5
RNA: TRANSCRIÇÃO E
PROCESSAMENTO
Francis J. Schmidt e David R. Setzer

5.1 VISÃO GERAL, 173 mento durante transcrição em eucariotos, 186


Capping, 186
5.2 MECANISMOS DE TRANSCRIÇÃO, 173 Remoção de íntrons de precursores de mRNA,
Processo inicial de síntese de RNA é transcrição, 186
173 Poliadenilação, 188
Informação em seqüência de DNA sinaliza síntese Mutações em sinais de splicing causam doenças
de RNA, 173 humanas, 188
RNA polimerase catalisa o processo de transcri- Splicing alternativo de pré-mRNA pode levar à
ção, 174 síntese de múltiplas isoformas de proteínas
Etapas da transcrição em procariotos, 175 a partir de uma única seqüência codificadora
Reconhecimento do promotor, 175 no DNA, 190
Início da síntese, 176
Elongação, 177 5.5 EXPORTAÇÃO DO RNA E CONTROLE DE QUA-
Terminação, 178 LIDADE, 191

5.3 TRANSCRIÇÃO EM EUCARIOTOS, 178 5.6 RNAs PEQUENOS INIBITÓRIOS, 192


Natureza da cromatina ativa, 178
Ativação da transcrição opera por recrutamento 5.7 REPARO DO DNA ACOPLADO À TRANSCRI-
de RNA polimerase, 179 ÇÃO, 192
Enhancers, 179
Transcrição por RNA polimerase II, 180 5.8 NUCLEASES E TURNOVER DO RNA, 193
Promotores para a síntese de mRNA, 180
Transcrição por RNA polimerase I, 181 BIBLIOGRAFIA, 194
Transcrição por RNA polimerase III, 181
A base enzimática comum para ação de RNA QUESTÕES E RESPOSTAS, 195
polimerases, 183
CORRELAÇÕES CLÍNICAS
5.4 PROCESSAMENTO DE RNA, 184 5.1 Antibióticos e Toxinas que Têm RNA Poli-
RNA transportador é modificado por clivagem, merase como Alvo, 176
adição e modificação de bases, 184 5.2 Síndrome do X Frágil: Uma Doença de RNA-
Clivagem, 184 Cromatina?, 179
Adição na extremidade 3´, 184 5.3 Envolvimento de Fatores Transcripcionais
Nucleosídeos modificados, 184 em Carcinogênese, 182
Processamento de RNA ribossômico libera vários 5.4 Talassemia Devido a Defeitos na Síntese de
RNAs de um precursor mais longo, 184 RNA Mensageiro, 188
Processamento de RNA mensageiro garante a 5.5 Auto-imunidade em Doença do Tecido Con-
seqüência codificadora correta, 185 juntivo, 189
RNA polimerase II recruta enzimas de processa- 5.6 Síndrome de Cockayne, 193

BioQ.05 172 22.01.07 16:40:55


CAPÍTULO 5 RNA: TRANSCRIÇÃO E PROCESSAMENTO | 179
Sítios HSS
(setas) 5� transcrito
CORRELAÇÃO CLÍNICA 5.2
Oviduto, imaturo Síndrome do X Frágil: Uma
Doença de RNA-Cromatina?
Oviduto, maduro
Síndrome do X frágil é a forma individual mais
comum de retardo mental hereditário, afetando
Eritrócitos
1/1250 homens e 1/2000 mulheres. Uma variedade
-5 0
de sintomas anatômicos e neurológicos resulta de
inativação do gene FMR1, localizado no cromosso-
mo X. A genética da síndrome é complexa, devido
Distância no DNA do início da transcrição, em quilobases ao mecanismo molecular da mutação do X frágil.
A condição do X frágil resulta de expansão
FIGURA 5.5 de uma seqüência repetida de um trinucleotí-
Sítios hipersensíveis à DNase (HSS) antes do promotor do deo, CGG, encontrado na região 5’ não-traduzi-
gene de lisozima de galinha, uma unidade transcripcional da do gene FRM1. Normalmente, essa repetição
eucariótica típica.
Sítios hiper-sensíveis – isto é, seqüências próximas ao gene está presente em 30 cópias, embora indivíduos
da lisozima que são particularmente susceptíveis à digestão normais possam ter até 200 cópias da repetição.
por nucleases mesmo quando empacotadas em cromatina Em indivíduos com síndrome do X frágil, o gene
– são indicados por setas. É provável que esses sítios fiquem
livres de nucleossomos. Note que alguns sítios hipersensíveis FRM1 contém muito mais cópias, de 200 a milha-
são encontrados no promotor da lisozima tanto em oviduto res, da repetição CGG. A genética complexa da
maduro como imaturo. Indução da síntese de lisozima em ovi- doença resulta do potencial da repetição CGG se
duto maduro é acompanhada pelo aparecimento de um novo
sítio hipersensível. Em contraste, nenhum sítio hipersensível expandir de geração para geração.
está presente em eritrócitos nucleados que nunca sintetizam A presença de um número anormalmente ele-
lisozima. vado de repetições CGG induz extensa metilação
Adaptado de Elgin, S. C. R. J. Biol. Chem. 263:1925, 1988.
do DNA de toda a região do promotor de FMR1.
DNA metilado é transcripcionalmente inativo,
de modo que mRNA de FMR1 não é sintetizado.
Outras modificações de histonas que influenciam Ausência da proteína FMR1 leva à patologia da
atividade gênica incluem metilação, fosforilação e ubi- doença. Proteína FMR1 normalmente se localiza
quitinação. Combinações dessas modificações ocor- no citoplasma de todos os tecidos do feto jovem
rendo em diferentes posições específicas em histonas e, mais tarde, especialmente no cérebro e tecido
podem constituir um “código histona” que acopla mo- neural fetal. A proteína FMR afeta tradução de
dificação de histonas, compactação de cromatina, mo- vários mRNAs e uma hipótese é que essa proteí-
dificação do DNA e atividade gênica (Corr. Clín. 5.2). na ajude na tradução e localização de mRNAs es-
A idéia geral é que cromatina parcialmente desdobrada pecíficos durante desenvolvimento. Uma possibi-
seja necessária, mas não suficiente, para transcrição. lidade descoberta recentemente é que a proteína
FMR1 esteja envolvida em RNA de interferência
Ativação de Transcrição Opera por e sua perda possa causar ampla regulação gênica
anormal (ver Seção 5.7). É provável que várias
Recrutamento de RNA Polimerase vias de sinalização estejam ligadas à patologia
Fatores protéicos eucarióticos, independentemente dessa doença muito complexa.
da seqüência à qual se liguem, operam de modo funda-
mentalmente diferente do fator σ de E.coli. Em vez de
primeiro fazer parte de um complexo protéico e depois Fonte: Warren, S. L. e Nelson, D. L. Advance in molecu-
procurar a seqüência relevante no DNA, os fatores se lar analysis of Fragile X syndrome. JAMA 271:536, 1994.
ligam a um sítio específico (seqüência) do DNA e de- Caskey, C. T. Triple repeat mutations in human disease.
pois ligam RNA polimerase (com ou sem envolvimento Science 256:784, 1992. Jin, P., Zarnescu, D. C., Ceman, S.,
de fatores intermediários). Esse mecanismo é chamado Nakamoto, M., Mowrey, J., Jongens, T. A., Nelson, D. L.,
“recrutamento”. Recrutamento é um meio pouco impor- Moses, K. e Warren, S. T. Biochemical and genetic interac-
tante em ativação de genes em procariotos, e o princi- tion between the fragile X mental retardation protein and
pal mecanismo em eucariotos. the micro RNA pathway. Nature Neurosci. 7:113, 2004.
Miyashiro, K. e Eberwine, J. Fragile X syndrome: (What’s)
Enhancers lost in translation? Proc. Natl. Acad. Sci. USA 101:17329,
2004. Fragile Site Mental Retardation 1 Gene; FMR1 in
Enhancers ou amplificadores aumentam muitas Online Mendelian Inheritance in Man, http://www.ncbi.
vezes a expressão de um gene. Fatores de transcrição nlm.nih.gov/entrez/dispomim.cgi?id=309550

BioQ.05 179 22.01.07 16:41:05


184 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Nucleotídeos entram e RNA sai por dois outros canais ordem temporal bem definida, mas não necessariamen-
separados na molécula. A despeito das diferenças em te rígida. Primeiro, o transcrito primário é cortado de
seqüências e composição em subunidades, RNA polime- modo relativamente inespecífico para gerar uma molé-
rases procarióticas e eucarióticas mantiveram estrutu- cula precursora com extensões 5’ e 3’ mais curtas. En-
ras semelhantes para desempenhar os mesmos objeti- tão ribonuclease P, uma ribozima (ver p. 68), remove
vos levando à síntese de uma nova cadeia de RNA. Estas a extensão 5’ por clivagem endonucleolítica. A extre-
incluem: (1) passagem do DNA molde por um canal na midade 3’ é cortada exonucleoliticamente, seguida por
enzima; (2) separação das fitas de DNA para formar síntese da terminação CCA. Síntese dos nucleotídeos
uma bolha na qual um híbrido RNA-DNA existe com a modificados ocorre em qualquer ordem em relação à
extremidade 3’ da cadeia de RNA posicionada no sítio clivagem nucleolítica. Remoção de íntrons é determina-
ativo; (3) colocação de nucleotídeos no sítio ativo por da pela estrutura secundária do precursor (ver Figura
um poro da enzima; (4) uso de um íon metálico para 5.10) e é executada por um sistema enzimático solúvel,
ajudar na catálise da formação de uma nova ligação és- com dois componentes; uma enzima remove o íntron e
ter fosfato entre o fosfato α do nucleosídeo trifosfato a outra sela novamente a cadeia nucleotídica.
que está chegando e a extremidade 3’ da cadeia nascen-
te de RNA; (5) exclusão do RNA produzido por outro Adição na Extremidade 3’
poro; e (6) direção do re-pareamento das duas fitas de
DNA, à medida que saem da enzima. Todo tRNA funcional tem a seqüência CCA em sua ex-
Lembre-se que a subunidade σ da holoenzima pro- tremidade 3’. Essa seqüência é essencial para tRNA
cariótica é responsável por ligar as caixas –10 e –35 de aceitar aminoácidos. Na maioria dos casos, é adicionada
promotores. Estudos estruturais demonstraram que seqüencialmente pela enzima tRNA nucleotidiltransfe-
sigma é uma molécula oblonga, composta por um feixe rase. Nucleotidiltransferases usam ATP e CTP como
de resíduos em α-hélice, empacotados em uma forma substratos e sempre incorporam-nos em tRNA numa
de “V” aberto. Um braço do “V” contém resíduos críticos razão de 2C/1A. As extremidades CCA são encontradas
para reconhecimento do promotor e ligação com poli- tanto em tRNAs citoplasmáticos como mitocondriais.
merase core. Um lado desse braço contém uma α-hélice
que se liga à seqüência “–10”, e a outra face liga polime- Nucleosídeos Modificados
rase core por interações hidrofóbicas.
Nucleotídeos de RNA transportador são os mais modi-

|
ficados de todos os ácidos nucléicos. Mais de 60 modifi-
5.4 PROCESSAMENTO DE cações diferentes nas bases e na ribose, exigindo bem
RNA mais de 100 diferentes reações enzimáticas, foram en-
contradas em tRNA. Muitas são simples, metilações de
uma etapa, mas outras envolvem síntese com múltiplas
Cópias em RNA de seqüências de DNA devem ser modi- etapas.
ficadas em moléculas maduras, funcionais, em procario- Formação de algumas bases modificadas na realida-
tos e eucariotos. As reações de processamento do RNA de requer quebra da ligação β-glicosídica entre ribose
podem incluir remoção de nucleotídeos extras, modifi- e a base. Enzimas modificadoras produzem as mesmas
cação de bases, adição de nucleotídeos e separação de modificações específicas em mais de uma espécie de
diferentes seqüências de RNA pela ação de nucleases es- tRNA; entretanto, as enzimas modificadoras são local-
pecíficas. Reações de processamento podem ocorrer co- específicas. A maioria das modificações se completa an-
transcripcionalmente (enquanto o RNA ainda está sen- tes de os precursores de tRNA terem sido clivados ao
do transcrito) ou pós-transcripcionalmente (depois do tamanho do tRNA maduro.
transcrito ter sido liberado pela RNA polimerase). Final-
mente, em eucariotos, RNAs são exportados do núcleo. Processamento de RNA Ribossômico
Libera Vários RNAs de um Precursor
RNA Transportador É Modificado
Mais Longo
por Clivagem, Adição e Modificação
de Bases O produto primário da transcrição do gene de rRNA é
um RNA longo, chamado 45S RNA, que contém as se-
Clivagem qüências dos rRNAs 28S, 5,8S e 18S. Processamento
do 45S RNA ocorre no nucléolo, e é feito por grandes
O transcrito primário de um gene de tRNA contém se- estruturas de ribonucleoproteínas, com múltiplas subu-
qüências extras de nucleotídeos, tanto 5’ como 3’ da se- nidades. Processamento dos rRNAs segue uma ordem
qüência do tRNA. Esses transcritos primários também seqüencial (Figura 5.11).
podem conter íntrons na região do anticódon. Reações Processamento de pré-rRNA em procariotos também
de processamento pós-transcripcional ocorrem em uma envolve clivagem de precursores de alto peso molecular

BioQ.05 184 22.01.07 16:41:13


CAPÍTULO 5 RNA: TRANSCRIÇÃO E PROCESSAMENTO | 193

CORRELAÇÃO CLÍNICA 5.6


Síndrome de Cockayne
Síndrome de Cockayne (CS) é uma doença complexa parada por ter encontrado uma base alterada (p.
autossômica recessiva causada por uma mutação em ex., um fotodímero de timina). Transcrição pára,
um de dois genes. Pacientes com CS apresentam alte- o transcrito parcial é degradado, e a fita molde do
rações de desenvolvimento e neurológicas, anomalias DNA é reparada. Aparentemente, aumento da trans-
esqueléticas e de retina, e uma deformidade facial crição pela proteína CSB também estimula o reparo
“tipo pássaro”. Morte geralmente ocorre por volta dos do DNA acoplado à transcrição.
20 anos de idade e é causada por degeneração neural. Se esta fosse toda a história, síndrome de Co-
A maioria dos pacientes com síndrome de Cockayne ckayne seria uma variante do xeroderma pigmen-
são também fotossensíveis e predispostos a câncer de toso; entretanto, pacientes com XP têm desenvol-
pele. vimento normal e são neurologicamente normais,
Fotossensibilidade aponta para um defeito em embora ainda sejam fotossensíveis. O que causa as
reparo do DNA. Por exemplo, xeroderma pigmento- outras características de CS? É provável que esses
so (XP) resulta de mutações em vários dos compo- outros sintomas sejam devidos a uma deficiência
nentes da via de reparo do DNA. CS também é uma primária na elongação da transcrição causada pelo
deficiência em reparo do DNA. Surpreendentemen- fator de elongação CSB alterado pela mutação. Essa
te, um dos dois genes responsáveis pela síndrome é idéia expande nosso entendimento da relação entre
uma subunidade da RNA polimerase II. A proteína mutação e doença. Geralmente, doenças genéticas
codificada pelo gene da síndrome de Cockayne B são causadas por uma mutação em processos bio-
aumenta a velocidade de elongação pela RNA poli- químicos que ficam fora das vias centrais de infor-
merase II. mação da célula. Isso faz sentido, porque inibição
Como pode uma deficiência de RNA polimerase geral da síntese de DNA, RNA ou proteína seria letal
causar um problema no reparo do DNA? A resposta num estágio precoce do desenvolvimento. Os defei-
é que os pacientes com CS são deficientes no repa- tos generalizados de CS devem se dever à mutação
ro do DNA acoplado à transcrição. Reparo acoplado afetando a transcrição de alguns genes mais do que
à transcrição ocorre quando RNA polimerase fica a de outros.

Fonte: Citterio, E., Vermeulen, W. e Hoeijmakers, J. H. J. Transcriptional healing. Cell 101:447, 2000; Selby, C. P.
e Sancar, A. Cockayne syndrome group B protein enhances elongation by RNA polymerase II. Proc. Natl. Acad. Sci.
U.S.A. 94:11205, 1997. van Gool, A. J., van der Horst, G. T. J., Citterio, E. e Hoeijmakers, J. H. J. Cockayne syndrome:
defective repair of transcription? EMBO J. 16:4155, 1997. Cockayne Syndrome, Type I; CKN1 in Online Mendelian
Inheritance in Man, http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=216400

|
5.8 NUCLEASES E Isso é mais claro para espécies de mRNA, que são
classificadas como instáveis. Entretanto, mesmo os
TURNOVER DO RNA RNAs ditos estáveis são reciclados; por exemplo, a meia
vida de espécies de tRNA no fígado é cerca de 5 dias.
Uma meia vida bastante longa para um mRNA de ma-
As diferentes funções de RNA e DNA em expressão míferos é 30 h.
gênica refletem-se em seus destinos metabólicos. O re- Remoção de RNAs do citoplasma é realizada por ri-
positório de informação genética de uma célula (DNA) bonucleases celulares. Nucleases são de vários tipos e
deve ser preservado, explicando assim a existência dos especificidades. A distinção mais útil é entre exonuclea-
múltiplos sistemas de reparo e edição do DNA no nú- ses, que degradam RNA a partir da extremidade 5’ ou 3’,
cleo. Embora seqüências individuais de nucleotídeos no e endonucleases, que clivam ligações fosfodiéster dentro
DNA possam ser recicladas, a molécula como um todo é de uma molécula. Produtos de ação de RNase contêm
metabolicamente inerte quando não está replicando. As fosfatos 3’- ou 5’-terminal, e tanto endo- como exonucle-
várias moléculas de RNA, por outro lado, são individu- ases podem ser melhor caracterizadas pela posição (5’
almente dispensáveis e podem ser substituídas por es- ou 3’), na qual o monofosfato criado pela clivagem fica
pécies recém-sintetizadas com a mesma especificidade. localizado. A estrutura do RNA também afeta a ação da
Não é surpreendente que sistemas de reparo de RNA não nuclease. A maioria das nucleases é menos eficiente em
sejam conhecidos. Em vez disso, RNAs defeituosos são regiões de RNA com estrutura muito ordenada.
removidos das células por degradação a nucleotídeos, Assim, tRNAs são preferencialmente clivados em
que depois são reutilizados em novas espécies de RNA. regiões não-pareadas da seqüência. Por outro lado,

BioQ.05 193 22.01.07 16:41:25


CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO | 197

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

6
SÍNTESE DE PROTEÍNAS:
TRADUÇÃO E MODIFICA-
ÇÕES PÓS-TRADUÇÃO
Dohn Glitz

6.1 VISÃO GERAL, 198 Alguns antibióticos e toxinas inibem biossíntese


6.2 COMPONENTES DO APARELHO DE TRADU- de proteínas, 215
ÇÃO, 198
RNA mensageiro transmite informação codifica- 6.4 AMADURECIMENTO DE PROTEÍNAS: DOBRA-
da em DNA, 198 MENTO, MODIFICAÇÃO, SECREÇÃO E DIRE-
RNA transportador é uma molécula tradutora CIONAMENTO, 218
bilíngüe, 199 Chaperones ajudam em dobramento de proteínas
O código genético usa um alfabeto de quatro 218
letras de nucleotídeos, 199 Proteínas para exportação seguem a via
Códons em mRNA são palavras de três letras, secretória, 218
199
Glicosilação de proteínas ocorre no retículo endo-
Pontuação, 199
plasmático e no complexo de Golgi, 218
Interações códon-anticódon permitem leitura de
mRNA, 199
6.5 DIRECIONAMENTO PARA MEMBRANA E OR-
“Decifrando” o código genético, 200
Mutações, 201 GANELAS, 224
Aminoacilação de RNA transportador ativa Seleção de proteínas na via secretória, 224
aminoácidos para síntese protéica, 203 Importação de proteínas por mitocôndrias requer
Especificidade e fidelidade de reações de sinais específicos, 227
aminoacilação, 205 Direcionamento para outras organelas requer
Ribossomos são bancadas de trabalho para sinais específicos, 227
síntese protéica, 205
6.6 MAIS MODIFICAÇÕES PÓS-TRADUÇÃO, 227
6.3 BIOSSÍNTESE DE PROTEÍNAS, 209 Proteólise parcial libera insulina e ativa
Tradução é direcional e colinear com mRNA, 209 zimogênios, 227
Iniciação da síntese de proteínas é um processo Aminoácidos podem ser modificados após
complexo, 209 incorporação em proteínas, 228
Elongação é a formação passo a passo de ligações Biossíntese de colágeno requer muitas
peptídicas, 211 modificações pós-tradução, 231
Terminação da síntese do polipeptídeo requer um Formação de pró-colágeno no retículo endo-
códon de parada (stop codon), 215 plasmático e no complexo de Golgi, 231
Tradução tem custo energético significativo, 215 Maturação de colágeno, 231
Síntese de proteínas em mitocôndrias difere
ligeiramente, 215 6.7 REGULAÇÃO DA TRADUÇÃO, 234

BioQ.06 197 22.01.07 16:43:42


CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO | 209
sintetizam proteínas que serão secretadas da célula ou tico 2a (eIF-2a) liga-se a GTP e ao tRNA iniciador, Met-
seqüestradas e funcionam em retículo endoplasmáti- tRNA imet, para formar um complexo ternário. Nenhum
co, complexo de Golgi ou lisossomos. Em homogenatos outro aminoacil-tRNA pode substituir o Met-tRNA imet
celulares, fragmentos de membranas com ribossomos iniciação-específico nessa etapa. Procariotos também
ligados constituem a fração microssomal; detergentes utilizam um tRNA iniciador específico, cuja metionina é
que destroem membranas liberam esses ribossomos. modificada por formilação de seu amino grupo. Só fMet-
tRNA imet é reconhecido pelo IF-2 procariótico.

|
6.3 BIOSSÍNTESE DE A segunda etapa requer subunidades ribossômi-
cas 40 S associadas a uma proteína muito complexa,
PROTEÍNAS eIF-3. eIF-3 de mamíferos contém oito polipeptídeos
diferentes e tem uma massa de 600-650 kDa; liga-se
à superfície da subunidade 40 S que fará contato com
Tradução É Direcional e Colinear com a subunidade 60 S e bloqueia fisicamente a associação
das subunidades. Portanto, eIF-3 é um fator antias-
mRNA sociação ribossômica – assim como eIF-6 que se liga a
subunidades 60 S. Um complexo que inclui eIF-2a-GTP,
Seqüências de RNA mensageiro são escritas (e trans-
Met-tRNA i Met, eIF-3-40 S e fatores protéicos adicionais
critas) 5’→3’, e durante tradução são lidas na mesma
agora se forma. Na terceira etapa, o complexo de pré-
direção. Seqüências de aminoácidos são tanto escritas
iniciação é formado: mRNA, eIF-4f, também chamado
como sintetizadas do resíduo amino-terminal para o
complexo de ligação ao cap, eIF-4a, uma helicase
carboxi-terminal. Um ribossomo permanece ligado a
que desenrola estrutura secundária da seqüência líder
uma molécula de mRNA e se move ao longo do compri-
não-traduzida do mRNA, PAB, uma proteína de ligação
mento do mRNA até que chegue a um códon de parada.
a poliA que faz uma alça aproximando a extremidade 3’
Comparações de seqüências de mRNA com seqüências
do mRNA do 5’-cap, e várias outras proteínas são ne-
das proteínas que codificam mostraram uma corres-
cessárias. O mRNA é então percorrido 5´à3´ até que o
pondência perfeita, colinear, sem sobreposições e sem
primeiro triplete AUG seja encontrado. Raramente, o
falhas entre a seqüência codificadora do mRNA e a do
primeiro AUG não é usado e um AUG posterior, carac-
polipeptídeo sintetizado. (Para uma rara exceção, ver
terizado por sua estrutura secundária no mRNA, é se-
Corr. Clín. 6.4). De fato, é comum deduzir a seqüência
lecionado para iniciação. GTP é hidrolisado por eIF-2a
de uma proteína, exclusivamente a partir da seqüência
com a ajuda de eIF-5, e eIF-2a-GDP e outros fatores são
de seu mRNA ou do DNA de seu gene. Entretanto, a
liberados. O eIF-2a-GDP interage com fator trocador de
seqüência deduzida pode diferir da proteína genuína,
nucleotídeo de guanina eIF-2b e GTP para regenerar
devido a modificações pós-tradução.
eIF-2a-GTP para outro ciclo de iniciação.
Uma história pode ser analisada em função de seu
A etapa final requer ligação desse complexo com
início, seu desenvolvimento ou parte do meio e seu final.
uma subunidade 60S e um fator adicional, eIF-5b-GTP.
Biossíntese de proteínas será descrita num arcabouço
GTP é hidrolisado, e eIF-5b-GDP e outros fatores são
semelhante: início do processo, elongação durante a
liberados. O complexo de iniciação completo é um
qual a maior parte da proteína é formada, e terminação
ribossomo 80 S com o mRNA e tRNA iniciador correta-
da síntese e liberação do polipeptídeo completo. Va-
mente posicionados para começar tradução.
mos depois examinar modificações pós-tradução, pelas
Procariotos usam menos fatores de iniciação para
quais uma proteína pode passar.
formar um complexo de iniciação similar. Suas subu-
nidades 30 S, complexadas com um IF-3 mais simples,
Iniciação da Síntese de Proteínas É podem ligar mRNA ou um complexo ternário de IF-2,
um Processo Complexo fMet-tRNA i met e GTP. Orientação do mRNA depende,
em parte, do pareamento de bases entre uma seqüência
Iniciação requer aproximação de uma subunidade ribos- rica em pirimidinas de oito nucleotídeos no 16 S rRNA e
sômica pequena (40 S), um mRNA e um complexo tRNA uma seqüência “Shine-Dalgarno” rica em purinas, cer-
do aminoácido amino-terminal, todos em uma orienta- ca de 10 nucleotídeos antes do códon AUG iniciador.
ção correta. Segue-se associação da subunidade grande Complementaridade entre rRNA e mRNA pode in-
(60 S) para formar um complexo de iniciação completo cluir vários pares errados, mas maior complementari-
em um ribossomo 80 S. Esse processo requer um grupo dade geralmente leva a iniciação que é mais eficiente.
de proteínas ligadas transitoriamente, conhecidas como Fator de iniciação IF1 também atua na formação do
fatores de iniciação, que só atuam na iniciação. A fun- complexo de pré-iniciação. Finalmente, subunidade
ção específica de alguns fatores de iniciação eucarióticos 50 S é ligada, GTP é hidrolisado a GDP e os fatores de
permanece pouco clara, mas síntese de proteínas pro- iniciação são liberados. É interessante que procariotos
cariótica fornece um modelo mais simples para compa- usem pareamento de bases RNA-RNA para posicionar
ração. A iniciação da tradução é apresentada na Figura mRNA, enquanto eucariotos usam muitos fatores pro-
6.7. Como primeira etapa, fator de iniciação eucarió- téicos para chegar ao mesmo resultado.

BioQ.06 209 22.01.07 16:43:55


CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO | 219

CORRELAÇÃO CLÍNICA 6.6


Deleção de um Códon, Modificação Pós-Tradução Incorreta e
Degradação Prematura de Proteína: Fibrose Cística

Fibrose cística é a doença autossômica recessiva vem secreções mucosas viscosas que levam a doença
mais comum em caucasianos, com uma freqüência pulmonar obstrutiva crônica e infecções persisten-
de cerca de 1 por 2000. O gene CF tem 230 kb de tes nos pulmões.
comprimento e inclui 27 éxons que codificam uma Em cerca de 70% dos indivíduos afetados, há uma
proteína de 1480 aminoácidos. A proteína conhecida deleção dos três nucleotídeos que codificam fenila-
como regulador de condutância transmembrânica da lanina 508, normalmente localizada no domínio 1 de
fibrose cística ou CFTR (ver p. 474) é um membro de ligação ao ATP, no lado citoplasmático da membrana
uma família de proteínas de transporte dependen- plasmática. Como em várias outras mutações CF, a
tes de ATP. Contém dois domínios que atravessam a proteína com deleção de Phe 508 não se dobra cor-
membrana, cada um com seis regiões transmembrâ- retamente no ER e não é adequadamente glicosilada
nicas, dois domínios de ligação a ATP e um domínio ou transportada para a superfície celular. Em vez
regulatório que inclui vários sítios de fosforilação. disso, é devolvida ao citoplasma para ser degrada-
CFTR funciona como um canal de cloreto regulado da nos proteassomos. Uma abordagem terapêutica,
por AMP cíclico. Epitélios em CF caracterizam-se ainda não aplicada em pacientes, usa drogas que mi-
por transporte defeituoso de eletrólitos. Os órgãos metizam interações chaperones com CFTR mutante
mais afetados incluem pulmões, pâncreas e fígado, e ajudam-nas em seu dobramento e transporte para
e os efeitos que mais oferecem risco de vida envol- a membrana.

Fonte: Ward, C., Omura, S., e Kopito, R. Degradation of CFTR by the ubiquitin-proteasome pathway. Cell 83:121,
1995. Plemper, R. K. e Wolf, D. H. Retrograde protein translocation: Eradication of secretory proteins in health and di-
sease. Trends Biochem. Sci. 24:266, 1999. Egan, M. E., Pearson, M., Weiner, S. A., Rajendran, V., Rubin, D., Glockner-
Pagel, J., et al. Curcumin, a major constituent of turmeric, corrects cystic fibrosis defects. Science 304:600, 2004.

na nascente, a seqüência sinal hidrofóbica é inserida, e


tradução e extrusão no, ou através do, translocon estão
agora acopladas. Mesmo segmentos muito hidrofílicos ou
carregados são direcionados através da membrana para
o lúmen do ER. O peptídeo sinal é excisado pela pepti-
dase sinal, uma proteína integral de membrana da face
luminal do ER. A proteína pode dobrar, e componentes
de proteínas formadas por múltiplas subunidades podem
se organizar. Outras etapas podem incluir processamen-
to proteolítico e glicosilação, que ocorre no lúmen do ER
e durante trânsito da proteína pelo aparelho de Golgi e
em vesículas secretórias.

Glicosilação de Proteínas Ocorre


no Retículo Endoplasmático e no
Complexo de Golgi
Glicosilação de proteínas para formar glicoproteínas
(ver p. 231) é importante por muitas razões. Glicosila-
ção altera as propriedades de proteínas, modificando FIGURA 6.12
sua estabilidade, solubilidade e volume físico. Além Retículo endoplasmático rugoso.
disso, os resíduos de carboidratos atuam como sinais Três setas paralelas indicam três ribossomos dentre os muitos
ligados às membranas. Seta única indica uma mitocôndria,
de reconhecimento que podem dirigir a distribuição para comparação.
de proteínas e influenciar interações célula-célula e Cortesia de Dr. U. Jarlfors, University of Miami.

BioQ.06 219 22.01.07 16:44:09


CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO | 235
alça da seqüência líder 5’ do mRNA da ferritina (ver p. tico gera peptídeos não-funcionais como o peptídeo-C
807). Esse mRNA é seqüestrado para uso futuro. Ácido da pró-insulina. Em todos os casos, um “tratamento do
δ-aminolevulínico sintase, uma enzima da biossínte- lixo” é necessário. Proteólise reduz as proteínas a peptí-
se de heme, também é regulada por um 5’-IRE no seu deos e eventualmente a aminoácidos. A maioria desses
mRNA. Em contraste, mais mRNA do receptor de fer- aminoácidos é reciclada para sintetizar novas proteí-
ritina é necessário se ferro estiver limitado; seu mRNA nas, mas alguns são metabolizados e seus produtos de
tem IREs em sua região 3’ não-traduzida. Ligação da degradação são excretados. Proteases digestivas como
proteína repressora estabiliza o mRNA e prolonga sua pepsina, tripsina, quimotripsina e elastase hidrolisam
vida útil. Muitos mRNAs regulados por crescimento, in- proteínas da dieta e não participam do turnover (reci-
cluindo os de proteínas ribossômicas, têm um encade- clagem) intracelular de proteínas, mas os aminoácidos
amento de polipirimidinas em sua seqüência líder. Uma que geram contribuem para a reserva metabólica usa-
proteína que se liga a polipirimidinas ajuda a regular da na tradução. Isso é particularmente necessário para
sua tradução. aminoácidos essenciais (ver Tabela 19.1, p. 726).
Moléculas pequenas de RNA regulam biossínte-
se de proteínas em dois níveis. Micro-RNAs (miRNA) Proteólise Dependente de ATP
são RNAs de 21 a 23 nucleotídeos de comprimento que
são formados a partir de RNAs maiores dupla-fita ou Ocorre em Proteassomos
grampo por uma endonuclease citoplasmática chama- Uma via proteolítica bem descrita usa proteassomos,
da Dicer. Uma RNA helicase separa as fitas, uma das estruturas em forma de halteres que contêm cerca de
quais é ligada por um complexo silenciador induzi- 28 polipeptídeos (Figura 6.22). Um núcleo cilíndrico é
do por RNA (RISC) que guia o miRNA para seqüên- tampado em ambas as extremidades por complexos em
cias complementares no mRNA. Formação de um du- forma de V que ajudam a reconhecer e desdobrar po-
plex mRNA-miRNA imperfeito reprime tradução, mas lipeptídeos e transportá-los para o núcleo proteolítico
não afeta estabilidade do mRNA. Interação cooperativa em um mecanismo que depende de ATP. Direcionamen-
de múltiplos miRNAs com um mRNA aumenta eficiên- to para proteassomos normalmente requer ubiquitina,
cia de inibição. Dicer e RISC também geram duplexes uma proteína muito conservada de 76 aminoácidos.
perfeitamente complementares de moléculas pequenas Proteínas são marcadas para degradação por poliubi-
de RNA com mRNA. Esses complexos de RNA peque- quitinação, como mostrado na Figura 6.23.
no de interferência (siRNA) resultam em clivagem e Ubiquitina é ativada por enzima E1 para formar um
inativação do mRNA alvo por uma endonuclease RISC tioéster; ATP é necessário e um complexo transitório
chamada slicer. RNAs de silenciamento e interferência AMP-ubiquitina está envolvido. A ubiquitina é, então,
são importantes no desenvolvimento normal e no de- passada para enzima E2 e, finalmente, via um grupo
senvolvimento de câncer. de complexos multiprotéicos E3, para uma proteína
alvo. Ligação da ubiquitina ocorre por ligações iso-

|
6.8 DEGRADAÇÃO peptídicas entre ε-amino grupos de resíduos de lisina
da proteína e o resíduo de glicina carboxi-terminal da
E TURNOVER DE ubiquitina. Várias moléculas de ubiquitina são ligadas à
PROTEÍNAS proteína e uma à outra, e a proteína poliubiquitinada é
levada aos proteassomos e degradada; uma isopepti-
dase libera ubiquitina intacta para ser reutilizada.
Proteínas têm tempos de vida que variam muito. Célu- Proteínas danificadas, defeituosas, dobradas errone-
las do cristalino não são substituídas e suas proteínas amente ou mutadas são rapidamente degradadas pela
não são recicladas. Hemoglobina em eritrócitos dura o via da ubiquitina. Uma mutação na fibrose cística que
tempo de vida dessas células, cerca de 120 dias. Outras resulta em deleção de um aminoácido altera muito a es-
proteínas têm tempos de vida medidos em dias, horas tabilidade de CFTR (Corr. Clín. 6.6). Seleção de proteí-
ou até minutos. Algumas proteínas da coagulação do nas nativas para degradação depende da especificidade
sangue sobrevivem apenas alguns dias, de modo que he- da enzima E3; tanto conformação como seqüência de
mofílicos só estão protegidos por um curto período após aminoácidos são importantes. Seqüências desestabili-
transfusão ou injeção de fatores necessários. Diabéticos zadoras PEST (ricas em Pro, Glu, Ser e Thr) foram iden-
requerem injeções de insulina regularmente uma vez tificadas em várias proteínas de vida curta, e um motivo
que o hormônio é metabolizado. Enzimas metabólicas de interação com ubiquitina, que liga ubiquitina e às ve-
variam quantitativamente, dependendo de necessidade zes também promove poliubiquitinação, foi identificado.
ou mudança de situação; por exemplo, a concentração Outro determinante é a identidade do aminoácido ami-
de enzimas do ciclo da uréia muda em resposta à die- no-terminal. De acordo com a regra do N-terminal,
ta. Proteínas estão também sujeitas a danos por oxida- proteínas com resíduos amino-terminais diferentes são
ção, proteólise, desnaturação ou outras modificações degradadas a velocidades completamente diferentes, e
irreversíveis. Erros em tradução e dobramento levam o tempo de vida de uma proteína pode ser modificado
a proteínas não-funcionais, e processamento proteolí- pela incorporação de um resíduo N-terminal desestabi-

BioQ.06 235 22.01.07 16:44:26


CAPÍTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA | 241

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

7
Plasmídeo
Promotor
����Z
Restrição
ao sítio A

Restricção
ao sítio B

Gene
resistente à
antibióticos

DNA RECOMBINANTE E
BIOTECNOLOGIA
Gerald Soslau

7.1 VISÃO GERAL, 242 7.7 DETECÇÃO E IDENTIFICAÇÃO DE ÁCIDOS NU-


CLÉICOS E PROTEÍNAS QUE LIGAM DNA, 254
7.2 A REAÇÃO DE POLIMERASE EM CADEIA Ácidos nucléicos como sondas (probes) para
(POLYMERASE CHAIN REACTION), 243 seqüências específicas de DNA ou RNA, 254
Técnica de Southern blot para identificar frag-
7.3 ENDONUCLEASES DE RESTRIÇÃO E MAPAS DE mentos de DNA, 255
RESTRIÇÃO, 243 Polimorfismo de conformação de cadeia única,
Endonucleases de restrição hidrolisam seletiva- 256
mente DNA, 243 Detecção de mRNA, 258
Mapas de restrição permitem preparação rotinei- Detecção de proteínas que se ligam a seqüência
ra de segmentos definidos de DNA, 245 específica no DNA, 258

7.4 SEQÜENCIAMENTO DE DNA, 245 7.8 DNA COMPLEMENTAR E BIBLIOTECAS DE


Método de clivagem enzimática interrompida: DNA COMPLEMENTAR, 260
procedimento de Sanger, 246 mRNA como molde para síntese de DNA usando
transcriptase reversa, 260
mRNA desejado pode ser enriquecido por
7.5 DNA RECOMBINANTE E CLONAGEM, 248
técnicas de separação, 261
DNAs de diferentes fontes podem ser ligados
Síntese de DNA complementar, 261
para formar uma nova espécie de DNA: DNA
RNA celular total como molde para síntese de
recombinante, 248 DNA usando RT-PCR, 262
Vetores de DNA recombinante são produzidos por
clonagem, 249 7.9 BACTERIÓFAGOS, COSMÍDEO E VETORES DE
Clonagem direcional: DNA inserido em DNA vetor CLONAGEM EM LEVEDURA, 262
em uma direção específica, 249 Bacteriófagos como vetores de clonagem, 263
Bactérias transformadas com DNA recombinante Examinando (screening) bibliotecas de bacte-
e necessidade de um processo de seleção, 250 riófagos, 264
Moléculas de DNA recombinante em uma biblio- Clonando fragmentos de DNA em cosmídeos e
teca gênica, 250 vetores cromossomos artificiais, 264
PCR contorna a necessidade de clonar DNA, 251
7.10 ANÁLISE DE LONGAS SEQÜÊNCIAS DE DNA,
7.6 SELEÇÃO DE UM DNA ESPECÍFICO CLONADO 265
EM BIBLIOTECAS, 252 Subclonagem permite definição de grandes seg-
Seleção de bactéria transformada por perda de mentos de DNA, 265
resistência a antibiótico, 252 Caminhar nos cromossomos (chromosome
α-Complementação para selecionar bactérias que walking) define arranjo de genes em segmen-
carregam plasmídeos recombinantes, 254 tos longos de DNA, 265

BioQ.07 241 22.01.07 16:48:30


254 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

|
α-Complementação para Selecionar 7.7 DETECÇÃO E IDENTIFI-
Bactérias que Carregam Plasmídeos CAÇÃO DE ÁCIDOS NU-
Recombinantes CLÉICOS E PROTEÍNAS
Vetores foram construídos (a série pUC) de tal modo que
bactérias selecionadas transformadas com esses veto-
QUE LIGAM DNA
res carregando insertos de DNA estrangeiro, podem ser
identificadas visualmente (Figura 7.10). Os plasmídeos
pUC contêm as seqüências regulatórias e parte da seqü- Ácidos Nucléicos como Sondas
ência 5’-codificadora (146 aminoácidos N-terminais) do (Probes) para Seqüências Específicas
gene da β-galactosidase (gene lacZ) do operon lac (ver
p. 293). O fragmento traduzido N-terminal da β-galac- de DNA ou RNA
tosidase é um polipeptídeo inativo. E. coli mutante, que
codifica a porção carboxi-terminal inativa que falta da Sondas de DNA e RNA são usadas para seleção de bac-
β-galactosidase, pode ser transformada usando-se os térias que abrigam DNA recombinante de interesse,
plasmídeos pUC. A tradução das porções da β-galactosi- para análise de mRNA expresso em uma célula ou para
dase do plasmídeo e a da célula hospedeira em resposta identificação de seqüências de DNA em um genoma.
a um indutor, isopropil tio-β-d-galactosídeo, se com- Contêm seqüências complementares ao ácido nucléico
plementam mutuamente gerando uma enzima ativa. O alvo e hibridizam com o ácido nucléico de interesse. O
processo é chamado α-complementação. Quando es- grau de complementaridade determina a força de liga-
sas bactérias transformadas são crescidas em presença ção da sonda. A sonda não precisa conter a seqüência
de um substrato cromogênico (5-bromo-4-cloro-3-in- complementar inteira do DNA. A sonda pode ser marca-
dolil-β-D-galactosídeo [X-gal]) para a β-galactosidase, da, geralmente com 32P ou com marcas não-radioativas
formam colônias azuis. Se, entretanto, um fragmento que dependem de substratos de enzimas acoplados a
de DNA estrangeiro for inserido na seqüência da por- nucleotídeos que, quando incorporados ao ácido nuc-
ção N-terminal da β-galactosidase, a enzima ativa não léico, podem ser detectados por uma reação catalisada
pode ser formada. Bactérias transformadas com esses por enzima.
plasmídeos recombinantes e crescidas em X-gal dão co- Sondas marcadas podem ser produzidas por nick
lônias brancas e podem ser selecionadas visualmente,
translation (tradução com corte) do DNA dupla-fita.
das colônias azuis não transformadas.

Sítio de policlonagem N-terminal FIGURA 7.10


interrompido α-Complementação para detecção de
Seqüência bactérias transformadas.
codificadora DNA estranho Um vetor construído (pUC 18) expressa
ampr pUC 18 ampr pUC 18
N-terminal inserido a seqüência codificadora N-terminal
2686 bp do gene da 2686 bp
da enzima β-galactosidase do operon
�-galactosidase N-terminal lac. Bactérias mutantes que codificam
do operon-��� interrompido a região C-terminal da β-galactosidase
são transformadas com pUC 18. Essas
Promotor bactérias transformadas, crescidas em
Transformação presença de um substrato especial
para a enzima intacta (X-gal), resultam
Transformação em colônias azuis, porque contêm a
enzima para reagir com o substrato.
As seqüências codificadoras funcionais
Cromossomo
N-terminal e C-terminal do gene
complementam-se mutuamente,
Seqüência codificadora gerando uma enzima funcional. Se,
� N-terminal do gene da
� -galactosidase
pUC18
recombinante
entretanto, um fragmento de DNA
estrangeiro for inserido, interrompe a
do operon-��� seqüência codificadora N-terminal da
pUC18 A bactéria cresce em agar
contendo X-gal a um indutor β-galactosidase, bactérias transformadas
A bactéria cresce em agar do operon���� com essa molécula recombinante não
contendo X-gal a um indutor produzirão enzima funcional. Colônias
do operon���� de bactérias que contêm esses vetores
recombinantes podem ser detectadas
Colônias visualmente como colônias brancas.
brancas
contêm
pUC18
recombinante

Colônias azuis

Colônias azuis contêm pUC18


sem o DNA estrangeiro

BioQ.07 254 22.01.07 16:48:41


CAPÍTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA | 259

CORRELAÇÃO CLÍNICA 7.6


Polimorfismo de Conformação de Cadeia-Única para Detecção de
Mutações Espontâneas que Podem Levar a SIDS
A síndrome da morte súbita infantil (SIDS) é uma a síndrome do QT longo continha a substituição de
causa importante de morte durante o primeiro ano AAC para TCC na posição 2971 a 2972 (proteína as-
de vida nos Estados Unidos. Estudo prospectivo em sociada com o canal de sódio), por análise de poli-
mais de 34.000 recém-nascidos que foram monito- morfismo de conformação de cadeia-única (SSCP)
rados por eletrocardiografia indicou uma forte cor- na amostra de DNA da criança, mas não dos pais. A
relação entre risco aumentado de SIDS e intervalo mutação substituiu um resíduo de serina por uma
QT prolongado em seu ECG. Com base nesse estudo, asparagina em uma região muito conservada da
decidiu-se procurar uma mutação em um ou mais proteína, que se presume participe da função do ca-
dos genes que se sabe estarem relacionados com a nal de sódio. A mutação não foi detectada em 200
síndrome do QT longo em uma criança de 44 dias indivíduos controles. A conclusão foi que a criança
de idade, que se apresentou cianótica, apnéica e sem tinha uma mutação espontânea em um gene asso-
pulso ao pronto-socorro de um hospital. A arritmia ciado com intervalo QT prolongado e isso contribuiu
da criança com um intervalo QT prolongado foi esta- para um evento tipo SIDS. Após tratamento, a crian-
bilizada com múltiplos eletrochoques DC, seguidos ça ficou sem nenhum sintoma por volta dos cinco
de tratamento com drogas. DNA genômico foi pre- anos de idade. Esse estudo indica o valor potencial
parado a partir de linfócitos do sangue periférico do exame eletrocardiográfico neonatal para reduzir
da criança e de seus pais. Um gene associado com mortalidade infantil por SIDS.

Fonte: Schwartz, P. J., Priori, S. G., Dumaine, R. Napolitano, C., Antzelevitch, C., Stramba-Badiale, M., Richard, T.
A., Berji, M. R. e Bloise, R. A molecular link between the sudden infant death syndrome and the long-QT syndrome.
N. Engl. J. Med. 343:262, 2000.

(a) Solução de hidrização FIGURA 7.13


Ensaio de proteção de nuclease.
250 bases 300 bases mRNA celular total pode ser isolado
Sonda X Sonda Y
+ de diferentes tecidos. Sondas de DNA
fita-única que são complementares a
seqüências conhecidas de diferentes
mRNAX + mRNAY genes transcritos (mRNAx, mRNAy,
Outros RNAs
400 bases mRNAz) são hibridizadas com a
Sonda Z mistura de RNAs. Digestão com
+
uma ribonuclease hidrolisará
mRNAZ e sondas não as regiões de RNA fita-única de
hidridizadas mRNA não-hibridizado com a
sonda de DNA e todas as espécies
de RNA que não hibridizaram. Só
(b) Digestão com nuclease
os híbridos DNA-RNA protegidos
250 bp 300 bp 400 bp da nuclease permanecerão para
Híbrido X Híbrido Y Híbrido Z análise por eletroforese em gel de
+ + poliacrilamida. Expressão diferencial
de genes em diferentes tecidos é,
então, facilmente observada
(c ) Reações de amostras de RNA de diferentes tecidos analisadas por eletroforese em gel de poliacrilamida.
Coração

Cérebro
Pulmão
Padrão

Pele

400 bp

300 bp
250 bp

BioQ.07 259 22.01.07 16:48:46


272 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Gene ��� Z truncado FIGURA 7.25


RE Mutagênese sítio-dirigida de um
Sítio de único nucleotídeo e detecção do DNA
Gene clonado Gene clonado mutado.
policlonagem
Endonucleose e purificado A figura é uma visão geral
de restrição (RE) simplificada do método. Esse
processo envolve a inserção de um
fragmento de DNA amplificado
RE Elemento puro em um vetor bacteriófago
regulatório modificado, M13. E. coli susceptível,
PLASMÍDEO de ��� Z Vetor M13 transformada com o DNA
recombinante de M13, sintetiza
a fita (+) de DNA, acondicionada
Transformar nas proteínas do bacteriófago.
������ Os bacteriófagos são isolados do
Fita susceptível meio de cultura, e o DNA do M13
recombinante recombinante fita-única é purificado.
(–) do M13 Isolar DNA fita
O DNA do M13 recombinante serve
única de M13
de molde para replicação do DNA por
recombinante
DNA polimerase, desoxinucleosídeos
do meio M13 RECOMBINANTE
trifosfato (dNTPs), DNA ligase e
um primer especial. O primer de
Oligômero com DNA (oligômero com pareamento
um único nucleotídeo errado) é sintetizado de modo a ser
com pareamento errado DNA polimerase exatamente complementar a uma
quatro dNTPs, região do DNA (gene) de interesse,
DNA ligase exceto por uma base que se deseja
alterar (mutar). O DNA do M13
recém-sintetizado, portanto, contém
DNA ligado a filtro de nitrocelulose uma base especificamente mutada
com NaOH, hibridizado com sonda marcada que, quando reintroduzida em E. coli
5� para o oligômero com pareamento errado susceptível, será fielmente replicada.
A E. coli transformada é crescida
em placas de agar com réplicas das
3�
colônias resultantes sendo feitas em
filtro de nitrocelulose. DNA associado
com cada colônia é desnaturado
e fixado ao filtro com NaOH, e o
Transformar ������ DNA ligado ao filtro é hibridizado
Tocar a placa de agar
suscetível e plaquear com uma sonda oligômero de DNA
com filtro de
o bacteriófago resultante marcada com 32P, com pareamento
nitrocelulose
contendo M13 tipo errado. Os mutantes putativos são,
selvagem mais Mutante então, identificados por exposição do
DNA mutado putativo filtro a filme de raio X.
sobre o tapete
de ������
crescida em agar
Auto-radiografia

|
fita de M13 é transformado em uma E. coli tipo-selva-
gem, a fita contendo uracil é destruída e a fita mutada
7.14 APLICAÇÕES DA
(–)serve de molde para a progênese dos bacteriófagos, a TECNOLOGIA DO DNA
maioria dos quais carregando a mutação de interesse.
O PCR também pode ser empregado para mutagêne-
RECOMBINANTE
se sítio-dirigida. Estratégias foram desenvolvidas para
incorporar uma base com pareamento errado em um
Métodos de DNA recombinante são aplicáveis a nume-
dos oligonucleotídeos que servem de primer para o
rosas disciplinas biológicas incluindo agricultura, estu-
PCR. Alguns desses procedimentos empregam bacte-
dos de evolução, biologia forense e clínica médica. En-
riófago M13 e seguem os princípios descritos na Figura
genharia genética pode introduzir proteínas novas ou
7.26. Uma variação desses métodos de PCR, mutagêne-
alteradas em grãos (p. ex., milho), de modo que eles
se por PCR inverso, foi aplicada a pequenos plasmíde-
contenham aminoácidos essenciais para o homem mas
os recombinantes (4-5 kb) (Figura 7.25).
freqüentemente ausentes de proteínas vegetais. Toxi-
O método é muito rápido, com 50-100% das colônias
nas letais a insetos específicos, mas inócuas ao homem,
geradas contendo a seqüência mutante. Os dois pri-
podem ser introduzidas em grãos para protegerem as
mers são sintetizados de modo que pareiem final-com-
plantas, evitando assim o uso de pesticidas que agridem
final com um primer contendo a base errada.
o meio ambiente. O DNA isolado de células do líquido
amniótico de uma mulher grávida pode ser analisado
quanto a defeitos genéticos no feto. Quantidades mi-

BioQ.07 272 22.01.07 16:49:01


CAPÍTULO 8 REGULAÇÃO DA EXPRESSÃO GÊNICA | 287

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

8
REGULAÇÃO DA
EXPRESSÃO GÊNICA
Daniel L. Weeks e John E. Donelson

8.1 VISÃO GERAL, 288 8.7 EXPRESSÃO GÊNICA EM EUCARIOTOS, 300


DNA eucariótico é ligado a histonas para formar
8.2 UNIDADE DE TRANSCRIÇÃO EM BACTÉRIAS: O cromatina, 301
OPERON, 288 Metilação do DNA correlaciona-se com inativação
de genes, 302
8.3 OPERON LACTOSE DE E. COLI, 288
Repressor do operon lactose é uma proteína difu- 8.8 COMPLEXO DE PRÉ-INICIAÇÃO EM EUCARIO-
sível, 290 TOS: FATORES DE TRANSCRIÇÃO, RNA POLI-
Seqüência operador do operon lactose é contígua MERASE II E DNA, 303
a um promotor e três genes estruturais, 291 Promotores eucarióticos e outras seqüências que
RNA polimerase e uma proteína reguladora reco- influenciam transcrição, 305
nhecem seqüência do promotor do operon lac- Projeto modular de fatores de transcrição euca-
tose, 292 rióticos, 305
Proteína ativadora de catabólito liga promotor Motivos comuns em proteínas que ligam DNA e
lactose, 292 regulam transcrição, 306

8.4 OPERON TRIPTOFANO DE E. COLI, 293 8.9 REGULAÇÃO DA EXPRESSÃO GÊNICA EUCA-
Operon triptofano é controlado por uma proteína RIÓTICA, 308
repressora, 293 Regulando os reguladores, 309
Região atenuadora do operon triptofano, 295 Ativação da transcrição do gene do receptor de
Atenuação da transcrição controla outros ope- LDL ilustra muitas características encontra-
rons de biossíntese de aminoácidos, 296 das na regulação gênica eucariótica, 309

8.5 OUTROS OPERONS BACTERIANOS, 297 BIBLIOGRAFIA, 312


Síntese de proteínas ribossômicas é regulada de
modo coordenado, 297 QUESTÕES E RESPOSTAS, 312
Resposta estringente controla síntese de rRNAs e
tRNAs, 297 CORRELAÇÕES CLÍNICAS
8.1 Resistência Transmissível a Múltiplas Drogas,
8.6 TRANSPOSONS BACTERIANOS, 299 300
Transposons são segmentos móveis do DNA, 299 8.2 Síndrome de Rubstein-Taybi, 302
Transposons TN3 contêm três genes estruturais, 8.3 Tamoxifeno e Receptor de Estrógeno como
299 Alvo, 309
8.4 Fatores de Transcrição e Doença Cardiovas-
cular, 310

BioQ.08 287 22.01.07 16:52:32


CAPÍTULO 8 REGULAÇÃO DA EXPRESSÃO GÊNICA | 297
influencie a formação de alças em grampo alternativas,
uma das quais lembrando um grampo de terminação Operon Proteína Proteínas especificadas pelo operon
regulatória
seguido de vários resíduos U. Ao contrário do operon
trp, transcrição do operon his é regulada primariamen- ��� S8 L14-L24-L5-S14-S8-L6-L18-S5-L15-L30
te por atenuação, uma vez que não possui um operador
reconhecido por uma proteína repressora. Em vez dis- ��� L4 S10-L3-L2-L4-L23-S19-L22-S3-S17-L16-L29
so, o ribossomo age como uma proteína reguladora po- S12-S7-EF•G-EF•Tu
��� S7
sitiva, semelhante ao complexo cAMP-CAP no operon
lac. Se o ribossomo estiver ligado (i.é., parado) no sítio � S4 S13-S11-S4-�-L17
atenuador, transcrição dos genes estruturais a seguir ��� L1 L11-L1
estará aumentada. Se o ribossomo não estiver ligado,
transcrição desses genes estará muito reduzida. ��� L10 L10-L7-����
Transcrição de alguns operons, mostrados na Figu-
FIGURA 8.12
ra 8.11, pode ser atenuada por mais de um aminoácido. Operons contendo genes de proteínas ribossômicas de E. coli.
Por exemplo, o operon thr é atenuado por treonina ou Genes dos componentes protéicos das subunidades ribossômicas
isoleucina, enquanto o operon ilv é atenuado por leuci- pequena (S) e grande (L) de E. coli ficam agrupados em vários
operons. Alguns desses operons também contêm genes das
na, valina ou isoleucina. Esse efeito pode ser explica- subunidades α, β e β‘ da RNA polimerase e fatores de síntese
do em todos os casos por pausa do ribossomo no códon protéica EF-G e EF-Tu. Pelo menos um dos produtos protéicos de
correspondente, o que interfere com formação de um cada operon geralmente regula expressão desse operon
(ver texto).
grampo de terminação. É possível que em seqüências
líderes mais longas, a pausa em mais de um códon seja
necessária para atingir máxima transcrição pela região
as subunidades ribossômicas e um gene da subunidade
de atenuação.
α da RNA polimerase. O operon rif tem os genes das
subunidades β e β’ da RNA polimerase e de proteínas

|
8.5 OUTROS OPERONS
BACTERIANOS
ribossômicas.
Uma característica comum aos seis operons de pro-
teínas ribossômicas é que sua expressão é regulada por
um dos produtos de seus próprios genes estruturais;
isto é, são auto-regulados. Em alguns casos, regu-
Síntese de Proteínas Ribossômicas É lação ocorre em nível de tradução, não de transcrição
Regulada de Modo Coordenado como discutido para operons lac e trp. Depois que o
mRNA policistrônico é feito, a proteína ribossômica “re-
Muitos operons bacterianos possuem os mesmos meca- gulatória” liga-se a esse mRNA e determina que região,
nismos regulatórios gerais dos operons lac, trp e his. se alguma, será traduzida. Em geral, a proteína ribos-
Entretanto, cada operon tem suas próprias característi- sômica que regula expressão de seu próprio operon as-
cas distintas. Um exemplo é dado pelos genes estrutu- socia-se com RNA ribossômico (rRNAs) no ribossomo.
rais das 70 ou mais proteínas que compõem os ribosso- Essa proteína tem uma alta afinidade por rRNA e uma
mos (Figura 8.12). Cada ribossomo contém uma cópia afinidade menor por uma ou mais regiões de seu próprio
de cada proteína ribossômica (exceto proteínas L7- mRNA. Portanto, competição ocorre entre rRNA e o
L12, que provavelmente estão presentes em quatro có- operon do mRNA pela ligação com a proteína. À medida
pias). Portanto, todas as 70 proteínas são necessárias que a proteína se acumula, alcançando um nível mais
em quantidades equimolares, e faz sentido que sua sín- alto que o de rRNA livre, liga-se a seu próprio mRNA e
tese seja regulada de modo coordenado. Seis operons impede síntese protéica em uma ou mais das seqüên-
diferentes, contendo cerca de metade dos genes de pro- cias codificadoras desse mRNA (Figura 8.13). Quando
teínas ribossômicas, ocorrem em dois grupos principais mais ribossomos são formados, o excesso dessa proteí-
de genes. Um grupo contém quatro operons adjacentes na ribossômica é usado e tradução de seu mRNA pode
(Spc, S10, str e a) e o outro grupo tem dois operons recomeçar.
(L11 e rif) localizados em outro ponto do cromossomo
de E. coli. Não há nenhum padrão óbvio de distribuição
dos genes entre esses operons. Alguns operons codifi- Resposta Estringente Controla
cam proteínas de uma subunidade ribossômica; outros Síntese de rRNAs e tRNAs
codificam proteínas de ambas as subunidades. Esses
operons também contêm genes de outras proteínas (re- Bactérias respondem de várias maneiras a extremo es-
lacionadas). tresse geral. Uma dessas situações é quando há amino-
Por exemplo, o operon str contém genes de fatores ácidos insuficientes para manter síntese protéica. Nessas
de elongação de tradução solúveis, EF-Tu e EF-G, e ge- condições, a célula invoca a resposta estringente, que
nes de algumas proteínas da subunidade ribossômica reduz síntese de rRNAs e tRNAs cerca de 20 vezes. Sín-
30S. O operon a contém genes de proteínas de ambas tese de mRNAs também diminui cerca de três vezes.

BioQ.08 297 22.01.07 16:52:44


300 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

CORRELAÇÃO CLÍNICA 8.1


Resistência Transmissível a
|
8.7 EXPRESSÃO GÊNICA EM
EUCARIOTOS
Múltiplas Drogas
Transcrição de genes em organismos eucarióticos é
Uma tendência alarmante é que bactérias pato- também regulada para dar a resposta adequada a ne-
gênicas estão ficando cada vez mais resistentes a cessidades biológicas. Além de modular a expressão de
um grande número de antibióticos. Muitos casos genes em resposta a condições nutricionais ou ambien-
foram documentados, nos quais uma cepa bacte- tais, organismos multicelulares regulam a expressão
riana em um paciente que vinha sendo tratado de genes especializados que direcionam diferenciação
com um antibiótico, subitamente torna-se resis- celular e caracterizam tipos celulares específicos. Al-
tente a esse antibiótico e, simultaneamente, a guns genes (chamados genes zeladores ou housekee-
vários outros antibióticos, embora essa cepa bac- ping) são expressos na maioria das células, outros são
teriana nunca tenha sido exposta antes a esses ativados sob demanda e outros, ainda, ficam perma-
outros antibióticos. Isso ocorre quando a bactéria nentemente inativos em todos, exceto alguns poucos
subitamente adquire, de outra cepa bacteriana, tipos de células. Em células eucarióticas, a membrana
um plasmídeo que contém vários transposons nuclear serve de barreira que permite seletivamente o
diferentes, cada um contendo um ou mais genes acesso de algumas proteínas ao DNA, enquanto man-
de resistência a antibióticos. Exemplos incluem: tém outras no citosol. Em bactérias, uma RNA polime-
os genes que codificam β-lactamase, que inativa rase é responsável pela transcrição de todos os RNAs
penicilina e cefalosporinas; a cloranfenicol ace- (tRNA, rRNA e mRNA). Em organismos eucarióticos,
tiltransferase, que inativa cloranfenicol; e fosfo- três RNA polimerases diferentes são usadas (ver p.
transferases, que modificam aminoglicosídeos, 181). RNA polimerase I transcreve os genes de rRNA,
como neomicina e gentamicina. RNA polimerase II transcreve os genes que codificam
proteínas, cujos transcritos se tornam mRNAs, e RNA
polimerase III transcreve os genes de tRNAs e a maio-
Fonte: Neu, H. C. The crisis in antibiotic resistance. ria dos outros RNAs pequenos. Embora alguns princí-
Science 257:1064, 1992 pios de ativação gênica e controle eucarióticos se apli-
quem a todas as três RNA polimerases, nesta seção o
foco será transcrição por RNA polimerase II. RNA po-
transcritos de modo divergente a partir de uma região limerase II é composta por pelo menos 10 subunidades
de controle de 163 pb, localizada entre eles, que liga o diferentes, com tamanhos entre 10 e 220 kDa. Algu-
repressor. O repressor também participa da inserção do mas das subunidades são também parte dos comple-
novo transposon, mas não afeta transcrição do gene de xos das RNA polimerases I e III, enquanto outras são
resistência à ampicilina. exclusivas da RNA polimerase II. A subunidade maior
Mutações em tnpA que inativam a transposase di- da RNA polimerase II tem, dependendo da espécie,
minuem a freqüência de transposição de Tn3. Muta- até 52 repetições da seqüência de aminoácidos PTSP-
ções em tnpR que inativam o repressor aumentam a SYS em sua região C-terminal (CTD, C-terminal do-
freqüência de transposição. Essas mutações desrepri- main). Uma característica própria dessas repetições é
mem tnpA, resultando em mais moléculas de transposa- que treonina (T), serina (S) e tirosina (Y) podem ser
se; isso aumenta a formação de mais cópias duplicadas fosforiladas.
do transposon. Também desreprime tnpR, mas como o Para entender melhor a regulação da transcrição em
repressor é inativo, isso não tem efeito. eucariotos, é útil relembrar a organização do DNA em
Transposons localizados em plasmídeos bacterianos cromatina e o papel de modificação no DNA, especial-
são de importância crescente em uso clínico de antibi- mente metilação de citosina, sobre ativação gênica.
óticos. Plasmídeos bacterianos que não foram alterados Além disso, vamos considerar como RNA polimerase
para uso experimental geralmente contêm genes que II é posicionada no ponto correto do promotor de um
facilitam sua transferência de uma bactéria para outra. gene para transcrever esse gene pela formação de um
Quando esses plasmídeos se transferem entre diferen- complexo de pré-iniciação, que envolve organização de
tes cepas bacterianas infecciosas, seus transposons fatores de transcrição gerais (TFs) com RNA poli-
contendo genes de resistência a antibióticos são merase II. A seguir, vamos ver como atividade de genes
transportados para as novas cepas bacterianas. Uma específicos pode ser regulada pelo uso de enhancers,
vez dentro de uma nova bactéria, o transposon pode se sítios de ligação de fatores de transcrição e sítios
duplicar no cromossomo e ficar permanentemente es- de organização de RNA polimerase. Finalmente,
tabelecido naquela linhagem celular. O resultado é que vamos discutir a ativação da transcrição por fatores de
mais e mais cepas de bactérias patogênicas tornaram- transcrição específicos, algumas de suas característi-
se resistentes a um número crescente de antibióticos. cas gerais e como são regulados.

BioQ.08 300 22.01.07 16:52:47


308 | PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

|
Proteínas bZIP têm um domínio de ligação ao DNA
composto por uma região básica, definida pela presença
8.9 REGULAÇÃO DA
de arginina e lisina, localizada a sete aminoácidos antes EXPRESSÃO GÊNICA
da primeira leucina e α-hélice. Os aminoácidos básicos
estabilizam a associação DNA-proteína por interações
EUCARIÓTICA
eletrostáticas com o esqueleto carregado negativamen-
te do DNA, além de formar pontes de hidrogênio na fen-
Como indicado acima, uma região relativamente pe-
da maior. Sítios de ligação de homodímeros têm sime-
quena de uma proteína regulatória pode ser dedicada à
tria díade, enquanto essa simetria não é encontrada em
ligação seqüência-específica ao DNA, enquanto outros
sítios de ligação de heterodímeros.
domínios estão envolvidos em interações proteína-pro-
A classe hélice-alça-hélice de fatores de transcrição
teína ou ligante. Vários domínios de ativação caracte-
inclui myoD, myc e max. Dois segmentos de α-hélice
rísticos foram identificados, incluindo domínios ácidos
anfipática separados por uma alça interveniente carac-
(alta concentração de aminoácidos com cadeias laterais
terizam proteínas hélice-alça-hélice.
ácidas), domínios ricos em glutamina, e domínios ricos
As hélices não são responsáveis por ligação com
em prolina. Experimentalmente, superprodução de
DNA, como nas proteínas dedos de zinco, mas por di-
qualquer desses domínios por técnicas de recombina-
merização com outra proteína. Como foi descrito para
ção, mesmo sem seus domínios de ligação ao DNA cor-
as proteínas bZIP, os dímeros formados podem ser homo
respondentes, pode levar à ativação errônea de trans-
ou heterodímeros. O domínio de ligação ao DNA é uma
crição de uma variedade de genes. Eles parecem ativar
extensão de uma das α-hélices que formam o feixe de
transcrição por meio do aumento da taxa de montagem
quatro-hélices gerado por dimerização (Figura 8.27).
do complexo de pré-iniciação. Alguns interagem dire-
tamente com TFIID, aumentando ligação ao TATA box,
enquanto outros interagem com TFIIB ou TAFs que são
parte do complexo TFIID. Quando múltiplos fatores de
transcrição se ligam a um promotor, eles podem ter um
efeito combinatório sobre a ligação e a montagem do
complexo de pré-iniciação. Domínios de ativação de
muitos fatores de transcrição têm como alvos as mes-
mas proteínas no complexo de pré-iniciação.

��� FIGURA 8.27


Formação do fator de transcrição dimérico é
mediada por interações hélice-alça-hélice.
O motivo hélice-alça-hélice aproxima dois
monômeros para formar um dímero que se liga
ao DNA. (a) Cada monômero tem duas hélices
unidas por uma alça. Uma hélice é usada para
interação proteína-proteína, enquanto a outra
é usada para ligar a fenda maior do DNA. Assim,
o dímero consiste de um feixe de quatro hélices
Se o dímero for formado por dois monômeros
idênticos, então se espera que os sítios de
ligação no DNA sejam muito semelhantes ou
idênticos; entretanto, se os monômeros forem
proteínas diferentes (formando heterodímeros),
então os sítios de ligação no DNA podem
ser não-relacionados. (b) Quando fatores de
transcrição ligam-se como dímeros, a presença
de um monômero truncado pode impedir
ligação ao DNA, mesmo em presença de
��� Homodímero HLS ativo Heterodímero HLS inativo monômeros completos. Por exemplo, se a hélice
de dimerização da proteína for feita sem o
domínio de ligação ao DNA, a dimerização com
um monômero completo produz um produto
incapaz de se ligar eficientemente ao DNA.
Modificado de Alberts, B., Bray, D., Lewis, J.,
Raff, M., Roberts, K. e Watson, J. Molecular
Biology of the Cell. New York: Garland, 1994.

DNA

BioQ.08 308 22.01.07 16:53:21


CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO | 315

PARTE 3 FUNÇÕES DE PROTEÍNAS

9
Fab 1 Fab 2

Sítio de ligação
Sítio de ligação
do anticorpo (Ag)
do anticorpo (Ag)

SS

Tuftsina C1q

CHO
Prot–A Prot–A

Fc

PROTEÍNAS II: RELAÇÕES


ESTRUTURA-FUNÇÃO EM
FAMÍLIAS DE PROTEÍNAS
Richard M. Schultz

9.1 VISÃO GERAL, 316 Estruturas terciárias da família serino proteases


são semelhantes, 332
9.2 MOLÉCULAS DE ANTICORPOS: SUPERFAMÍLIA
DE PROTEÍNAS IMUNOGLOBULINAS, 316 9.4 HEMOGLOBINA E MIOGLOBINA, 334
Moléculas de anticorpos contêm quatro cadeias Hemoglobina humana ocorre em várias formas,
polipeptídicas, 317 334
Regiões de seqüências constantes e variáveis Mioglobina: uma cadeia polipeptídica única com
da estrutura primária, 318 um sítio de ligação para O2, 334
Imunoglobulinas de uma classe contêm regiões Grupo prostético heme é sítio de ligação de O2,
de seqüências homólogas comuns, 318 334
Seqüências repetitivas geram dobras homólo- Cristalografia de raios-X definiu a estrutura de
gas tridimensionais em um anticorpo, 318 hemoglobina e mioglobina, 336
Há dois sítios de ligação de antígeno por molécula Estruturas primária, secundária e terciária de
de anticorpo, 322 mioglobina e cadeias de hemoglobina, 336
Genética das imunoglobulinas, 323 Um equilíbrio simples define ligação de O2 à mio-
Dobra de imunoglobulina é encontrada em uma globina, 337
grande família de proteínas com diferentes Ligação de O2 à hemoglobina envolve cooperativi-
papéis funcionais, 323 dade entre subunidades, 339
Mecanismo molecular de cooperatividade na
9.3 PROTEÍNAS COM UM MECANISMO CATALÍTI- ligação de O2, 340
CO COMUM: SERINO PROTEASES, 324 Hemoglobina facilita transporte de CO2 e NO, 342
Enzimas proteolíticas são classificadas por seu Diminuição em pKa de grupos ácidos com mudan-
mecanismo catalítico, 324 ça de conformação T para R leva à dissociação
Serino proteases apresentam notável especifi- de prótons, 343
cidade em hidrólise de ligações peptídicas, Transporte de CO2 e O2 é ligado por prótons
325 de efeito Bohr, 344
Serino proteases são sintetizadas como zimogê- 2,3-Bisfosfoglicerato (BPG) em eritrócitos
nios, 329 modula liberação de oxigênio de hemoglo-
Inibidores protéicos específicos para serino pro- bina, 345
teases, 330 Hemoglobina entrega óxido nítrico (NO) para a
Serino proteases têm relações estrutura-função parede capilar de tecidos onde promove
semelhantes, 330 liberação de O2, 345
Homologia de seqüência em serino proteases, 331

BioQ.09 315 22.01.07 16:59:32


324 | PARTE 3 FUNÇÕES DE PROTEÍNAS

FIGURA 9.9
Seqüência de aminoácidos das regiões constantes de
cadeias pesadas de genes de cadeia pesada de IgG 1,
2 e 4.
Seqüências de CH1, região de articulação H (hinge),
regiões CH2 e CH3 são apresentadas. Seqüência de γ1
está completa, e diferenças em γ2 e γ4 em comparação
com seqüência γ1 são mostradas usando abreviações de
uma letra dos aminoácidos. Linha tracejada (—) indica
ausência de aminoácido na posição correspondente em
γ1, com a finalidade de melhor alinhar as seqüências
para mostrar a homologia máxima.
Seqüência de cadeia γ1 de Ellison, J. W., Berson, B. J. e
Hood, L. E. Nucleic Acid Res. 10:4071, 1982. Seqüências
dos genes γ2 e γ4 de Ellison, J. e Hood, L. Proc. Natl.
Acad. Sci. USA 79:1984, 1984.

|
9.3 PROTEÍNAS COM UM Enzimas Proteolíticas São
MECANISMO CATALÍ- Classificadas por seu Mecanismo
TICO COMUM: SERINO Catalítico
PROTEASES Enzimas proteolíticas são classificadas de acordo com
seu mecanismo catalítico. Além das serino proteases,
outras classes utilizam cisteína (cisteíno proteases),
Serino proteases são uma família de enzimas que aspartato (aspartato proteases) ou íons metálicos
usam um resíduo de serina ativado de modo singular no (metalo proteases) para realizar sua função catalí-
sítio de ligação ao substrato, para hidrolisar catalitica- tica. As que hidrolisam ligações peptídicas no interior
mente ligações peptídicas. Essa serina pode ser carac- de um polipeptídeo são endopeptidases, e aquelas que
terizada pela reação irreversível de seu grupo hidroxila quebram a ligação peptídica de aminoácidos COOH- ou
de cadeia lateral com diisopropilfluorofosfato (DFP) NH2-terminais são exopeptidases.
(Figura 9.11). De todas as serinas da proteína, DFP re- Serino proteases freqüentemente ativam outras se-
age só com a serina cataliticamente ativa, formando um rino proteases a partir de sua forma precursora inativa,
éster de fosfato. denominada um zimogênio, por clivagem de uma liga-
ção peptídica específica. Esse mecanismo de ativação

BioQ.09 324 22.01.07 16:59:43


CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO | 335

CORRELAÇÃO CLÍNICA 9.6


Hemoglobinopatias
Há mais de 800 hemoglobinas humanas mutantes afinidade aumentada por oxigênio são freqüen-
diferentes. Mutações causam instabilidade na es- temente caracterizadas por anemia hemolítica e
trutura da hemoglobina, afinidade aumentada ou formação de corpos de Heinz.
diminuída por oxigênio, ou um aumento na taxa de Hemoglobinas mutantes que formam meta-
oxidação do ferro ferroso do heme (Fe2+) para o es- hemoglobina incluem HbM Iwateα87His→Tyr e
tado férrico (Fe3+). Uma hemoglobina férrica, não- HbM HydeParkβ92His→Tyr, onde as histidinas pro-
funcional, é chamada meta-hemoglobina e é simbo- ximais F8 das cadeias α e β, respectivamen-
lizada por HbM. te, estão mutadas. Na HbM Bostonα58His→Tyr e na
Hemoglobinas instáveis surgem por substituição HbMSaskatoonβ63His→Tyr, as histidinas distais E7
de prolina por um aminoácido em uma região de α- estão mutadas. Mutações de aminoácidos que fi-
hélice da dobra de globina. Prolinas não participam cam junto do heme ou formam o sítio de ligação
da estrutura em α-hélice e a quebra de um segmento com oxigênio freqüentemente levam a meta-he-
de α-hélice gera uma hemoglobina instável (exem- moglobina. Pacientes com altas concentrações
plos são HbSakiβ14Leu→Pro e HbGenova β28Leu→Pro). Ou- de meta-hemoglobina apresentam cianose (cor
tras hemoglobinas instáveis surgem por substituição azulada na pele).
por um aminoácido que é muito grande ou muito Duas das mutações mais prevalentes ocor-
pequeno para estabelecer contatos corretos, ou por rem no aminoácido da mesma posição, o β6Glu.
colocação de um grupo carregado ou polar no lado Quando esse glutamato é substituído por valina,
de dentro de um domínio. Hemoglobinas instáveis o resultado é HbS β6Glu→Val; enquanto substitui-
desnaturam facilmente e precipitam, formando cor- ção por lisina gera HbCβ6Glu→Lys. Homozigotos
pos de Heinz, que danificam a membrana do eritró- com HbS expressam anemia falciforme, na qual
cito. Pacientes com hemoglobinas instáveis podem as moléculas de hemoglobina precipitam como
desenvolver anemia, reticulocitose, esplenomegalia tactóides ou longas cadeias, o que produz a for-
e urobilinúria. ma de foice dos eritrócitos (ver Corr. Clín. 3.3).
Algumas hemoglobinas mutantes têm afinida- HbC forma uma estrutura diferente de agregado
de aumentada por oxigênio (P50 mais baixa). Um consistindo de cristalóides de extremidades ce-
exemplo interessante é HbCowtown β246His→Leu, na qual gas. Isso reduz o tempo de vida dos eritrócitos,
a histidina, que dissocia 50% dos prótons do efeito mas causa menos hemólise que HbS. Esta forma
Bohr, é perdida. Essa mutação impede a regulação de hemoglobinopatia apresenta efeitos patológi-
da dissociação de oxigênio por concentração de íons cos mais limitados. Como ambas HbS e HbC são
hidrogênio e desestabiliza a conformação T, em re- comumente encontradas em certas populações
lação à conformação R, causando um aumento na negras da África, não é raro encontrar indivídu-
afinidade por oxigênio e liberação diminuída de O2 os heterozigotos para ambos os genes mutantes
para os tecidos. Mutações em hemoglobina que in- nessas populações. Indivíduos com HbSC terão
terferem com ligação de DPG também aumentam uma anemia intermediária entre as observadas
afinidade por oxigênio. Hemoglobinopatias com para homozigotos de HbS e HbC.

Fonte: Dickerson, R. E. e Geis, I. Hemoglobin: Structure, Function, Evolution, and Pathology. Menlo Park, CA:
Benjamin-Cummings, 1983. Arcasoy, M. O. e Gallagher, P. G. Molecular diagnosis of hemoglobinopathies and other red
blood cell disorders. Semin. Hematol. 36:328, 1999.

Quatro ligações são com os átomos de nitrogênio pirró- é designada como histidina proximal nas estruturas
lico da porfirina. Como os anéis pirrólicos e os carbonos de hemoglobina e mioglobina (Figuras 9.20 e 9.21). O2
de ligação fazem parte do mesmo sistema aromático, forma a sexta ligação; o O2 é colocado entre o átomo
esses átomos ficam em um plano comum. O ferro ligado ferroso e um segundo imidazol de histidina, designada
à porfirina tenderá a ficar no mesmo plano da porfiri- como histidina distal. Na desoxi-hemoglobina, a sex-
na. A quinta e a potencial sexta ligações com ferro são ta posição está desocupada.
direcionadas ao longo de um eixo perpendicular ao pla- O heme é posicionado dentro de um bolsão hidrofó-
no do anel porfirínico (Figura 9.20). A quinta ligação é bico de cada subunidade globina, com aproximadamen-
com um nitrogênio do imidazol de uma histidina. Esta te 80 interações fornecidas por cerca de 18 resíduos,

BioQ.09 335 22.01.07 16:59:57


CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO | 347
VEIA ARTÉRIA de divisão celular, morte (apoptose), diferenciação e
O2
HS SH 2 O HS SH O
2 2
migração. Todas as células produzem constituintes de
1
  CO2   membrana basal, e cada membrana basal tem caracte-
  CO2   rísticas do tipo celular, a partir do qual é sintetizada.
T O2 R O2 Uma membrana basal sublinha camadas de células epi-
teliais e endoteliais, e circunda outros tipos de células
5 ON HS SH ONS SH O
6 O2 2
(Figura 9.39). Uma membrana basal separa duas cama-
    das de células no glomérulo renal, onde funciona como
 
X-SNO
  um filtro seletivo.
O2 T O2 R O2 Uma lâmina basal é formada por associações não-
covalentes entre sítios específicos localizados em domí-
nios de ligação das proteínas associadas. Muitas prote-
X-SNO ínas de membrana basal também se ligam a células por
CO2 meio de domínios de ligação a células nas proteínas e
8 ON HS SH 7 HS SH receptores celulares na membrana celular externa. A
    estrutura de muitas das proteínas é composta de uni-
  CO2  
dades modulares com homologia de seqüência e de do-
T 4 O2 T bras com superdobras comuns, como as dobras de imu-
noglobulinas (Ig) e de fator de crescimento epidérmico
4 HS SH 3 O2 HS SH O2 (EGF). Essas dobras são encontradas repetitivamente
  NO   e são os blocos construtores de proteínas de matriz
    extracelular. Enquanto módulos EGF nessas proteínas
NO T NO R O2 não parecem ter função de fator de crescimento, prote-
3 O2 1 O2 ínas fatores de crescimento e citocinas são encontradas
CAPILAR ARTERÍOLA na lâmina basal, particularmente em associação com
as partes carboidrato dos proteoglicanos componentes.
FIGURA 9.37
Ligação e liberação de NO por hemoglobina durante o ciclo Durante a reciclagem (turnover) da membrana basal
respiratório. induzida por proteases e heparanases, esses fatores de
O modelo mostra a ligação e a dissociação de NO, O2 e crescimento e citosinas são liberados para agirem sobre
CO2 enquanto uma molécula de hemoglobina faz dois
ciclos completos na circulação. O primeiro ciclo envolve células vizinhas. Além disso, muitas proteínas de lâmi-
intermediários 1-4, e o segundo ciclo, intermediários 5-8. na basal escondem atividades crípticas que são ativadas
As conformações T e R são mostradas e os grupos SH são da quando clivadas e removidas da seqüência completa
cadeia lateral de βCys93. O NO é ligado diretamente a um
ferro-heme ou ao SH da βCys93. As etapas-chaves no transporte por ação de proteases (ver endostatina, p. 1021). O pró-
de NO são (i) sua ligação inicial a um heme no intermediário protease plasminogênio está ubiquamente presente na
3 e transferência do heme de uma subunidade β para βCys93 matriz extracelular e é ativado por secreção celular de
no intermediário 6 (conformação R) e (ii) sua transferência
para uma molécula tiol pequena X-SH no intermediário 7 ativadores de plasminogênio (ver p. 979).
(conformação T), quando hemoglobina é convertida de R para
T. A molécula de hemoglobina representada pode ser apenas
1 em 1.000 moléculas de hemoglobina circulantes, devido à
Composição Protéica da Lâmina
relativamente baixa concentração molar de NO no sangue. Basal
Redesenhado de Gross, S. S. e Lane, P. Proc. Natl. Acad. Sci.
USA 96:9967, 1999. A lâmina basal é composta de colágeno tipo IV, lami-
nina, nidogem (também chamado entactina) e perle-

|
9.5 O COMPLEXO PROTÉICO cam, o proteoglicano de heparam sulfato. Além disso,
pequenas quantidades de talvez 50 outras proteínas po-
DA LÂMINA BASAL dem estar presentes, incluindo osteopontina (também
chamada BM-40 ou SPARC), fibulina, colágeno tipo XV,
colágeno tipo XVIII e o proteoglicano agrim. A diversi-
Uma lâmina basal é um complexo muito estruturado dade e a tecido-especificidade de uma membrana basal
de proteínas de matriz extracelular observado inicial- é determinada pelas isoformas de colágeno tipo IV e la-
mente ao microscópio como uma região amorfa densa- minina e os tipos de proteínas minoritárias presentes.
mente empacotada de cerca de 50 a 100 nm de espes- Isoformas de colágeno tipo IV são produzidas por sete
sura circundando tecidos ou células (Figura 9.39). O genes diferentes de colágeno tipo IV. Essas isoformas
termo membrana basal é usado para descrever a lâ- compartilham homologia de estrutura de domínios,
mina basal e os colágenos fibrilares ligados ao seu lado mas diferem em 30-50% de suas seqüências de amino-
externo. A membrana basal dá suporte a tecidos e re- ácidos. Há pelo menos 12 isoformas de laminina. As
gula acesso de células ao estroma intersticial. Também isoformas de colágeno tipo IV e laminina expressas são
participa da determinação de propriedades de células características do tipo celular e do tecido que sintetiza
que estão ligadas a ela, incluindo os críticos processos a membrana basal associada.

BioQ.09 347 22.01.07 17:00:54


358 | PARTE 3 FUNÇÕES DE PROTEÍNAS

PARTE 3 FUNÇÕES DE PROTEÍNAS

10
ENZIMAS: CLASSIFICAÇÃO,
CINÉTICA E CONTROLE
Henry Weiner

10.1 VISÃO GERAL, 359 FMN e FAD são formas coenzimas da ribofla-
vina, 373
10.2 CLASSIFICAÇÃO DE ENZIMAS, 360 Piridoxal fosfato é a forma coenzima de piri-
Classe 1: Óxido-redutases, 361 doxal, 373
Classe 2: Transferases, 361 Adenosina trifosfato pode ser um segundo subs-
Classe 3: Hidrolases, 361 trato ou um modulador de atividade, 374
Classe 4: Liases, 362 Cofatores íons metálicos, 374
Classe 5: Isomerases, 362 Papel de metais em oxidação e redução, 376
Classe 6: Ligases, 363
10.6 CINÉTICA DE REAÇÕES QUÍMICAS, 376
10.3 CONCEITOS GERAIS DE MECANISMOS ENZI- Velocidade de formação de produto, 376
MÁTICOS, 363 Reações de primeira e segunda ordem, 377
Considerações termodinâmicas, 363
Velocidade de desaparecimento de substrato, 377
Ligação de substrato por uma enzima, 364
Reações reversíveis, 378
Estado de transição, 364
Reações complexas, 378
Ligação forte no estado de transição, 365
Reações iônicas não precisam envolver íons,
365 10.7 CINÉTICA ENZIMÁTICA DE REAÇÕES DE UM
Ligações parcialmente carregadas, 366 SUBSTRATO, 379
Importância do grupo carbonila, 366 Equação de Michaelis-Menten, 380
Oxidações, 367 Concentração de enzima livre, 382
Adição e remoção de prótons, 367 Significado de Km, 382
Ligação covalente de substrato à enzima, 367 Número de turnover (kcat), 382
pH afeta a reação por afetar ácidos e bases gerais, Significado de kcat na equação de Michaelis-Men-
368 ten, 383
Quando concentração de substrato é muito
10.4 SÍTIO ATIVO DE UMA ENZIMA, 368 maior que Km, 383
Estereoquímica ajuda a explicar o mecanismo de Quando concentração de substrato é muito
reações catalisadas por enzimas, 370 menor que Km, 383
Influência de grupos sobre o substrato distal à Reações reversíveis, 384
ligação a ser modificada, 370 Baixo Km versus alto kcat, 384
Calculando as constantes, 384
10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES, Substrato e produto ligam-se ao mesmo
371 sítio, 385
Coenzimas, 371 Efeito das condições de ensaio, 385
NAD e NADP são formas coenzimas da niaci- Temperatura, 385
na, 372 pH, 385

BioQ.10 358 22.01.07 17:10:09


CAPÍTULO 10 ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E CONTROLE | 371

CORRELAÇÃO CLÍNICA 10.1


Mutação de um Sítio de Ligação de Coenzima Resulta em Doença Clínica

Cistationinúria é uma doença genética na qual γ-cis- ticos de cistationina. Esses pacientes produzem a
tationase está deficiente ou inativa. A cistationase apoenzima, que reagiu com o anticorpo. Em um pa-
catalisa a reação: ciente, a atividade enzimática era não-detectável em
homogenatos de fibroblastos, mas aumentou para
Cistationina → cisteína + α-cetobutirato 31% do normal com a adição de piridoxal fosfato 1
mM à mistura de reação. Acredita-se que o Km para
Deficiência da enzima leva ao acúmulo da cista- a ligação do piridoxal fosfato à enzima tenha aumen-
tionina no plasma. Como cistationase é uma enzima tado, devido a uma mutação no sítio de ligação. Ati-
dependente de piridoxal fosfato, vitamina B6 foi ad- vidade é parcialmente restaurada aumentando-se a
ministrada a pacientes cujos fibroblastos continham concentração de coenzima. Aparentemente, esses
material que apresentavam reação cruzada com an- pacientes requerem uma concentração de estado
ticorpos contra cistationase. Muitos responderam à estacionário mais alta de coenzima para manter a
terapia com B6 com uma queda nos níveis plasmá- atividade de γ-cistationase.

Fonte: Pascal, T. A., Gaull, G. E., Beratis, N. G., Gillam, B. M., Tallan, H. H. e Hirschhorn, K. Vitamin B6 -responsive
and unresponsive cystathionuria: two variant molecular forms. Science 190: 1209, 1975.

|
10.5 COENZIMAS, Coenzimas
CO-SUBSTRATOS E Tabela 10.2 lista as coenzimas e vitaminas a partir das
COFATORES quais são derivadas. Coenzimas participam de enzimas
catalisadas por enzimas, mas não são os compostos pri-
mários que estão sendo modificados. Algumas coenzi-
mas participam da ação de muitas enzimas diferentes,
Muitas enzimas requerem a participação de uma coenzi- enquanto outros participam apenas de um número li-
ma, um co-substrato ou cofator na reação catalítica. Co- mitado de reações. Podem ter afinidades pela enzima
enzimas são moléculas orgânicas pequenas, freqüente- semelhantes ao substrato, podem ser fortemente liga-
mente derivados de vitaminas (ver p. 1074). Podem ser das ou podem ser covalentemente ligadas. Algumas são
ou não modificadas (p. ex., oxidadas ou reduzidas) na modificadas durante uma reação, mas estão no seu es-
reação. As que são alteradas são também chamadas co- tado original no final da reação (modificação cíclica),
substratos. Para algumas reações, a energia de hidróli- enquanto outras permanecem modificadas no fim. Se
se de ATP é necessária sem incorporação de sulfato ao estiverem modificadas no fim (p. ex., oxidadas ou redu-
produto. ATP nessas reações é um co-substrato. Íons zidas), devem participar de outra reação para retornar
metálicos são freqüentemente necessários para reações ao seu estado original. Coenzimas estão presentes em
enzimáticas e chamados cofatores. células em uma concentração razoavelmente constante,

TABELA 10.2 Coenzimas


Coenzima Vitamina Reação Mediada

Biotina Biotina Carboxilação

Cobalamina (B12) Cobalamina (B12) Alquilação

Coenzima A Pantotenato Transferência de acil

Coenzimas flavina Riboflavina (B2) Oxidação-redução

Ácido lipóico Transferência de acil

Coenzimas nicotinamida Nicotinamida Oxidação-redução

Piridoxal fosfato Piridoxina (B6 ) Transferência de amino

Tetra-hidrofolato Ácido fólico Transferência de grupo de um carbono

Tiamina pirofosfato Tiamina (B1) Transferência de carbonila

BioQ.10 371 22.01.07 17:10:28


CAPÍTULO 10 ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E CONTROLE | 383

CORRELAÇÃO CLÍNICA 10.3


Efeito Fisiológico de Mudanças nos Valores de Km de Enzimas
A sensibilidade incomum de asiáticos a bebidas alco- que sua enzima fosse 50% ativa, mas apresentava ati-
ólicas tem uma base bioquímica. Em alguns japone- vidade muito baixa. ALDH forma tetrâmeros com os
ses e chineses, muito menos álcool é necessário para dois monômeros (E4, E3K, E2K2, EK3 e K4), onde E4
produzir vasodilatação, que resulta em rubor facial e K4 são formas homotetraméricas das subunidades
e aceleração dos batimentos cardíacos, do que o ne- contendo glutamato e lisina, respectivamente, e as
cessário para causar o mesmo efeito em europeus. outras são heterotetrâmeros. E3K tinha 50% da ativi-
Os efeitos fisiológicos devem-se ao acetaldeído gera- dade total, não 75%, enquanto EK3 praticamente não
do pela álcool desidrogenase hepática. Acetaldeído tinha atividade, não os 25% que se poderia esperar
é normalmente removido por aldeído desidrogenase com uma subunidade ativa. A subunidade K era do-
(ALDH), que converte acetaldeído em acetato. Um minante e podia inativar a subunidade, à qual estava
aminoácido na posição 487 na subunidade de 500 pareada, uma vez que o resíduo da posição 487 inte-
aminoácidos da enzima tetramérica está trocado em rage com uma arginina da posição 475. Quando um
alguns dos indivíduos afetados. A enzima ativa tem glutamato estava na posição 487, uma ligação salina
um glutamato, enquanto a variante inativa tem uma estável se formava, mas quando uma lisina estava na
lisina. Descobriu-se que a variante asiática tem ati- posição 487, causava um movimento da arginina. O
vidade muito baixa, e o Km para NAD+ aumentado movimento rompia o bolsão de ligação a NAD, em-
de 30 μM para 7.000 μM. Embora a enzima esteja bora o resíduo 487 não estivesse em contato com a
ativa, teria muito pouca atividade no fígado porque dobra de Rossmann. Este exemplo ilustra o fato de
o Km é muito alto e kcat, muito baixa. uma mutação puntual em uma enzima poder afetar
Além disso, indivíduos afetados eram heterozi- o sítio ativo, embora o resíduo não esteja em contato
gotos, tendo genes para a enzima glutamato ativa e direto com essa região. Também mostra como uma
a enzima lisina essencialmente inativa. Esperar-se-ia subunidade pode ser dominante sobre outra.

Fonte: Zhou J. e Weiner, H. Basis for half-of-the-site reactivity and the dominance of the K487 oriental subu-
nit over the E487 subunit in heterotetrameric human liver mitochondrial aldehyde dehydrogenase. Biochemistry
39:12019, 2000.

geral, este termo representa a(s) etapa(s) mais lenta(s) xima nessas condições porque praticamente 100% da
da reação. Como Km, kcat é composta de várias constan- enzima está no complexo ES. No instante em que uma
tes de velocidade individuais. molécula de produto é feita, ela deixa a enzima e outra
molécula de S liga-se à enzima, mantendo sempre a en-
Significado de kcat na Equação de zima saturada com S. Nessas condições, a velocidade é
Michaelis-Menten governada estritamente pelos termos que governam a
reação de ES indo para produto (ES → E + P).
Quando Concentração de Substrato É
Muito Maior do que Km Quando Concentração de Substrato É
Muito Menor do que Km
Equação 10.19 está na forma de uma equação hiperbóli-
ca geral. Quando o valor de [S] é muito maior que o va- Quando [S] é muito baixa comparada com Km, Eq. 10.18
lor de Km, o valor do denominador aproxima-se do valor pode ser aproximada como
de [S], e a equação pode ser aproximada por
kcat [Et ][S] Vmax [S]
v= ou v = (10.27)
kcat [E][S] km Km
v= = kcat [E] (10.26)
[S]
Um gráfico de v versus [S] seria linear, uma con-
isto é, a velocidade torna-se independente da concentra- dição que existe só quando [S] << valor de Km. Como
ção de S; a reação torna-se de ordem zero com relação para qualquer reação química a velocidade de formação
a S. Isso é encontrado na parte da curva onde a veloci- de produto é uma constante de velocidade multiplicada
dade essencialmente se nivela, e não aumenta quando a pela concentração de reagentes, o termo kcat /Km pode
concentração de [S] aumenta (inclinação = 0) (Figura ser considerado como uma constante de velocidade de
10.47). A reação está acontecendo à sua velocidade má- segunda ordem, uma vez que há dois termos de concen-

BioQ.10 383 22.01.07 17:10:54


394 | PARTE 3 FUNÇÕES DE PROTEÍNAS

|
10.10 REGULAÇÃO DE ATI- de modos diferentes de inibidores competitivos ou não-
competitivos. Ligantes podem ser ativadores, até mes-
VIDADE ENZIMÁTICA mo os substratos de enzimas. Os ligantes que mudam a
atividade enzimática, mas não são modificados em con-
seqüência da ação enzimática, são chamados efetores,
modificadores ou moduladores. A maioria das enzimas
Modificação Covalente sujeitas à modulação por ligantes são enzimas determi-
Células têm capacidade de regular a atividade de en- nantes de velocidade de vias metabólicas.
zimas-chaves por modificação covalente ou ligação re- Enzimas que respondem a moduladores têm sí-
versível de ligantes. Muitos exemplos de modificação tios adicionais conhecidos como sítio(s) alostérico(s).
covalente, como fosforilação, serão descritos em outros Alostérico é derivado da raiz grega allo, significando
capítulos. Há muitas proteínas quinases que catalisam “o outro”. Um sítio alostérico é uma região específica da
fosforilação de resíduos de serina, treonina ou treoni- enzima, bem diferente do sítio de ligação do substrato.
na em proteínas e enzimas específicas (ver p. 490) e A existência de sítios alostéricos é ilustrada na Corr.
proteína fosforilases que removem o fosfato por hidróli- Clín. 10.10. Os ligantes que se ligam a sítios alostéricos
se. Dependendo da proteína, fosforilação pode aumen- são chamados efetores alostéricos ou moduladores. Li-
tar ou diminuir a atividade enzimática. Outros grupos gação de um efetor alostérico causa uma mudança con-
além do fosfato podem ser adicionados a uma enzima formacional na enzima, de modo que a afinidade pelo
para alterar sua atividade, incluindo sulfato e acetato. substrato ou outros ligantes também muda. Efetores
Modificação covalente de proteínas é um modo rápido alostéricos positivos (+) aumentam a afinidade da enzi-
e eficiente de controlar atividade de uma proteína ou ma por substrato ou outro ligante. O inverso é verdade
enzima. para efetores alostéricos negativos (–). O sítio alostéri-
co no qual o efetor positivo se liga é chamado um sítio
ativador; o efetor negativo liga-se a um sítio inibitório.
Controle Alostérico de Atividade Enzimas alostéricas são divididas em duas classes,
Enzimática com base no efeito do efetor alostérico sobre Km e Vmax.
Na classe K, o efetor altera o Km, mas não Vmax, en-
Embora os sítios de ligação de substrato e ativo de uma quanto na classe V, o efetor altera Vmax, mas não Km.
enzima sejam estruturas bem definidas, a atividade de Enzimas da classe K dão gráficos duplos-recíprocos
muitas enzimas pode ser modulada por ligantes agindo como os de inibidores competitivos, e enzimas da classe

CORRELAÇÃO CLÍNICA 10.10


Um Caso de Gota Demonstra a A PRPP
sintetase
I
Diferença entre um Sítio Alostérico
e um Sítio de Ligação de Substrato C

A descoberta de que sítios alostéricos inibitórios são separa-


dos de sítios alostéricos ativadores, bem como dos sítios de
ligação de substrato e catalítico, é ilustrada por um estudo +
de um paciente com gota, cujo nível de PRPP nos eritrócitos
estava aumentando. Descobriu-se que a PRPP sintetase do
paciente tinha valores normais de Km, Vmax, juntamente com
sensibilidade à ativação por fosfato. Os níveis aumentados PRPP

de PRPP e hiperuricemia surgiram porque os produtos finais Pi
da via (ATP, GTP) não eram capazes de inibir a sintetase no
sítio alostérico inibitório (I). Sugeriu-se que uma mutação ATP
no sítio inibitório ou no mecanismo de acoplamento entre o Ribose
sítio inibitório e catalítico levou ao defeito do mecanismo de
controle por feedback.
AMP ATP
GMP GTP

Fonte: Sperling, O., Persky-Brosh, S., Boen, P. e DeVries, A. Human erytrocyte phosphoribosyl-pyrophosphate
synthetase mutationally altered in regulatory properties. Biochem. Med. 7: 389, 1973

BioQ.10 394 22.01.07 17:11:17


CAPÍTULO 11 CITOCROMOS P450 E ÓXIDO NÍTRICO SINTASES | 407

PARTE 3 FUNÇÕES DE PROTEÍNAS

11
Adenina
Ribose Citocromo P450
Fosfato Redutase
Fosfato
Ribitol
Citocromo �5
2e- N N ?
NADPH O CH3 1e- Fosfato
N N CH3 Ribitol C N• C
O N N N Fe N
[FAD] H3C O C N C
N 1e-
H3C N
C N C
O
[FMN]
N • • •• N

C N C

Citocromo P450

CITOCROMOS P450 E
ÓXIDO NÍTRICO SINTASES
Linda J. Roman e Bettie Sue Siler Masters

11.1 VISÃO GERAL, 408 11.9 AS ÓXIDO NÍTRICO SINTASES: PROPRIEDA-


DES E FUNÇÃO, 425
11.2 CITOCROMOS P450: PROPRIEDADES E FUN-
ÇÃO, 408 11.10 ISOFORMAS DE ÓXIDO NÍTRICO SINTASES E
FUNÇÕES FISIOLÓGICAS, 428
11.3 CICLO DE REAÇÃO DO CITOCROMO P450, NOSI, 428
409 NOSII, 429
NOSIII, 430
11.4 SISTEMAS DE TRANSPORTE DE ELÉTRONS
DOS CITOCROMOS P450, 410 BIBLIOGRAFIA, 432
NADPH-citocromo p450 redutase é a flavopro-
teína doadora de elétrons no retículo endo- QUESTÕES E RESPOSTAS, 434
plasmático, 410
NADPH-adrenodoxina redutase é a flavoproteína CORRELAÇÕES CLÍNICAS
doadora de elétrons em mitocôndrias, 411 11.1 Hiperplasia Adrenal Congênita: Deficiência
de CYP21A2, 416
11.5 CITOCROMO P450: NOMENCLATURA E ISO- 11.2 Produção de Hormônios Esteróides Duran-
FORMAS, 412 te a Gestação, 418
11.3 Inibição de Citocromo P450: Interações
11.6 CITOCROMOS P450: SUBSTRATOS E FUN- Droga-Droga e Efeitos Adversos, 420
ÇÕES FISIOLÓGICAS, 413 11.4 Papel de CYP2E1 em Toxicidade Hepática
Induzida por Acetaminofen, 422
11.7 CITOCROMOS P450 PARTICIPAM DE SÍNTESE 11.5 Indução de Citocromo P450: Interações
DE HORMÔNIOS ESTERÓIDES E DE OXIGENA- Droga-Droga e Efeitos Adversos, 423
ÇÃO DE COMPOSTOS ENDÓGENOS, 414 11.6 Polimorfismos Genéticos de Enzimas P450,
Citocromos P450 oxidam substratos lipofílicos 426
exógenos, 417 11.7 Mecanismo de Ação de Sildenafil, 430
11.8 Aspectos Clínicos da Produção de Óxido
11.8 INDUÇÃO E INIBIÇÃO DE CITOCROMO P450, Nítrico, 431
423 11.9 História da Nitroglicerina, 432
Interações droga-droga, 423
Polimorfismos genéticos de citocromo P450, 425
Inibição terapêutica de citocromo P450, 425

BioQ.11 407 22.01.07 17:15:52


412 | PARTE 3 FUNÇÕES DE PROTEÍNAS

|
11.5 CITOCROMO P450: de seqüência de aminoácidos dos membros é superior a
55%. A subfamília é identificada por uma letra maiús-
NOMENCLATURA E cula arábica (p. ex., CYP1A, CYP1B, CYP1C, etc.). Os
ISOFORMAS membros individuais de cada subfamília são então nu-
merados na ordem em que foram identificados (p. ex.,
CYP1A1, CYP1A2, CYP1A3, etc.). Embora citocromos
P450 sejam enzimas, os termos “isoenzima” ou “isozi-
Devido ao grande número de citocromos P450 que fo- ma” não são usados para descrever essas proteínas; em
ram identificados (mais de 4.500 em janeiro de 2005), ver disso, o termo “forma”ou “isoforma” é usado.
um sistema de classificação das enzimas em grupos Tabelas 11.1 e 11.2 relacionam as isoformas conheci-
funcionais e nomenclatura foi desenvolvido. O sistema das de citocromos P450 humanos. Há 57 isoformas divi-
escolhido é baseado em classificação de acordo com a didas em 18 famílias e 41 subfamílias. O genoma humano
identidade relativa das seqüências de aminoácidos das codifica 58 pseudogenes CYP que não formam proteína
enzimas. A superfamília dos citocromos P450 é assim ativa. Tabela 11.1 lista as isoformas que utilizam prima-
dividida inicialmente em famílias, nas quais a identida- riamente compostos exógenos (p. ex., drogas e xenobió-
de da seqüência de aminoácidos dos membros é superior ticos); cada isoforma metaboliza uma ampla variedade de
a 40%. A família é designada pelo prefixo “CYP”, em re- substratos. Tabela 11.2 lista as isoformas envolvidas em
ferência a cytochrome P450, seguida por um numeral metabolismo de compostos endógenos; essas isoformas
arábico (p. ex., CYP1, CYP2, CYP3, etc). As famílias são geralmente reconhecem apenas um ou dois substratos
ainda divididas em subfamílias, nas quais a identidade específicos, e estes são apresentados na tabela.

TABELA 11.1 Citocromos P450 Humanos Envolvidos em Metabolismo Exógeno


Família Substrato(s) Inibidor(es) Indutor(es)
Isoformas
CYP Selecionado(s) Selecionado(s) Selecionado(s)

1 1A1 Benzo(a)pireno, diclofenac Cetoconazol Benzo(a)pireno

1A2 Benzo(a)pireno, warfarina Ciprofloxin Erva de São João

1B1 Benzo(a)pireno, aflatoxina B1 Tamoxifen NCa

2 2A6 Acetaminofen, nicotina Canabidol Dexametasona

2A7 NC NC NC

2A13 Hexametilfosforamida NC NC

2B6 Diazepam, mefenitoína Cetoconazol Rifampicina

2C8 Taxol, ibuprofen, verapamil Quinina Fenobarbital

2C9 Amitriptilina, naproxen Sulfafenazol Rifampicina

2C18 Imipramina, metadona NC Rifampicina

2C19 Diazepan, omeprazol Isoniazida Rifampicina

2D6 Fluvastatina, codeína, risperidona Quinidona Dimetilsulfóxido

2E1 Acetaminofen, halotano Watercress Isoniazida, etanol

2F1 Naftaleno, estireno NC NC

2J2 Bufuralol NC NC

2R1, 2S1 NC NC NC

2U1, 2W1 NC NC NC

3 3A4 Eritromicina, nifedipina, codeína, warfarina, Troleandomicina, Cortisol, rifampina,


terfenadina cetoconazol fenobarbital

3A5 Verapamil, prevastatina NC Dexametazona

3A7 Ácido retinóico, codeína, cortisol DHEA NC

3A43 Testosterona NC NC

a
NC, não bem caracterizado.

BioQ.11 412 22.01.07 17:16:01


420 | PARTE 3 FUNÇÕES DE PROTEÍNAS

Metabolismo de Terfenadina Acetaminofen, comumente usado como analgésico


e antipirético, é convertido por CYP2E1 em N-acetil-p-
OH Terfenadina
(Seldane) benzoquinoneimina (NAPQ1), um composto muito rea-
HO N
tivo levando a aductos protéicos, estresse oxidativo e to-
xicidade. Normalmente, acetaminofen é primariamente
metabolizado por vias de glucuronidação e sulfatação
CYP3A4 em conjugados polares, inativos, que são facilmente ex-
cretados (Figura 11.14, vias superior e inferior, respec-
OH Fexofenadina tivamente). Acetaminofen é também metabolizado por
(Allegra)
HO N CYP2E1 em NAPQ1 muito reativo (Figura 11.14, via do
meio). A quantidade de acetaminofen que é metaboliza-
da por CYP2E1 é normalmente baixa, em comparação
CO2H
com glucuronidação e sulfatação. As pequenas quanti-
FIGURA 11.12 dades de NAPQ1 formadas são rapidamente conjugadas
O metabolismo de terfenadina em fexofenadina, o composto por glutationa (ver p. 764) em um metabólito não-tóxico.
bioativo.

CORRELAÇÃO CLÍNICA 11.3


Inibição de Citocromo P450: Interações Droga-Droga e Efeitos Adversos

Os papéis que citocromos P450 desempenham no cardíacos sérios surgiram, porque a droga parental
metabolismo de drogas e as sérias conseqüências causou alteração nos canais cardíacos de potássio
das interações droga-droga foram demonstrados e aumentou o risco de uma taquicardia ventricular
com clareza para duas drogas, terfenadina (Selda- rara, chamada Torsade de Pointes. Alguns indiví-
ne) e cisapride (Propulside), quando seu metabolis- duos morreram de problemas cardíacos que se de-
mo foi inibido por outras drogas. Uma pequena por- senvolveram depois que tomaram terfenadina com
centagem dos usuários teve efeitos adversos graves, eritromicina ou cetoconazol. Como as propriedades
que forçaram seus fabricantes e o Food and Drug terapêuticas da terfenadina estão associadas com
Administration (FDA) a divulgar avisos de que es- seu metabólito não-tóxico fexofenadina, o fabrican-
sas drogas não podem ser tomadas juntamente com te testou fexofenadina como um novo medicamento
outras drogas que inibem CYP3A4. A gravidade dos e buscou aprovação do FDA para esse metabólito,
efeitos adversos forçou o FDA a remover ambas as agora comercializado como Allegra.
drogas do mercado. Cisapride foi aprovado em 1993 para pacientes
O FDA aprovou terfenadina, um anti-histamínico que sofrem de azia noturna, que resulta de doença
de segunda geração, em 1985, para tratar alergias de refluxo gastro-esofágico ou GERD. A eliminação
sazonais. Terfenadina é rapidamente metabolizada dessa droga do corpo depende do seu metabolismo
no fígado por CYP3A4 em fexofenadina, como mos- por CYP3A4, e quando administrada sozinha ou com
tra a Figura 11.12, resultando em baixos níveis da outras drogas que não inibem CYP3A4, a droga ori-
droga original logo depois da ingestão, mas os efei- ginal não se acumula no plasma. Entretanto, quan-
tos terapêuticos do terfenadina são realmente cau- do tomada com outras drogas que são substratos ou
sados por fexofenadina. Como muitas outras drogas inibidores de CYP3A4, o metabolismo de cisapride é
são substratos ou inibidores de CYP3A4, o metabo- reduzido e acumula-se com administrações subse-
lismo de terfenadina é potencialmente passível de qüentes. Em alguns indivíduos, níveis aumentados
inibição. Indivíduos que tomaram terfenadina com o de cisapride causam arritmias cardíacas e, por volta
antibiótico macrolídeo eritromicina, ou com o agente do final de 1999, anomalias de ritmo cardíaco foram
antifúngico cetoconazol, ambos fortes inibidores de relatados em 341 pacientes que tomavam cisapride,
CYP3A4, apresentaram níveis plasmáticos significa- resultando em 80 mortes. Então, o fabricante de ci-
tivamente elevados de terfenadina. Numa pequena sapride parou de comercializar essa droga nos Esta-
porcentagem de usuários de terfenadina, problemas dos Unidos, após 2000.

Fonte: Terfenadine: proposal to withdraw approval of two new drugs applications and one abbreviated new drug
application. Fed. Reg. 62:1889, 1997. (Esse documento pode ser visto na página da internet do Federal Register em
http://www.access.gpo.gov/su_docs/aces/aces140.html); e Desta, Z., Soukhova, N., Mahal, S. K. e Flockhart, D. A.
Interactions of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab.
Dispos. 28:789, 2000.

BioQ.11 420 22.01.07 17:16:08


428 | PARTE 3 FUNÇÕES DE PROTEÍNAS

|
11.10 ISOFORMAS DE bora se localize na membrana por interações proteí-
na-proteína com uma gama de proteínas regulatórias
ÓXIDO NÍTRICO e de localização. É expressa constitutivamente, o que
SINTASES E FUNÇÕES significa que não é normalmente induzida em nível
transcripcional, e é ativada pelo influxo de cálcio. No
FISIOLÓGICAS caso de NOSI, e NOSIII, ver a seguir), calmodulina não
está ligada à enzima nos níveis intracelulares basais
de cálcio. Requer um influxo de cálcio para elevar a
Há três isoformas principais de NOS – neuronal (NOSI concentração de cálcio, permitindo ligação da calmo-
ou nNOS), indutível (NOSII ou iNOS) e endotelial dulina, assim ativando a formação de NO. A quantida-
(NOSIII ou eNOS) – embora variações em cada um de de NO sintetizado no estado ativado é muito baixa
desses tipos ocorram em muitos organismos diferentes. – isto é, picomolar. O NO produzido funciona como um
Propriedades dessas isoformas são resumidas na Tabe- neurotransmissor nos sistemas nervosos central e pe-
la 11.4. riférico. No músculo esquelético, NO também serve de
Muitas das funções fisiológicas de NO são mediadas mediador da força contrátil.
por ativação de guanilato ciclase solúvel, uma proteí- No sistema nervoso central, NO é produzido geral-
na heterodimérica (α/β) contendo heme que converte mente por NOSI no neurônio pós-sináptico, mas difun-
GTP em cGMP. cGMP é um segundo mensageiro envol- de de volta na sinapse para o neurônio pré-sináptico.
vido em muitas cascatas de transdução de sinal (ver p. Síntese de NO é regulada pelo influxo de cálcio por ca-
518). A forma inativa da guanilato ciclase solúvel tem nais dependentes de receptor – isto é, após estimulação
um heme penta-coordenado, ligado por uma histidina pós-sináptica de receptores de N-metil-D-aspartado
à subunidade β. NO liga-se à sexta posição para formar (NMDA) pelo neurotransmissor excitatório glutamato.
um heme hexa-coordenado e causa quebra da ligação Guanilato ciclase é ativada por NO, produzindo cGMP,
heme-histidina, gerando o complexo nitrosil ativo, pen- que regula síntese dos neurotransmissores norepinefri-
ta-coordenado, da guanilato ciclase solúvel (Figura na e glutamato, aumentando assim a produção de NO
11.19). Ativação da guanilato ciclase solúvel causa au- (Figura 11.20). NO está implicado em sinalização neu-
mento de até 400 vezes na taxa de formação de cGMP. ral, neurotoxicidade, plasticidade neuronal, aprendiza-
Os níveis de cGMP são regulados por um equilíbrio entre do e memória, e percepção de dor.
atividade de guanilato ciclase e fosfodiesterase (PDE), Além de seus domínios oxigenase e redutase, NOSI
particularmente PDE5, que é específica para cGMP, que tem um domínio PDZ N-terminal de 300 aminoácidos,
hidrolisa cGMP em 5’-GMP, desligando o sinal. que medeia sua interação com outras proteínas. No sis-
tema nervoso central, o domínio PDZ da NOSI interage
com a proteína de densidade pós-sináptica PSD-95. O
NOSI receptor NMDA também interage com PSD-95, aproxi-
NOSI é encontrada primariamente em músculo es- mando muito NOSI e o receptor NMDA, de modo que
quelético e em neurônios tanto do sistema nervoso NOSI fica diretamente exposta ao cálcio entrando pelo
central como do periférico. É uma enzima solúvel, em- canal iônico do receptor NMDA ativado.

������� ������ ����� FIGURA 11.19


His
Ativação da guanilato ciclase solúvel por NO.
His
His Redesenhado com base em figura de Bellamy, T. C. e
α1 β1 α1 β1 α1 β1 Garthwaite, J. The receptor-like properties of nitric
e2+
Fe
F
2+ oxide-activated soluble guanylate cyclase in intact
Fe
e2+
Fe
F cells. Mol. Cell. Biochem. 230:165, 2002.
NO
NO
NO

TABELA 11.4 Propriedades das Isoformas de NOS


Propriedade NOSI NOSII NOSIII

Massa molecular 160 kDa 130 kDa 135 kDa

Expressão Constitutiva Indutível Constitutiva

Fração celular Citoplasmática Citoplasmática Ligada à membrana

Dependência de influxo de cálcio Dependente Independente Dependente

Ação fisiológica Neurotransmissão Citotoxicidade Vasodilatação

BioQ.11 428 22.01.07 17:16:19


436 | PARTE 3 FUNÇÕES DE PROTEÍNAS

PARTE 3 FUNÇÕES DE PROTEÍNAS

12
MEMBRANAS BIOLÓGICAS:
ESTRUTURA E TRANSPORTE
EM MEMBRANAS
Thomas M. Devlin

12.1 VISÃO GERAL, 437 Proteínas periféricas de membrana, 451


Proteínas de membrana ancoradas por lipídeos,
12.2 COMPOSIÇÃO QUÍMICA DE MEMBRANAS, 451
438 Proteínas e lipídeos difundem em lamelas da
Lipídeos são importantes componentes de membrana, 452
membranas, 438 Microdomínios de complexos lipídeo-proteína
Glicerofosfolipídeos são os lipídeos mais estão presentes em membranas, 454
abundantes de membranas, 438 Natureza dinâmica de membranas, 455
Glicerofosfolipídeos são anfipáticos, 441
Esfingolipídeos estão presentes em membranas, 12.5 MOVIMENTO DE MOLÉCULAS ATRAVÉS DE
441 MEMBRANAS, 456
Colesterol é um importante componente de Algumas moléculas difundem através de
membranas plasmáticas, 443 bicamadas lipídicas, 456
Composição em lipídeos varia entre membranas, Classificação e nomenclatura de sistemas de
443 deslocamento por membrana, 457
Proteínas de membrana, 444
Carboidratos de membranas são parte de 12.6 CANAIS DE MEMBRANAS, 458
glicoproteínas ou glicolipídeos, 445 Classificação dos canais de membrana, 458
Características dos canais de membrana, 459
12.3 MICELAS, BICAMADAS LIPÍDICAS E LIPOS- Aquaporinas e aquagliceroporinas, 459
SOMOS, 445 Canais iônicos de Na+, Ca 2+, K+ e Cl–
Lipídeos formam estruturas vesiculares, 445
controlados por voltagem, 460
Bicamadas lipídicas sintéticas e
Canal nicotínicos de acetilcolina (nAChR), 464
lipossomos, 445
Junções comunicantes (gap junctions) e
Propriedades gerais de bicamadas lipídicas, 446
canais do poro nuclear, 465
12.4 ESTRUTURA DE MEMBRANAS BIOLÓGICAS,
12.7 TRANSPORTADORES DE MEMBRANA, 466
447
Quatro etapas no transporte de moléculas de
Modelo do mosaico fluido de membranas
soluto, 466
biológicas, 447
Energética de sistemas de transporte de
Lipídeos são distribuídos assimetricamente em
membranas, 448 membrana, 467
Proteínas integrais de membrana ficam
mergulhadas na bicamada lipídica, 449 12.8 TRANSPORTE PASSIVO, 468

BioQ.12 436 22.01.07 17:18:53


CAPÍTULO 12 MEMBRANAS BIOLÓGICAS: ESTRUTURA E TRANSPORTE EM MEMBRANAS | 445

Carboidratos de Membranas CH2OH


O
São Parte de Glicoproteínas ou H
H
H

Glicolipídeos OH H
HO OH
Carboidratos estão presentes em membranas como
oligossacarídeos covalentemente ligados a proteínas H HNCOCH3
(glicoproteínas) e a lipídeos (glicolipídeos). Os açú- N-Acetil-�-D-glucosamina
cares nos oligossacarídeos incluem glicose, galactose,
manose, fucose, N-acetilgalactosamina, N-acetilglu- CH2OH

cosamina e ácido N-acetilneuramínico (ácido siálico) O


HO H
(Figura 12.18 e Apêndice, para estruturas). Estruturas H
de glicoproteínas e glicolipídeos são apresentadas nas OH H
H OH
páginas 638 e 708, respectivamente. O carboidrato fica
na superfície extracelular da membrana plasmática e H HNCOCH3
na superfície luminal do retículo endoplasmático. Fun-
N-Acetil-�-D-galactosamina
ções de carboidratos ligados a proteínas em membranas
incluem reconhecimento célula-célula, adesão e ação H
como receptor. Há pouco ou nenhum carboidrato livre O
H H
em membranas. CH3

|
H HO
HO OH
12.3 MICELAS, BICAMADAS
LIPÍDICAS E OH
�-L-Fucose
H

LIPOSSOMOS
H
O
H O
CH3 C N HCOH COOH
Lipídeos Formam Estruturas HCOH
Vesiculares CH2OH
H H H OH
A característica estrutural básica das membranas deve-
se às propriedades físico-químicas dos glicerofosfolipí- OH H
deos e esfingolipídeos. Esses compostos anfipáticos, com II
Ácido N-Acetil-D-neuramínico
uma cabeça hidrofílica e uma cauda hidrofóbica (Figura
12.19a), interagem em sistemas aquosos in vitro para
FIGURA 12.18
formar esferas, chamadas micelas (Figura 12.19b). Os Estruturas de alguns carboidratos de membrana.
grupos das cabeças polares ficam no lado de fora da es-
fera, enquanto as caudas hidrofóbicas interagem para
excluir água. Micelas têm apenas uma superfície polar, trutura em bicamada, com duas camadas de lipídeos
que fica no lado apresentado para a fase aquosa. Mice- formando uma estrutura na qual há contato mínimo
las podem ser preparadas contendo um único lipídeo das cadeias hidrocarbônicas com água. Os grupos da
ou uma mistura de lipídeos. A concentração de lipídeos cabeça polar ficam na interface entre o meio aquoso e
necessária para formação de micelas é a concentração o lipídeo, e as caudas hidrofóbicas interagem, criando
micelar crítica. Formação de micelas também depen- um ambiente interior hidrofóbico que exclui água (Fi-
de da temperatura e, se uma mistura de lipídeos estiver gura 12.19c). Esta conformação em bicamada é a estru-
presente, da razão entre as concentrações dos diferen- tura lipídica básica de todas as membranas biológicas.
tes lipídeos (ver p. 1062). A estrutura da micela é muito Bicamadas lipídicas são extremamente estáveis, sendo
estável, graças às interações hidrofóbicas entre cadeias mantidas juntas por forças hidrofóbicas das cadeias hi-
hidrocarbônicas e atração dos grupos polares de cabe- drocarbônicas e interações iônicas dos grupos carrega-
ça pela água. Micelas são importantes em digestão in- dos das cabeças com água. Bicamadas lipídicas selam-
testinal e absorção de lipídeos (ver p. 1031). se automaticamente, se rompidas.
Uma bicamada lipídica, em condições adequadas,
Bicamadas Lipídicas Sintéticas e fechar-se-á sobre si mesma para formar uma vesícula
Lipossomos esférica que separa o ambiente externo de um com-
partimento aquoso interno. Tais vesículas, chamadas
Dependendo das condições experimentais, lipídeos lipossomos (Figura 12.19d), são preparadas usando
anfipáticos como glicerofosfolipídeos formam uma es- lipídeos purificados e lipídeos extraídos de membranas

BioQ.12 445 22.01.07 17:19:06


462 | PARTE 3 FUNÇÕES DE PROTEÍNAS

CORRELAÇÃO CLÍNICA 12.4


O Rim de Mamíferos e
Aquaporinas
O papel primário do rim é regular o pH do sangue, em isquemia tissular. Em algumas condições, como
eliminar produtos tóxicos do metabolismo e regular insuficiência cardíaca congestiva, cirrose hepática e
equilíbrio de água do corpo. Cada rim contém cer- gravidez, há um aumento na quantidade de AQP2 no
ca de um milhão de néfrons, as unidades funcionais rim, levando a uma expansão no volume líquido ex-
multicelulares do tecido. Cada néfron tem várias re- tracelular. Seres humanos sem atividade de AQP1 do
giões distintas (ver diagrama), cada uma com fun- rim aparentemente não têm problemas detectáveis
ções muito específicas no processamento do filtrado em condições normais, mas podem ter em condições
do sangue, que ocorre no glomérulo. Uma grande de estresse (desidratação). Espera-se que condições
quantidade de sangue é filtrada (cerca de 150 L/dia), clínicas adicionais venham a ser atribuídas a altera-
e a água deve ser reabsorvida no néfron e ductos co- ções nas outras aquaporinas.
letores, exceto cerca de 1,5 L/dia, que é excretado
como urina. Aquaporinas são responsáveis pela re-
cuperação de água do filtrado à medida que flue pelo Túbulo contornado
distal
Túbulo de
conexão
lúmen do néfron. Como indicado no diagrama, pelo Glomérulo

menos sete diferentes isoformas de aquaporinas, lo-


calizadas em diferentes pontos ao longo do néfron e Água
dos ductos coletores, são responsáveis pela reabsor-
ção de água. Tubo proximal +ADH
AQP 1, 7, 8 água
Existem várias doenças renais nas quais a reab-
Água
sorção de água é anormal e nas quais a expressão e
a função das aquaporinas foi investigada. Vários mo-
delos animais dessas condições foram úteis na de-
Água
terminação da causa de algumas dessas condições. Dutos coletores
Alça descendente
Baixos níveis de AQP2 e poliúria (excreção excessi- AQP 2, 3, 4, 6, 8
fina
va de urina) são encontrados em diabetes insipidus AQP 1
nefrogênica adquirida (NDI), hipocalemia adquirida
Água
(baixo K+ sangüíneo) e hipercalcemia (Ca 2+ sangü-
íneo aumentado). Em muitos casos, NDI é causada Alça
ascencente +ADH
por incapacidade do rim responder a vasopressina fina água
(ver p. 897); considera-se que isso leve a uma ex-
pressão diminuída e/ou incorporação de AQP2 na Urina final
membrana. Em outros casos de NDI, há um defeito
no gene da aquaporina; em alguns casos, este de-
feito leva a uma incapacidade do monômero formar Localização de aquaporinas em cada segmento do
estruturas tetraméricas normais. Níveis de AQP1, néfron e ductos coletores do rim.
AQP2 e AQP3 em modelos animais são reduzidos Modificado a partir de figura das citações abaixo.

Fonte: King, L. S. e Yasui, M. Aquaporins and disease: Lessons from mice to humans. Trends Endocrinol. Metab.
13:355, 2002. Nielsen, S., Frokiaer, J., Marples, D., Kwon, T-H., Agre, P., e Knepper, M. A. Aquaporins in the kidney:
From molecules to medicine. Physiol. Rev. 82: 205, 2002. King, L. S., Kozono, K., e Agre, P. From structure to disease:
The evolving tale of Aquaporin biology. Nature Rev. Mol. Cell Biol. 5:687, 2004.

acessórias (β, γ ou δ) não têm uma estrutura comum; resíduo carregado positivamente a cada terceira posi-
algumas têm vários segmentos transmembrânicos e ou- ção, e pode servir como um sensor de voltagem; des-
tras são proteínas periféricas localizadas inteiramente locamento mecânico deste segmento pode levar a uma
intra ou extracelularmente. Estão geralmente envolvi- mudança conformacional na proteína, resultando em
das em regulação do canal; subunidades β podem inte- abertura do canal. Dois mecanismos muito diferentes
ragir com proteínas de citoesqueleto e de matriz extra- foram sugeridos, mas nenhum provado, para como o ca-
celular. Um modelo do canal de Na+ é apresentado na nal e os domínios sensíveis a voltagem são acoplados e
Figura 12.38. Um segmento transmembrânico tem um iniciam a abertura do canal. Canais iônicos voltagem-

BioQ.12 462 22.01.07 17:19:39


478 | PARTE 3 FUNÇÕES DE PROTEÍNAS

12.10 | IONÓFOROS tem o canal e grupos hidrofóbicos ficam na periferia do


canal, interagindo com a membrana lipídica. A estru-
tura permite a passagem de água e cátions divalentes,
mas não ânions. Associação e dissociação de monôme-
Um grupo interessante de compostos sintetizados e
ros controla a taxa de fluxo de íons.
excretados por bactérias facilita a translocação de íons
Ionóforos têm atividade de antibiótico, porque
inorgânicos através de membranas de outras células.
rompem o equilíbrio iônico intracelular. São também
Essas moléculas, chamadas ionóforos, são membros
valiosas ferramentas experimentais em estudos de
dos canais sintetizados não-ribossomicamente (ver p.
translocação de íons em membranas biológicas e para
459) e são compostos de peso molecular relativamente
manipulação da composição iônica de células.
baixo (até alguns milhares de daltons). Há dois subgru-
pos principais. (1) transportadores móveis, que ligam
L-Val D-Val
um íon e se difundem facilmente em uma membrana, e O
(2) formadores de canal. Alguns ionóforos importantes O
são listados na Tabela 12.11. O N
N H O
O
Cada transportador móvel tem uma especificidade O O
O L L
definida para íons. Valinomicina (Figura 12.59) tem N
O K+
uma afinidade por K+ 1.000 vezes maior do que por Na+, D-Val
O
L-Val
N H
e A23187 (Figura 12.60) tem uma afinidade por Ca 2+ H O
O
10 vezes maior do que por Mg2+. Vários dos transpor- O L O
O N
tadores móveis têm uma estrutura cíclica, e o íon fica N O
coordenado com átomos de oxigênio no centro da es- O

trutura; a periferia da molécula consiste de grupos hi- O D-Val


L-Val
drofóbicos. Quando um íon é quelado pelo ionóforo, sua
capa de água é removida e o íon é envolvido pela capa FIGURA 12.59
Estrutura do complexo valinomicina-K+.
hidrofóbica. O complexo ionóforo-íon difunde-se livre- Abreviaturas: D-Val, D-valina; L-Val: L-valina; L, L-lactato; H,
mente através da membrana. Como interação de íon e D-hidroxiisovalerato.
ionóforo é uma reação de equilíbrio, uma concentração
de estado estacionário (steady state) do íon se estabe- CH3
lece em ambos os lados da membrana.
Valinomicina transporta K+ por um mecanismo ele- H3C CH3
trogênico uniporte que cria um gradiente eletroquímico H O O
através de uma membrana, visto que transporta um K+ H CH3
carregado positivamente (Figura 12.61a). Nigericina é
um antiporter eletricamente neutro; seu grupo carbo- C O
N O
xila, quando dissociado, liga um íon positivo, como K+,
OH
formando um complexo neutro que cruza a membrana. NH
Transporta um próton de volta na difusão pela membra- C
na, levando a uma troca de K+ por H+ (Figura 12.61b). O
Gramicidina A é um peptídeo de 15 resíduos com NH
D- e L-aminoácidos alternados. Em membranas, forma CH3
uma β-hélice e pode dimerizar, formando um longo seg-
mento transmembrânico (25 Å) e um canal de diâmetro FIGURA 12.60
estreito (5 Å) (Figura 12.62). Resíduos polares reves- Estrutura de A23187, um ionóforo de Ca2+.

TABELA 12.11 Importantes Ionóforos


Composto Importantes Cátions Transportados Ação
+ +
Valinomicina K ou Rb Uniporte, eletrogênico
+ +
Nonactina NH4 , K Uniporte, eletrogênico

A23187 Ca2+ /2 H + Antiporte, elétron-neutro


+ +
Nigericina K /H Antiporte, elétron-neutro
+ +
Monensina Na /H Antiporte, elétron-neutro

Gramicidina H +, Na +, K+, Rb + Forma canais


+ +
Alameticina K , Rb Forma canais

BioQ.12 478 22.01.07 17:20:19


CAPÍTULO 13 FUNDAMENTOS DA TRANSDUÇÃO DE SINAL | 483

PARTE 3 FUNÇÕES DE PROTEÍNAS

P P
P P

13
FUNDAMENTOS DA
TRANSDUÇÃO DE SINAL
George R. Dubyak

13.1 VISÃO GERAL, 484 Receptores canais iônicos, 494


Término da sinalização por receptores canais
13.2 TRANSDUÇÃO DE SINAL INTERCELULAR, iônicos, 495
485 Regulação de canais iônicos por outros recep-
Dois modos fundamentais de transdução de tores, 495
sinal intercelular, 485
Sinalização justácrina ou contato-depen- 13.6 RECEPTORES LIGADOS A ENZIMAS, 496
dente, 485 Funções fisiológicas de ligantes extracelulares,
Sinalização endócrina, 486 496
Sinalização parácrina, 486 Receptores tirosina quinases (RTKs), 496
Sinalização sináptica ou neuronal, 486 Ras GTPase e MAP quinase, 497
Sinalização autócrina, 486 Receptores serina/treonina quinases, 499
Moléculas sinalizadoras secretadas, 487
13.7 RECEPTORES DE CITOCINAS, 500
13.3 RECEPTORES PARA MOLÉCULAS SECRETA- Receptores de citocinas: estrutura e função,
DAS, 487 500

13.4 TRANSDUÇÃO DE SINAL INTRACELULAR 13.8 RECEPTORES ACOPLADOS A PROTEÍNA G,


POR RECEPTORES DE SUPERFÍCIE CELULAR, 500
488 Funções fisiológicas e ligantes extracelulares,
Ligantes, receptores e interações receptor-li- 500
gante, 488 Estrutura de receptores acoplados a proteína G,
Relações entre receptores, efetores e segundos 501
mensageiros, 489 Proteínas G heterotriméricas, 503
Fosforilação de proteínas na transdução de O ciclo da proteína G, 505
sinal, 490 Término da sinalização por receptores
Proteínas regulatórias que ligam GTP na trans- acoplados a proteína G, 506
dução de sinal, 491 Efeitos de toxinas bacterianas sobre pro-
Outros componentes de complexos de sinaliza- teínas G heterotriméricas, 506
ção mediada por receptor e cascatas, 491
Interação ligante-receptor e eventos subse- 13.9 TRANSDUÇÃO DE SINAL BASEADA EM AMP
qüentes de sinalização, 492 CÍCLICO, 506
Término da transdução de sinal por receptores Regulação da síntese e degradação de AMP
de superfície celular, 492 cíclico, 506
Mecanismos intracelulares de sinalização por
13.5 RECEPTORES CANAIS IÔNICOS LIGANTE-DE- AMP cíclico, 508
PENDENTES, 493

BioQ.13 483 22.01.07 17:40:53


488 | PARTE 3 FUNÇÕES DE PROTEÍNAS

ou reprimir transcrição e, assim, alterar a expressão de moléculas sinalizadoras intracelulares conhecidas


de proteínas codificadas por estes genes. Devido a seus como segundos mensageiros (a molécula secretada
efeitos sobre a expressão gênica, ativação de receptores extracelular é o primeiro mensageiro); ou (2) uma mu-
intracelulares produz mudanças de longa duração (de dança no potencial elétrico de membrana plasmática; e
horas a dias) na função das células-alvos. A estrutura (3) ativação de cascatas enzimáticas envolvendo pro-
e a função desses receptores são descritas em maiores teína quinases, proteína fosfatases ou proteases. Qua-
detalhes na p. 488. tro superfamílias principais de receptores de superfície
Receptores de superfície celular atuam como celular estrutural e funcionalmente relacionados são
sítios de reconhecimento para a vasta maioria de mo- mediadores da imensa maioria de vias de comunicação
léculas sinalizadoras que são muito grandes (proteí- intercelular (Figura 13.4); estas incluem receptores
nas ou hormônios polipeptídicos) ou muito hidrofílicas canais iônicos ligante-dependentes, receptores
para cruzar rapidamente a membrana plasmática da ligados a enzimas ou catalíticos; família de re-
célula-alvo. Tais moléculas sinalizadoras interagem ceptores de citocinas; e receptores acoplados a
com a célula-alvo ligando-se a receptores de superfí- proteína G ou GPCR.

|
cie celular que são proteínas integrais de membrana
(Figura 13.3b). Proteínas receptores de superfície são
acopladas a uma variedade de reações bioquímicas in-
13.4 TRANSDUÇÃO DE
tracelulares chamadas cascatas ou vias de transdu- SINAL INTRACELULAR
ção de sinal.
O evento mais proximal ou precoce da transdução
POR RECEPTORES DE
de sinal, desencadeado pela ligação de uma molécula SUPERFÍCIE CELULAR
sinalizadora a um receptor, é uma mudança conforma-
cional do receptor que resulta no seguinte: (1) geração
Ligantes, Receptores e Interações
��� Receptor canal iônico ligante-dependente
Receptor-Ligante
Membrana Íons
Um ligante é qualquer molécula que se liga a uma re-
plasmática ceptor protéico. Um agonista é um ligante que, ao se li-
Neurotransmissor
gar, ativa transdução de sinal, enquanto um antagonis-
ta é um ligante que impede transdução de sinal quando
se liga ao receptor. Um agonista ou antagonista fi-
Citosol
Receptor
siológico é uma molécula de ocorrência natural (como
um hormônio ou neurotransmissor) que atua como um
��� Receptores ligados a enzimas ligante para um receptor. Um agonista ou antagonis-
ta farmacológico é uma molécula sintética que atua
como um ligante para um receptor. Muitas drogas tera-
pêuticas são agonistas ou antagonistas de receptores.
Certos agonistas fisiológicos podem estimular múl-
tiplos tipos de receptores que são chamados subtipos
de receptores. O conceito-chave é que a mesma molé-
Domínio catalítico inativo Domínio catalítico inativo cula extracelular sinalizadora pode se ligar a diferen-
tes receptores protéicos que são produtos de diferentes
��� Receptores de citocinas
genes. Por exemplo, acetilcolina pode interagir com um
receptor canal iônico ligante-dependente (ver p. 465)
que causa contração de músculo esquelético, ou com
receptores acoplados a proteína G (ver p. 491) que cau-
sam relaxamento do músculo cardíaco (Figura 13.5).

Enzima ativada
��� Receptores acoplados a proteína G
Neurotransmissor ou hormônio

FIGURA 13.4
Principais classes de receptores de
superfície celular para moléculas
sinalizadoras secretadas.
Redesenhado com base em figura de
Alberts, B., et al. Essential Cell Biology,
Proteína G Enzima Proteína G ativada Enzima ativada 2nd ed. New York: Garland, 2004.

BioQ.13 488 22.01.07 17:41:19


498 | PARTE 3 FUNÇÕES DE PROTEÍNAS

CORRELAÇÃO CLÍNICA 13.1


Família de Receptores Tirosina Quinases ErbB/HER como Alvos para
Quimioterapia do Câncer
O receptor de fator de crescimento epidérmico do gene ErbB2 é amplificada em até duas ordens de
(EGF) foi o primeiro com atividade intrínseca de ti- grandeza em 20% dos seres humanos com câncer de
rosina quinase a ser identificado e caracterizado em mama invasivo.
detalhes. Este receptor catalítico é membro de uma A expressão aberrante de proteína ErbB/HER em
família de quatro proteínas relacionadas, chamadas múltiplos cânceres humanos tem levado ao desenvol-
receptores ErbB/HER, devido à sua semelhança com vimento de várias terapias por drogas que têm estes
o oncogene v-erbB de vírus de eritroblastose aviária, receptores como alvos. Um grupo de agentes tera-
que induz leucemia eritróide em pássaros. Esta liga- pêuticos inclui anticorpos monoclonais que se ligam
ção entre proteínas ErbB/HER e câncer também se a domínios extracelulares funcionalmente significa-
observa no homem. Superexpressão do gene ErbB1 tivos de diferentes subtipos de HER. Trastuzumab
humano, que codifica o receptor humano de EGF (Herceptin® da Genentech) é um anticorpo anti-
(HER1), caracteriza cânceres de bexiga, mama, rim, HER2 que tem sido usado, desde 1998, para o trata-
próstata e pulmão de célula não-pequena. Um gene mento desses cânceres de mama caracterizados por
ErbB1 mutante produz um receptor que não tem o superexpressão de ErbB2/HER2. O mecanismo por
domínio extracelular de ligação a EGF, e é muito trás das ações antitumorais de Trastuzumab/Her-
expresso nos glioblastomas, que correspondem a ceotin® envolve o recrutamento de fatores imunes
25% dos tumores de cérebro humano adulto. ErbB3 anticorpo-dependentes que matam as células tumo-
e ErbB4 humanos, respectivamente, codificam os rais e a atenuação da proteólise do ectodomínio de
receptores HER3 e HER4 que se ligam a proteínas HER2 (por metaloproteases nativas) que potencia-
extracelulares pertencentes à família NRG (neurre- liza ainda mais a dimerização constitutiva desses
gulina/herregulina/neu) de fatores de crescimento receptores. Cetixumab (IMC-C225 ou Erbitux® da
e diferenciação. ErbB3 é freqüentemente superex- ImClone) é um anticorpo que interage com o domí-
presso em cânceres de mama, cólon, próstata e estô- nio de ligação de EGF da proteína ErbB1/HER1 e,
mago, enquanto superexpressão de ErbB4 foi obser- assim, impede ativação induzida por ligante do re-
vada em tumores de células da granulosa ovariana. ceptor. Este agente está sendo testado em pacientes
O outro membro da família é o gene ErbB2, que co- com cânceres de célula escamosa de cabeça e pes-
difica a proteína HER2 a qual, surpreendentemente, coço ou cânceres de pulmão de célula não-pequena.
não tem capacidade de se ligar a nenhum fator de Além dessas terapias baseadas em anticorpos, uma
crescimento extracelular conhecido. Em vez disso, variedade de drogas que são moléculas pequenas
receptores HER2 possuem uma conformação basal foi projetada para atingir os domínios intracelula-
que permite a eles formarem homodímeros com ou- res tirosina quinase das proteínas ErbB/HER. Esses
tras proteínas HER2 não-ligadas ou heterodímeros reagentes são compostos baseados em 4-anilinoqui-
com receptores HER1, HER3 ou HER4 ocupados por nazolina, que atuam como inibidores competitivos
fator de crescimento. Como dimerização é a etapa dos sítios de ligação de ATP das quinases, particu-
crítica para ativar a atividade intrínseca de tirosina larmente do subtipo ErbB1/HER1. No momento, tais
quinase dessa proteína, mesmo modesta superex- drogas estão sendo testadas em pacientes sofrendo
pressão de HER2 pode alterar regulação normal de de cânceres de pulmão de célula não-pequena que
crescimento celular. Significativamente, expressão não responderam a outras quimioterapias.

Fonte: Roskowski, R., Jr. The ErbB/HER receptor protein-tyrosine kinases and cancer. Biochem. Biophys. Res.
Commun. 319:1, 2004.

transitoriamente e estimulam uma família de proteína Quando ativadas, as MAP quinases terminais fosfori-
serina/treonina quinases, que desencadeiam a cascata lam múltiplas proteínas-alvos no citosol e no núcleo, in-
da proteína quinase ativada por mitógeno (mitogen-ac- cluindo fatores de transcrição que regulam a expressão
tivated protein kinase) ou cascata da MAP quinase de genes necessários para divisão celular, sobrevivência
(Figura 13.17). Esta cascata de amplificação envolve celular ou diferenciação fenotípica.
ações em série de três proteína quinases; a primeira
quinase, ativada por Ras (ou MAP quinase quinase qui-
nase) ativa um conjunto intermediário de MAP quinase
quinases, que ativam as MAP quinases finais efetoras.

BioQ.13 498 22.01.07 17:42:09


514 | PARTE 3 FUNÇÕES DE PROTEÍNAS

Proteína quinase FIGURA 13.31


dependente de Pi Domínio inibitório Papel de calmodulina e proteína quinases
calmodulina Proteína fosfatase reguladas por calmodulina nas cascatas de
sinalização intracelular reguladas por Ca2+.
COOH Redesenhado com base em figura de Alberts, B., et
al. Molecular Biology of the Cell, 4th ed. New York:
P Ca2+ independente Inativa Garland, 2002. Principais classes de fosfolipases
(50-80% ativa) usadas durante transdução de sinal mediada por
NH2
receptor.
Domínio catalítico

+Ca2+
Calmodulina
+Ca2+/calmodulina

Ca2+

ADP ATP

P
Ativada
Autofosforilação
Totalmente
ativa

nal) podem fosforilar uma ampla faixa de proteínas fosfatos e diacilgliceróis como segundos mensagei-
substratos. Alterar a atividade dessas proteínas é o ros. Inositol fosfolipídeos podem ser mais fosforilados
mecanismo primário, pelo qual Ca 2+ aumentado alte- por fosfoinositídeo-3-quinase (PI-3K) para produ-
ra o comportamento celular. CaM-quinase II também zir fosfatidilinositol-3,4,5-trisfosfato (PIP3), outro
se autofosforila quando ligada a calmodulina. Embora segundo mensageiro. Enzimas fosfolipases D (PLD)
Ca 2+ citosólico seja só transitoriamente aumentado em hidrolisam predominantemente fosfolipídeos de colina
resposta à ativação de receptores de superfície celular, ou etanolamina para produzir ácido fosfatídico, que
esta autofosforilação de CaM-quinase II permite que é subseqüentemente metabolizado por ácido fosfatídico
permaneça ativa muito depois do Ca 2+ citosólico ter fosfo-hidrolases (PAP) para gerar o segundo mensagei-
voltado ao nível de linha basal. CaM-quinases podem ro diacilglicerol. Enzimas fosfolipases A2 (PLA2)
fosforilar e modular uma ampla faixa de enzimas, ca- atacam vários fosfolipídeos para produzir ácidos graxos
nais iônicos, proteínas contráteis e proteínas regulató- livres, como ácido araquidônico e liso-fosfolipídeos.
rias de genes.

|
Regulação de Fofolipase C e
13.12 TRANSDUÇÃO DE Fosfolipase D
SINAL BASEADA EM
Como descrito anteriormente para transdução de sinal
FOSFOLIPÍDEOS baseada em Ca 2+, muitos receptores acoplados a pro-
teína G e receptores tirosina quinases estimulam a li-
beração de Ca 2+ do retículo endoplasmático por meio
Metabolismo Regulado de de ativação da produção de 1,4,5-inositol trisfosfato
Fosfolipídeos como um Componente (IP3). Este segundo mensageiro solúvel em água é deri-
de Vias Intracelulares de Sinalização vado da hidrólise de fosfatidilinositol-4,5-bisfosfa-
to (PIP2), um fosfolipídeo de membrana relativamente
Transdução de sinal por muitos receptores de super- minoritário que é gerado por múltiplas fosforilações do
fície celular envolve ativação de uma ou mais fosfoli- resíduo de inositol do fosfatidilinositol. Esta hidrólise de
pases que catalisam a hidrólise de diferentes classes PIP2 é catalisada por uma família de fosfolipases tipo C
de fosfolipídeos (p. ex., fosfolipídeos de inositol ou (PLC) com alta seletividade para inositol fosfolipídeos
colina). Várias importantes classes de enzimas efeto- (Figura 13.32). É importante apreciar que a hidrólise de
ras fosfolipases catalisam a produção de diferentes PIPs por uma PLC gera dois segundos mensageiros di-
produtos que atuam como segundos mensageiros ou ferentes: (1) o produto solúvel IP3 e (2) diacilglicerol
reguladores de produção de segundos mensageiros (DAG), um segundo mensageiro hidrofóbico. Enzimas
(Figura 13.32). Enzimas fosfolipases C (PI-PLC) PI-PLCβ são ativadas por interação com subunidades
hidrolisam fosfolipídeos de inositol gerando inositol α de proteínas G da família Gq /11 ou as subunidades βγ

BioQ.13 514 22.01.07 17:43:19


CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO | 521

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

P P
P P

14
BIOENERGÉTICA E
METABOLISMO OXIDATIVO
Diana S. Beattie

14.1 SISTEMAS DE PRODUÇÃO E DE UTILIZAÇÃO Conversão do grupo acetil de acetil-CoA a CO2


DE ENERGIA, 522 e H2O conserva energia, 537
ATP liga sistemas de produção e de utilização Ciclo dos ácidos tricarboxílicos serve como
de energia, 522 uma fonte de intermediários biossintéticos,
NAD+ e NADPH em catabolismo e anabolismo, 537
523 Reações anapleróticas repõem intermediários
do ciclo dos ácidos tricarboxílicos, 538
14.2 RELAÇÕES TERMODINÂMICAS E COMPO- Atividade do ciclo dos ácidos tricarboxílicos é
NENTES RICOS EM ENERGIA, 524 cuidadosamente regulada, 539
Energia Livre é energia disponível para traba-
lho útil, 525 14.5 ESTRUTURA E COMPARTIMENTALIZAÇÃO
Valor calórico de componentes da dieta, 526 POR MEMBRANAS MITOCONDRIAIS, 540
Compostos são classificados com base em ener- Membranas mitocondriais interna e externa
gia liberada na hidrólise de grupos específi- têm diferentes composições e funções, 540
cos, 526
14.6 CADEIA DE TRANSPORTE DE ELÉTRONS,
Variações de energia livre podem ser determi-
542
nadas em reações enzimáticas acopladas,
Reações de oxidação-redução, 542
527
Variações da energia livre em reações redox,
Energias de ligações de alta energia de vários 544
grupos podem ser transferidas de um com- Transporte mitocondrial de elétrons é um
posto para outro, 527 sistema com múltiplos componentes, 544
Complexo I: NADH-ubiquinona óxido-redutase,
14.3 FONTES E DESTINOS DA ACETIL-COENZIMA 545
A, 529 Complexo II: succinato-ubiquinona óxido-redu-
Fontes e destinos metabólicos do piruvato, tase, 546
530 Outras desidrogenases flavoproteínas mito-
Piruvato desidrogenase é um complexo mul- condriais, 546
tienzimático, 531 Complexo III: ubiquinol-citocromo c óxido-re-
Piruvato desidrogenase é rigorosamente regu- dutase, 547
lada, 531 Citocromos, 547
Acetil-CoA é usado por várias vias diferentes, Ciclo Q para transferência de elétrons e
534 bombeamento de prótons no complexo
III, 549
14.4 CICLO DOS ÁCIDOS TRICARBOXÍLICOS, 534 Movimento proposto das proteínas ferro-
Reações do ciclo dos ácidos tricarboxílicos, enxofre durante transferência de elé-
535 trons no complexo III, 549

BioQ.14 521 22.01.07 17:50:31


524 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

Carboidrato Nicotinamida Nicotinamida


(oxidada) (reduzida)

H C OH
O Íon híbrido, O
H H H
4 H:–
C NH2 C NH2 + H+

Nicotinamida adenina dinucleotídeo (NAD+)


5 3
H C O
6 2
..
N+ N
1
H C OH –O O CH2

...
P O
H O H H
Oxidado H H
O OH OH NH2

Lipídeo O N
N

AMP
P
–O O CH2
H C H O N N
H H
H H
OH OH
Reduzido
NADP+ contém um grupo fosforil
nessa 2�-hidroxila

FIGURA 14.3 FIGURA 14.4


Estados de oxidação de átomos de carbono típicos em Estrutura de nicotinamida adenina dinucleotídeo (NAD +).
carboidratos e lipídeos. Íon hidreto (H: -, um próton com dois elétrons) transferido para NAD +
forma NADH.

|
14.2 RELAÇÕES TERMO- Substrato
reduzido
Produto
oxidado
DINÂMICAS E COM-
PONENTES RICOS EM Catabolismo

ENERGIA
NADP+ NADPH

Células podem interconverter diferentes formas de


Anabolismo
energia e também trocam energia com seu ambiente. Os
princípios de termodinâmica governam reações desse
Produto Precursor
tipo. Conhecimento desses princípios facilita uma per-
reduzido oxidado
cepção de como reações que produzem e que utilizam
energia ocorrem dentro da mesma célula, e como um
FIGURA 14.5
organismo é capaz de executar várias funções de tra- Transferência de equivalentes de redução durante catabolismo
balho. A primeira lei da termodinâmica afirma que e anabolismo usando NADPH e NADH.
energia não pode ser criada nem destruída. Essa lei de
conservação de energia estipula que, embora energia
possa ser convertida de uma forma para outra, a energia sistema. Entropia é vista como a energia de um sistema
total de um sistema permanece constante. Por exemplo, que não está disponível para realizar trabalho útil. To-
energia química disponível em um combustível metabó- dos os processos, sejam químicos ou biológicos, tendem
lico, como glicose, é convertida na glicólise em energia a progredir em direção a uma situação de máxima en-
química de ATP. No músculo esquelético, a energia quí- tropia. Portanto, sistemas vivos que são muito ordena-
mica envolvida em ligações fosfato ricas em energia do dos, nunca estão em equilíbrio com seu ambiente, visto
ATP é convertida em energia mecânica, durante a con- que o equilíbrio em um sistema resulta quando acaso
tração muscular. A energia de um gradiente de prótons ou desordem (entropia) está no máximo. Em sistemas
com eletropotencial osmótico através da membrana mi- biológicos, entretanto, é quase impossível quantificar
tocondrial é convertida em energia química durante a mudanças de entropia porque tais sistemas raramen-
síntese de ATP. te estão em equilíbrio. Para maior simplicidade e por
A segunda lei da termodinâmica diz respeito a utilidade inerente nessas considerações, uma grandeza
entropia. Entropia, designada por S, é uma medida ou chamada energia livre é empregada.
indicador do grau de desordem ou casualidade de um

BioQ.14 524 22.01.07 17:50:36


CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO | 537
COO– COO– H COO– O NADH produzido nas três desidrogenases NAD + -
C ligadas no ciclo TCA é rapidamente oxidado a NAD +
CH2 CH2
C pela cadeia respiratória. Este é outro fator que favorece
CH2 COO– H COO– a direção para frente da malato desidrogenase.
COO–
Conversão do Grupo Acetil de Acetil-
Succinato Malonato Maleato
CoA a CO2 e H2O Conserva Energia
FIGURA 14.21
Estruturas do succinato, um intermediário do ciclo TCA; O ciclo TCA (Figura 14.20) é a via oxidativa terminal
malonato, um inibidor da succinato desidrogenase e do ciclo; e para a maioria dos combustíveis metabólicos. Resíduos
maleato, um composto não envolvido no ciclo.
de dois carbonos na forma de acetil-CoA são completa-
mente oxidados a CO2 e H2O, e quatro etapas oxidativas
resultam na formação de 3 NADH + H+ e 1 FADH2, que
(200 kDa) e é estereoespecífica para a forma trans do são usados subseqüentemente para geração de ATP.
substrato (a forma cis, maleato, não é substrato; Figura Oxidação de cada NADH + H+ resulta em formação de
14.21). A reação é livremente reversível em condições 2,5 ATPs por fosforilação oxidativa, enquanto que oxi-
fisiológicas. Correlação Clínica 14.2 descreve uma defi- dação do FADH2 formado na reação da succinato desi-
ciência genética de fumarase. drogenase gera 1,5 ATPs. Uma ligação de alta energia é
A reação final do ciclo TCA é catalisada pela mala- formada como GTP, na reação da succinil-CoA sinteta-
to desidrogenase, na qual os equivalentes de redução se. Assim, a geração líquida de ATP ou seus equivalen-
são transferidos para NAD +, para formar NADH + H+. tes (i. é, GTP) para a completa oxidação de um grupo
O equilíbrio da reação é fortemente deslocado para a acetil no ciclo de Krebs é 10.
formação de L-malato, com um ΔGo’ = +7,0 kcal mol–1.
Esta reação endergônica é deslocada no sentido para Ciclo dos Ácidos Tricarboxílicos Serve
frente por ação da citrato sintase e de outras reações,
que removem oxaloacetato. como uma Fonte de Intermediários
Biossintéticos
A discussão do ciclo TCA até agora se concentrou em
seu papel na quebra oxidativa de grupos acetil a CO2
CORRELAÇÃO CLÍNICA 14.2
e H2O, formação de coenzimas reduzidas e síntese de
Deficiência de Fumarase ATP. Em geral, o ciclo TCA é o mecanismo final comum
para quebra de alimentos; entretanto, como resumido
Deficiência de enzimas do ciclo TCA é rara, indi- na Figura 14.22, os compostos de quatro, cinco e seis
cando a importância desta via para sobrevivên- carbonos gerados nas reações do ciclo TCA são impor-
cia. Vários casos, entretanto, foram descritos, de tantes intermediários em processos biossintéticos.
severa deficiência de fumarase em mitocôndrias Succinil-CoA, malato, oxaloacetato, α-cetoglutarato e
e citosol de tecidos (p. ex., linfócitos do sangue). citrato são todos precursores da biossíntese de impor-
É caracterizada por severa deficiência neurológi- tantes compostos celulares.
ca, encefalopatia e distonia, que se desenvolvem Transaminação converte α-cetoglutarato em glu-
logo após o nascimento. Urina contém quantida- tamato, que pode deixar a mitocôndria e ser converti-
des anormais de fumarato e níveis elevados de do em vários outros aminoácidos. No tecido nervoso,
succinato, α-cetoglutarato, citrato e malato. As α-cetoglutarato é convertido nos neurotransmissores
isoenzimas mitocondrial e citosólica de fumara- glutamato e ácido γ-aminobutírico (GABA). Glutamato
se são derivadas de um único gene. Em pacientes é também produzido a partir de α-cetoglutarato pela
afetados, ambos os pais têm a metade dos níveis enzima mitocondrial glutamato desidrogenase, em pre-
normais de atividade enzimática, mas são clini- sença de NADH ou NADPH e amônia. O amino grupo
camente normais, como seria de se esperar em incorporado em glutamato pode, então, ser transferido
uma doença autossômica recessiva. A primeira para formar vários aminoácidos, por diferentes amino-
mutação caracterizada no gene da fumarase con- transferases. Estas enzimas e a relevância da incorpo-
tém uma glutamina substituída por um resíduo ração ou da liberação de amônia em ou de α-cetoácidos
de glutamato 319. são discutidas no Capítulo 19.
Succinil-CoA representa um ponto de ramificação
metabólico (Figura 14.23), porque pode ser formado
Fonte: Bourgeron, T., Chreiten, D., Poggi-Bach, J., et. a partir de α-cetoglutarato no ciclo ou a partir de me-
al. Mutation of the fumarase gene in two siblings with tilmalonil-CoA, nas etapas finais da quebra de ácidos
progressive encephalopathy and fumarase deficiency. J. graxos de cadeia ímpar ou dos aminoácidos de cadeia
Clin. Invest. 93:2514, 1994. ramificada valina e isoleucina, ou pode ser convertido

BioQ.14 537 22.01.07 17:50:57


CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO | 565

CORRELAÇÃO CLÍNICA 14.6


Intolerância a Exercício em Pacientes com Mutações no Citocromo b

Em 1993, uma mutação no citocromo b resultando essas mutações envolvem uma transição de guanina
em atividade diminuída do complexo citocromo bc1 para adenina no mtDNA, sugerindo que a mutação
foi encontrada em um homem de 25 anos de idade, pode ter resultado de dano oxidativo. Além disso,
que se apresentava com intolerância a exercício e em todas as mutações de sentido errado (missen-
fraqueza proximal. A mutação substituía um resíduo se), uma glicina conservada foi substituída por uma
de aspartato, no lugar de uma glicina conservada molécula carregada maior; isto alterou a estrutura
na posição 290. Subseqüentemente, demonstrou-se do citocromo b, resultando em atividade catalítica
que outros pacientes com sintomas semelhantes e diminuída do complexo bc1. Mutações sem sentido
atividade diminuída do complexo bc1 têm mutações (nonsense) resultando em citocromo b truncado e
nas quais um glutamato substituiu uma glicina con- mutações envolvendo deleções de 4-24 pares de ba-
servada na posição 339, e uma serina substituiu uma ses do mtDNA foram identificadas. Estas mutações
glicina conservada na posição 34. Mais recentemen- nonsense e por deleções freqüentemente levam a
te, demonstrou-se que um paciente com severa car- severa intolerância a exercício, acidose láctica no es-
diomiopatia hipertrófica tinha uma mutação na qual tado de repouso e ocasionalmente mioglobinúria. Em
um glutamato substituiu uma glicina conservada na contraste com a maioria das mutações no mtDNA, as
posição 166. As mutações de glicina para aspartato mutações identificadas no gene do citocromo b não
ou glutamato estavam localizadas no citocromo b são de herança materna. Além disso, a maioria foi ex-
próximo ao sítio QO para oxidação de ubiquinol, en- pressa apenas em tecidos musculares, sugerindo que
quanto a mutação glicina para serina localizava-se sejam mutações somáticas, que ocorreram durante
próxima do sítio Qi da redução de ubiquinona. Todas diferenciação de células troncos miogênicas.

Fonte: Andreu, A. L., et al. Exercise intolerance due to mutations in the cytochrome b gene of mitochondrial DNA.
N. Engl. J. Med. 341:1037, 1999.

|
14.10 ESPÉCIES REATIVAS O radical hidroxila é, sem dúvida, o radical livre mais
perigoso, uma vez que está envolvido em reações como
DE OXIGÊNIO (ROS) peroxidação de lipídeos e geração de outros radicais tó-
xicos. Peróxido de hidrogênio não é um radical livre,
mas é convertido pelas reações de Fenton ou de Haber-
Oxigênio é essencial para a vida. A maioria das oxida- Weiss no radical hidroxila, em presença de Fe2+ ou de
ções intracelulares resulta em transferência de dois Cu+, que são prevalentes em células (Figura 14.62).
elétrons para aceptores apropriados, como NAD + ou
FAD, que são então oxidados pela cadeia de transporte
de elétrons. A etapa final desta cadeia é catalisada por Produção de Espécies Reativas de
citocromo c oxidase, que liga fortemente O2 ao centro Oxigênio
binuclear, onde redução passo a passo do O2 ocorre,
sem liberação de intermediários no processo de oxida- Embora processos oxidativos em células geralmente
ção (ver Seção 14.6, p. 542). A estrutura eletrônica do resultem em transferência de elétrons para O2 para for-
O2, entretanto, favorece sua redução por adição de um mar água, sem liberação de intermediários, um peque-
elétron de cada vez, levando à geração de radicais de no número de radicais de oxigênio é inevitavelmente
oxigênio que podem causar dano celular. Um radical é formado devido a vazamento nas reações de transferên-
uma molécula com um elétron não-pareado muito reati- cia de elétrons. A principal fonte intracelular de radi-
vo em um orbital externo, que pode iniciar uma cadeia cais de oxigênio é a cadeia de transporte de elétrons
de reações por remoção de um elétron de outra molé- mitocondrial, onde superóxido é produzido por transfe-
cula para completar seu próprio orbital. A transferência rência de um elétron para O2, a partir da semiquinona
passo a passo de elétrons para O2 resulta em formação estável produzida durante a redução de ubiquinona pe-
de ânions superóxido (O2-), depois peróxido de hi- los complexos I e II (Figura 14.63). Superóxido também
drogênio (H2O2), e finalmente radical hidroxila li- pode ser produzido por transferência de um elétron de
vre (OH•) (Figura 14.61). uma flavina, como FMN. As espécies reativas de oxi-

BioQ.14 565 22.01.07 17:51:56


572 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

Glicogênio G C

15
METABOLISMO DE CAR-
BOIDRATOS I: PRINCIPAIS
VIAS METABÓLICAS E SEU
CONTROLE
Robert A. Harris

15.1 VISÃO GERAL, 573 15.4 REGULAÇÃO DA GLICÓLISE, 584


Hexoquinase e glucoquinase têm propriedades
15.2 GLICÓLISE, 574 diferentes, 586
Glicólise ocorre em todas as células humanas, 6-Fosfofruto-1-quinase é uma enzima regulatória
574 da glicólise, 589
Glicose é metabolizada diferentemente em várias Regulação da 6-fosfofruto-1-quinase por
células, 575 ATP e AMP, 589
Regulação da 6-fosfofruto-1-quinase por pH
15.3 VIA GLICOLÍTICA, 577 intracelular, 590
Glicólise ocorre em três estágios, 578 Regulação da 6-fosfofruto-1-quinase por
Estágio um: preparação da glicose, 578 citrato, 592
Estágio dois: quebra de um intermediário Controle hormonal da 6-fosfofruto-1-quinase por
fosforilado, 578 cAMP e frutose 2,6-bisfosfato, 592
Estágio três: reações de óxido-redução e A enzima bifuncional 6-fosfofruto-2-quinase/fru-
síntese de ATP, 578 tose 2,6-bisfosfatase é regulada por fosforila-
ção, 595
Rendimento em ATP e equação balanceada da
Coração contém uma isoenzima diferente da
glicólise anaeróbica, 581
6-fosfofruto-2-quinase/frutose 2,6-bisfosfa-
NADH gerado por glicólise deve ser oxidado no-
tase, 595
vamente a NAD +: papel da lactato desidro-
Piruvato quinase é também uma enzima regula-
genase e das lançadeiras de substrato, 582 tória da glicólise, 595
Glicólise anaeróbica, 582
Glicólise aeróbica, 582 15.5 GLUCONEOGÊNESE, 597
Lançadeiras são importantes em outras vias de Síntese de glicose é necessária para sobrevivên-
óxido-redução, 583 cia, 597
Oxidação de álcool, 583 Ciclos de Cori e da alanina, 599
Formação de glucuronídeo, 583 Síntese de glicose a partir de lactato, 600
Reagentes sulfidrila e fluoreto inibem glicólise, Gluconeogênese usa muitas enzimas glicolí-
583 ticas na direção inversa, 601
Arsenato impede síntese de ATP sem inibir gli- Glicose é sintetizada a partir da maioria dos
cólise, 583 aminoácidos, 602

BioQ.15 572 22.01.07 18:00:31


574 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

GLICOGÊNIO CH2OH
O
Glicogenólise Glicogênese H H

GLICOSE OH H
HO OH
Glicólise Gluconeogênese H OH
�-D-Glicose
LACTATO
2 ADP3– + 2 Pi2–
FIGURA 15.1
Relação da glicose com as principais vias do metabolismo de 2 ATP4–
carboidratos.

O O–
C
gulação é exercida em enzimas chaves será enfatizado
2 HO C H
ao longo do capítulo.
Isto será particularmente verdadeiro para síntese CH3
(glicogênese) e degradação (glicogenólise) de glicogê- L-Lactato

nio. Muitas células armazenam glicogênio para suas pró- FIGURA 15.2
prias necessidades futuras. O fígado é menos egoísta, ar- Equação geral balanceada da soma das reações da glicólise.
mazenando glicogênio principalmente para manutenção
da glicose sangüínea, para garantir que outros tecidos,
em especial o cérebro, tenham um suprimento adequa- se para seu suprimento de ATP, até que um suprimento
do. Regulação da síntese e da degradação de glicogênio é normal de oxigênio esteja disponível. Isto economiza
um modelo para nosso entendimento de como hormônios oxigênio para ser usado pelo cérebro, ilustrando um
funcionam e como vias metabólicas são reguladas. Estes dos muitos mecanismos que evoluíram para assegurar a
tópicos contribuem para nosso entendimento da condi- sobrevivência do tecido cerebral em momentos de es-
ção diabética, do jejum e de como os tecidos do corpo tresse. Oxigênio não é necessário para glicólise; de fato,
respondem a estresse, trauma severo e lesões. oxigênio pode, indiretamente, suprimir glicólise pelo
A química e a nomenclatura dos carboidratos são efeito Pasteur, que será considerado mais tarde (p.
apresentadas no Apêndice. 589). Contudo, glicólise ocorre em células com um su-
primento abundante de oxigênio molecular. Desde que
15.2 | GLICÓLISE as células também contenham mitocôndrias, o produto
final da glicólise em presença de oxigênio é piruvato, e
não lactato. Piruvato é, então, completamente oxidado
Glicólise Ocorre em Todas as Células a CO2 e H2O pelo complexo piruvato desidrogenase e
enzimas do ciclo TCA alojadas dentro de mitocôndrias
Humanas (Figura 15.3). Glicólise, portanto, prepara para a oxida-
ção aeróbica dos carboidratos. O processo completo de
A via de Embden-Meyerhof ou via glicolítica repre-
glicólise e oxidação mitocondrial do piruvato a CO2 e
senta um processo antigo, que ocorre em todas as célu-
H2O tem a seguinte equação:
las do corpo humano, pelo qual ocorre degradação ana-
eróbica de glicose em lactato, com liberação de energia D-Glicose(C6H12O6) + 6 O2 + 32 ADP3- + 32 Pi 2- +
como ATP. Este é um exemplo da fermentação ana- + 32 H+ → 6 CO2 + 6 H2O + 32 ATP4 -
eróbica, um termo usado para vias metabólicas que
organismos usam para extrair energia química de com- Muito mais ATP é produzido na oxidação comple-
bustíveis ricos em energia, em ausência de oxigênio. ta da glicose a CO2 e H2O (32 ATP/glicose) do que na
Para muitos tecidos, glicólise é só uma via fornecedora conversão de glicose em lactato (2 ATP/glicose). Isto
de energia de emergência, capaz de produzir 2 moles de tem importantes conseqüências a serem consideradas
ATP a partir de 1 mol de glicose, em ausência de oxi- em detalhes mais adiante. A importância da glicólise
gênio (Figura 15.2). Quando o suprimento de oxigênio como uma via preparatória é melhor exemplificada pelo
de um tecido é interrompido, os níveis de ATP ainda cérebro, que tem uma necessidade absoluta de glicose.
podem ser mantidos pela glicólise, pelo menos por um O piruvato processado pela glicólise é oxidado a CO2 em
curto período. Muitos exemplos poderiam ser dados, mitocôndrias.
mas a capacidade de utilizar glicólise como uma fon- Um cérebro humano adulto usa aproximadamente
te de energia é particularmente importante durante o 120 g de glicose por dia para suprir sua necessidade de
nascimento natural de seres humanos. Com exceção do ATP. Em contraste, glicólise com lactato como produto
cérebro, a circulação do sangue diminui para a maioria final é o principal mecanismo de produção de ATP em
das partes do corpo do bebê, durante o parto. Normal- alguns outros tecidos. Glóbulos vermelhos não têm mi-
mente, o cérebro não é privado de oxigênio durante o tocôndrias e, portanto, são incapazes de converter piru-
parto, mas outros tecidos passam a depender da glicóli- vato em CO2. A córnea, o cristalino e regiões da retina

BioQ.15 574 22.01.07 18:00:33


CAPÍTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE | 589
ína enzima glucoquinase no fígado. Portanto, uma pes-
soa que está consumindo uma refeição grande e rica em CORRELAÇÃO CLÍNICA 15.4
carboidratos terá maiores quantidades de glucoquinase
do que uma que não está. O fígado com glucoquinase Diabetes Mellitus
induzida contribui mais para baixar os níveis elevados
de glicose no sangue. A ausência de insulina torna o Diabetes mellitus é uma doença crônica que se
fígado de pacientes com diabetes mellitus deficiente em caracteriza por alterações no metabolismo de
glucoquinase, a despeito dos altos níveis de glicose san- carboidratos, lipídeos e proteínas. Dois tipos
güínea, e diminui a capacidade de o fígado “tamponar” principais são identificados clinicamente: tipo 1
a glicose sangüínea (ver Corr. Clín. 15.4). Defeitos no (ver Corr. Clín. 22.8, p. 857) e tipo 2 (ver Corr.
gene que codifica glucoquinase, que alteram sua S0,5 e/ Clín. 22.7, p. 855).
ou Vmax causam diabetes do jovem com início na matu- Em pacientes sem hiperglicemia em jejum,
ridade (MODY, maturity-onset diabetes of the young), o teste de tolerância à glicose por via oral pode
uma forma de diabetes mellitus tipo 2. ser usado para diagnóstico. Consiste na determi-
nação do nível de glicose sangüínea no estado
de jejum e em intervalos de 30-60 min., por 2 h
6-Fosfofruto-1-quinase É uma ou mais, após consumo de sobrecarga de 100 g
Enzima Regulatória da Glicólise de glicose. Em indivíduos normais, glicose san-
güínea retorna aos níveis normais em 2 h após
6-Fosfofruto-1-quinase seja um ponto regulatório ingestão do carboidrato. No diabetes, glicose no
muito importante da glicólise. Catalisa a primeira eta- sangue atinge um nível mais elevado e permane-
pa de comprometimento da glicólise porque a reação ce elevada por períodos de tempo mais longos,
catalisada pela fosfoglicose isomerase é reversível, e cé- dependendo da gravidade da doença. Entretanto,
lulas fazem uso de glicose 6-fosfato na via das pentoses muitos fatores podem contribuir para um teste
fosfato e para síntese de glicogênio. Citrato, ATP e íons de tolerância a glicose anormal. O paciente deve
hidrogênio (baixo pH) são os efetores alostéricos ne- ter consumido uma dieta rica em carboidratos
gativos importantes, enquanto AMP e frutose 2,6-bis- nos 3 dias anteriores, presumivelmente para per-
fosfato são importantes efetores alostéricos positivos mitir indução de enzimas das vias de utilização
(Figura 15.13). Estes compostos sinalizam a necessida- de glicose, por exemplo, glucoquinase, acil graxo
de de diferentes velocidades da glicólise em resposta a sintase e acetil-CoA carboxilase. Quase todas as
mudanças em (a) estado energético da célula (ATP e infecções (até mesmo um resfriado) e “estresse”
AMP), (b) ambiente interno da célula (íons hidrogênio), menos definido (presumivelmente por efeitos so-
(c) disponibilidade de combustíveis alternativos, como bre o sistema nervoso simpático) podem resul-
ácidos graxos e corpos cetônicos (citrato), e (d) razão tar em anormalidades transitórias no teste de
insulina/glucagon no sangue (frutose 2,6-bisfosfato). tolerância à glicose. Devido a esses problemas,
hiperglicemia de jejum seria, provavelmente, o
Regulação da 6-Fosfofruto-1-quinase por teste sine qua non para o diagnóstico de diabe-
ATP e AMP tes. Captação de glicose por tecidos sensíveis a in-
sulina – isto é, múscular e adiposo – é diminuída
O efeito Pasteur é a inibição da utilização de glicose no estado diabético. O paciente diabético ou não
e o acúmulo de lactato que ocorre quando respiração tem insulina ou desenvolveu “resistência à insuli-
(consumo de oxigênio) é iniciada em células anaeróbi- na” nestes tecidos. Resistência à insulina resulta
cas. É perfeitamente compreensível em bases termodi- de anomalia no receptor de insulina ou em etapas
nâmicas, uma vez que a oxidação completa da glicose a subseqüentes, mediadoras dos efeitos metabólicos
CO2 e H2O rende muito mais ATP do que glicólise ana- da insulina. Células do parênquima hepático não
eróbica: requerem insulina para captar glicose. Sem insu-
lina, contudo, o fígado tem capacidade diminuída
Glicólise:
para remover glicose do sangue. Isto é explicado,
D-Glicose + 2 ADP3– + 2 Pi 2 – → 2 L-lactato – + 2 ATP4–
em parte, por atividade diminuída de glucoquina-
Oxidação completa: se e a perda de ação da insulina sobre enzimas-
D-Glicose + 6 O2 + 32 ADP3- + 32 Pi 2 – + 32 H+ → chaves da glicogênese e da via glicolítica.
→ 6 CO2 + 6 H2O + 32 ATP4–

Células usam ATP para fornecer a energia necessá- Fonte: Taylor, S. I. Insulin action, insulin resistance
ria a seus processos de trabalho inerentes. Como muito and type 2 diabetes mellitus. Em: C. R. Scriver, A. L.
mais ATP é produzido a partir de glicose em presença Beaudet, W. S. Sly e D. Valle (Eds.), The Metabolic and
de oxigênio, muito menos glicose precisa ser consumida Molecular Bases of Inherited Disease, 8th ed., New
para satisfazer a demanda de energia. O efeito Pasteur York: McGraw-Hill, 2001, p. 1433.

BioQ.15 589 22.01.07 18:00:57


CAPÍTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE | 609

|
15.6 GLICOGENÓLISE E CH2OH CH2OH
O O
GLICOGÊNESE O O O

Glicogênio É a Forma de Ligação glicosídica �-1,4

���
Armazenamento de Glicose
CH2OH
Glicogenólise refere-se à quebra de glicogênio em gli-
O
cose ou glicose 6-fosfato; glicogênese refere-se à síntese
de glicogênio. Estes processos ocorrem em quase todos O O
os tecidos, mas especialmente em músculo e fígado. No
CH2
homem bem alimentado, o conteúdo de glicogênio no
O
fígado pode responder por até 10% do peso úmido des-
se órgão. Músculo armazena menos glicogênio, quando O O
expresso nas mesmas bases – um máximo de apenas
1-2% do seu peso úmido. Contudo, a maioria das pes-
soas tem mais músculos do que fígado, com o total do Ligação glicosídica �-1,6

glicogênio muscular chegando ao dobro da quantidade ���


de glicogênio hepático.
FIGURA 15.47
Grânulos de glicogênio são abundantes no fígado Dois tipos de ligações entre as moléculas de glicose estão
de animais bem alimentados (Figura 15.46), mas estão presentes no glicogênio.
virtualmente ausentes deste órgão após 24 h de jejum.
Exercício pesado causa a mesma perda de grânulos de
glicogênio em fibras musculares. Esses grânulos são “árvore” do glicogênio (ver Figura 15.48) é caracteri-
grupos de moléculas individuais de glicogênio que têm zado por ramos a cada quatro resíduos glucosil no es-
uma massa de até 2  107 Da. Glicogênio é composto queleto (core) mais central da molécula, e muito menos
de resíduos glucosil, ligados principalmente por liga- freqüentemente em regiões mais externas. Glicogênio
ções glicosídicas α-1,4 (Figura 15.47). Ramificações contrasta com proteínas e ácidos nucléicos, devido a
surgem de ligações α-1,6 freqüentes. Um braço da essa ramificação, mas, é claro, é uma forma de arma-
zenamento de combustível e não catalisa reações nem
contém informação em uma célula.
Glicogênio é estocado em músculo e fígado por razões
bem diferentes. Glicogênio do músculo é uma reserva
de combustível para a produção de ATP dentro daquele
tecido, enquanto glicogênio hepático é uma reserva de
glicose para a manutenção das concentrações de glicose
no sangue. Os níveis de glicogênio hepático variam: são
altos logo após uma refeição e, depois, diminuem lenta-
mente à medida que é usado para ajudar a manter o nível
de glicose no sangue (ver Figura 15.49) entre refeições
e durante o jejum noturno. No homem como no rato, o

FIGURA 15.46
Micrografia eletrônica mostrando grânulos de glicogênio
(material corado escuro) no fígado de um rato alimentado.
Micrografia generosamente cedida por Dr. Robert R. Cardell FIGURA 15.48
do Department of Anatomy da University of Cincinnati. Estrutura ramificada do glicogênio

BioQ.15 609 22.01.07 18:01:40


626 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

16
COO– CH2OH
O –O SO O
H
H
3
H O–
OH H O H
H H H

H OH H HNCOCH3

Unidade repetitiva do condroitim 4-sulfato

METABOLISMO DE
CARBOIDRATOS II:
VIAS ESPECIAIS E
GLICOCONJUGADOS
Nancy B. Schwartz

16.1 VISÃO GERAL, 627 16.5 GLICOPROTEÍNAS, 638


Glicoproteínas contêm quantidades variáveis de
16.2 VIA DAS PENTOSES FOSFATO, 627 carboidratos, 639
Via das pentoses fosfato tem duas fases, 627 Carboidratos são ligados Covalentemente a glico-
Glicose 6-fosfato é oxidada e descarboxilada proteínas por ligações N- ou O-glicosídicas,
em uma pentose fosfato, 627 639
Interconversões de pentoses fosfato levam a Síntese de glicoproteínas N-ligadas envolve doli-
intermediários glicolíticos, 628 col fosfato, 640
Glicose 6-fosfato pode ser completamente oxida-
da a CO2, 628 16.6 PROTEOGLICANOS, 642
Via das pentoses fosfato produz NADPH, 630 Existem seis classes de proteoglicanos, 642
Hialuronato é um copolímero de N-acetilglu-
16.3 INTERCONVERSÕES DE AÇÚCARES E FORMA- cosamina e ácido glucurônico, 642
ÇÃO DE NUCLEOTÍDEOS-AÇÚCAR, 631 Condroitim sulfatos são os glicosaminoglica-
Isomerização e fosforilação são reações comuns nos mais abundantes, 642
para interconverter carboidratos, 631 Dermatam sulfato contém ácido L-idurônico,
Açúcares ligados a nucleotídeos são intermediários 643
em muitas transformações de açúcares, 633 Heparina e heparam sulfato diferem dos
Epimerização interconverte glicose e galactose, outros glicosaminoglicanos, 643
633 Queratam sulfato existe em duas formas, 643
Ácido glucurônico é formado por oxidação de Biossíntese de condroitim sulfato é típica da
UDP-glicose, 634 formação de glicosaminoglicanos, 643
Descarboxilação, óxido-redução e transaminação
de açúcares geram produtos necessários, 635 BIBLIOGRAFIA, 647
Ácidos siálicos são derivados de N-acetilglucosa-
mina, 637 QUESTÕES E RESPOSTAS, 647

16.4 BIOSSÍNTESE DE CARBOIDRATOS COMPLE-


XOS, 637

BioQ.16 626 22.01.07 18:09:26


CAPÍTULO 16 METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS | 631
ATP ADP (6) NADP+ (6) NADPH + (6) H+ H2O
Glicose (6) Glicose 6-fosfato 6-Fosfoglucono-lactona 6-Fosfogluconato

(6) NADP+
(6) CO2 (6) NADPH + (6)H+

(6) Ribulose 5-fosfato

(4) Xilulose 5-fosfato (2) Ribose 5-fosfato

(2) Frutose 6-fosfato


(2) Gliceraldeído 3-fosfato + (2) Sedo-heptulose 7-fosfato
+

Gliceraldeído 3-fosfato

(2) Eritrose 4-fosfato + (2) Frutose 6-fosfato

FIGURA 16.3
Via das pentoses fosfato.

des, requerem equivalentes de redução de NADPH. No Isomerização e Fosforilação são


fígado, 20-30% do CO2 produzido pode ser proveniente
da via das pentoses fosfato; o equilíbrio entre glicólise e Reações Comuns para Interconverter
via das pentoses fosfato depende das necessidades me- Carboidratos
tabólicas do órgão. Em músculo estriado de mamíferos,
que apresenta pouca síntese de ácidos graxos e esterói- Formação de alguns açúcares pode ocorrer direta-
des, todo catabolismo de G6P ocorre por glicólise e ciclo mente, começando com glicose, por reações de modi-
TCA, com nenhuma oxidação direta de glicose 6-fosfato ficações, como conversão de G6P em frutose 6-fosfato
pela via das pentoses fosfato. por fosfoglucose isomerase, na glicólise. Uma isomeri-
zação aldose-cetose semelhante, catalisada por fos-

|
fomanose isomerase, produz manose 6-fosfato. De-
16.3 INTERCONVERSÕES ficiência dessa enzima leva a uma forma de síndrome
DE AÇÚCARES E FOR- de glicoproteínas deficientes em carboidratos (CDGS,
carbohydrate-deficient glycoprotein syndrome) (ver
MAÇÃO DE NUCLEO- Corr. Clín. 16.3).
TÍDEO-AÇÚCAR Fosforilação e transferência interna de um grupo
fosfato na mesma molécula de açúcar são também mo-
dificações comuns. Glicose 1-fosfato, resultante da gli-
A maioria dos monossacarídeos encontrados em com- cogenólise, é convertida em G6P pela fosfoglucomutase.
postos biológicos deriva da glicose. As transformações Galactose é fosforilada a galactose 1-fosfato por galac-
dos açúcares mais comuns em sistemas de mamíferos toquinase, e manose a manose 6-fosfato por manoqui-
são resumidas na Figura 16.4. nase. Frutose livre, um importante constituinte da die-
ta, é fosforilada no fígado a frutose 1-fosfato, por uma
frutoquinase especial. Entretanto, nenhuma mutase in-
terconverte frutose 1-fosfato e frutose 6-fosfato, nem a
fosfofrutoquinase pode sintetizar frutose 1,6-bisfosfato
a partir de frutose 1-fosfato. Em vez disso, frutose 1-fos-

BioQ.16 631 22.01.07 18:09:30


638 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

redutora de um açúcar aceptor. Uma glicosiltransferase Mais de 40 tipos de ligações glicosídicas foram iden-
é específica para o açúcar aceptor, o açúcar transferido tificados em oligossacarídeos de mamíferos, e cerca
e a ligação formada. Uma reação de glicosiltransferase de 15 mais em glicosaminoglicanos. A multiplicidade
é resumida como se segue: de ligações surge da diversidade de monossacarídeos
envolvidos e da formação de ligações α e β com cada
Nucleosídeo- um dos grupos hidroxila disponíveis no açúcar aceptor.
glicosiltransferase
 glicosil1 −
difosfato- + glicose    Isso sugere que oligossacarídeos tenham o potencial
glicose (aceptor) O − glicose2 −
(glicosídeo) para grande conteúdo informacional. De fato, sabe-se
(doador)
que a bioatividade de muitas moléculas é determinada
+ nucleosídeo difosfato pela natureza dos resíduos de açúcares constituintes.
Por exemplo, a especificidade antigênica dos principais
tipos sangüíneos é determinada pela composição em
açúcares (ver Corr. Clín. 16.8).
N-acetilgalactosamina é o imunodeterminante do
CORRELAÇÃO CLÍNICA 16.8 sangue tipo A, e galactose, do sangue tipo B. Remoção
de N-acetilgalactosamina de eritrócitos do tipo A, ou
Substâncias dos Grupos de galactose de eritrócitos do tipo B, converte ambos
Sangüíneos em eritrócitos do tipo O. Cada vez mais, outros exem-
plos de açúcares como determinantes de especifici-
A superfície dos eritrócitos humanos é coberta dade de receptores de superfície celular e interações
por um complexo mosaico de determinantes an- com lectinas, do direcionamento de células para cer-
tigênicos específicos, muitos dos quais são polis- tos tecidos e da sobrevivência ou remoção da circula-
sacarídeos complexos. Há cerca de 100 determi- ção de certas moléculas, têm sido reconhecidos. Todas
nantes de grupos sangüíneos, pertencentes a 21 as ligações glicosídicas identificadas em compostos
sistemas de grupos sangüíneos independentes. biológicos são degradadas por enzimas hidrolíticas
Os mais estudados são os do sistema ABO de específicas, glicosidases. Além de serem instrumentos
grupos sangüíneos e do sistema Lewis, estreita- valiosos para a elucidação da estrutura de oligossa-
mente relacionado. Variação genética é alcançada carídeos, o interesse nessa classe de enzimas baseia-
por glicosiltransferases específicas, responsáveis se nas muitas doenças genéticas do metabolismo de
pela síntese dos determinantes heterossacarídi- carboidratos complexos que resultam de defeitos em
cos. O gene H codifica uma fucosiltransferase, glicosidases (ver Corr. Clín. 16.10 e 16.11; p. 641 e 642,
que adiciona fucose a uma galactose periférica respectivamente).
do heterossacarídeo precursor. O alelo A codifica
uma N-acetilgalactosamina glicosiltransferase,
o alelo B codifica uma galactosiltransferase, e o
16.5 | GLICOPROTEÍNAS
alelo O codifica uma proteína inativa. Os açúca-
res transferidos pelas enzimas A e B são adicio- Glicoproteínas foram definidas como proteínas conjuga-
nados ao oligossacarídeo H-específico. O gene das, que contêm um ou mais açúcares, sem uma unida-
Lewis (Le) codifica outra fucosiltransferase, de repetitiva serial, e são ligados covalentemente a uma
que adiciona fucose a um resíduo periférico de proteína. Esta definição exclui os proteoglicanos (ver
N-acetilglucosamina do precursor. Ausência do p. 652). Glicoproteínas em membranas celulares podem
produto do gene H dá origem ao determinante ter um papel importante no comportamento de células
Lea específico, enquanto ausência de ambas as e, especialmente, em funções biológicas da membrana.
enzimas H e Le é responsável pela especificidade Glicoproteínas são constituintes do muco secretado por
Leb. Elucidação das estruturas desses oligossa- certas células epiteliais, onde medeiam lubrificação e
carídeos determinantes representa um marco na proteção de tecidos que revestem os sistemas respira-
química de carboidratos. Este conhecimento é tório, gastrointestinal e reprodutor feminino.
essencial para práticas de transfusão de sangue Muitas proteínas secretadas são glicoproteínas, e
e para propósitos legais e históricos. Por exem- estas incluem (a) hormônios como hormônio folículo-
plo, pó de tecidos contendo carboidratos com- estimulante, hormônio luteinizante e gonadotrofina
plexos foi utilizado em análises sorológicas para coriônica e (b) proteínas plasmáticas como orosomu-
estabelecer o grupo sangüíneo de Tutankhamen cóides, ceruloplasmina, plasminogênio, protrombina e
e de seus prováveis ancestrais. imunoglobulinas.

Fonte: Yamamoto, F., Clausen, I., White, T., Mark,


J. e Hakomori, S. Molecular genetic basis of the histo-
blood group ABO system. Nature 345:229, 1990.

BioQ.16 638 22.01.07 18:09:38


642 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

CORRELAÇÃO CLÍNICA 16.11 Defeitos Enzimáticos na Degradação de Glicolipídeos


Doenças de Glicolipídeos Doença Deficiência Enzimática

Um grupo de doenças genéticas humanas surge de Tay-Sachs β-Hexosaminidase A


deficiências em hidrolases, que agem predominan- de Sandhoff β-Hexosaminidases A e B
temente em substratos glicolipídicos, resultando em GM1 gangliosidose β-Galactosidase
acúmulo de produtos de glicolipídeos e gangliosíde- Sialidose Sialidase
os. Os sintomas clínicos associados a cada um dos de Fabry α-Galactosidase
glicoconjugados podem variar muito. Entretanto, de Gaucher β-Glucoceramidase
devido à preponderância de lipídeos no sistema ner-
de Krabbe β-Galactoceramidase
voso, tais doenças freqüentemente têm neurodege-
Leucodistrofia metacro- Arilsulfatase A (cerebro-
neração associada e severa deterioração mental e
mática sídeo sulfatase)
motora.

Fonte: Beutler, E. e G. Garabowski. Gaucher disease. Em: C. R. Scriver, A. R. Beaudet, W. S. Sly e D. Valle (Eds.),
The Metabolic and Molecular Bases of Inherited Disease, Vol. III, 8th ed. New York: McGraw-Hill, 2001, p. 3635.

16.6 | PROTEOGLICANOS das matrizes extracelulares e das superfícies celulares,


e participam de adesão e sinalização celular.

Esta é uma classe de macromoléculas complexas que


Hialuronato É um Copolímero de
pode conter 95% ou mais carboidratos, e lembra mais
polissacarídeo do que proteína. Para distingui-los de N-Acetilglucosamina e Ácido Glucurônico
outras glicoproteínas, eles são chamados proteoglica- Hialuronato difere dos outros tipos de glicosaminogli-
nos. Suas cadeias de carboidratos são chamadas glico- canos. É não-sulfatado, não é ligado covalentemente a
saminoglicanos ou mucopolissacarídeos, especialmente proteína, e não está limitado a tecidos animais, sendo
em referência às doenças de acúmulo mucopolissacari- também produzido por bactérias. É classificado como
doses, que resultam de uma incapacidade de degradar glicosaminoglicano devido a sua similaridade estru-
essas moléculas (ver Corr. Clín. 16.13). tural com esses polímeros, e consiste exclusivamente
de unidades dissacarídicas repetitivas de N-acetilglu-
Existem Seis Classes de cosamina e ácido glucurônico (Figura 16.12). Embora
Proteoglicanos tenha a estrutura química menos complexa dos glicosa-
minoglicanos, as cadeias podem alcançar 105 -107 Da. A
Proteoglicanos consistem de muitas cadeias de glico- alta massa, o caráter polieletrolítico e o grande volume
saminoglicanos diferentes, ligadas covalentemente a que ocupa em solução contribuem para as propriedades
um esqueleto protéico. Seis classes são reconhecidas: do hialuronato como um lubrificante e absorvente de
condroitim sulfato, dermatam sulfato, queratam sul- choques. É encontrado predominantemente em líquido
fato, heparam sulfato, heparina e hialuronato. Certas sinovial, humor vítreo e cordão umbilical.
características são comuns a todas as diferentes clas-
ses de glicosaminoglicanos. As longas cadeias hetero- Condroitim Sulfatos São os
polissacarídicas não-ramificadas são compostas, em
Glicosaminoglicanos Mais Abundantes
grande parte, por unidades dissacarídicas repetitivas,
consistindo de uma hexosamina e um ácido urônico. Os glicosaminoglicanos mais abundantes do corpo, os
Constituintes comuns dos glicosaminoglicanos são condroitim sulfatos, são ligados a resíduos específicos
grupos sulfatos, ligados por ligações éster a certos mo- de serina em um esqueleto protéico por meio de uma
nossacarídeos, ou por ligações amida ao grupo amino região de ligação tetrassacarídica:
de glucosamina. Só hialuronato não é sulfatado e não
é covalentemente ligado a proteína. As carboxilas dos GluUA Gal Gla Xyl �-Ser
1�3 1�3 1�4
ácidos urônicos e os grupos sulfatos contribuem para
a natureza fortemente carregada dos glicosaminoglica- As unidades dissacarídicas características consis-
nos. Sua carga elétrica e sua estrutura macromolecu- tem de N-acetilgalactosamina e ácido glucurônico, que
lar são importantes em seu papel como lubrificantes e são ligadas a essa região de ligação (Figura 16.12). Os
como elementos de sustentação no tecido conjuntivo. dissacarídeos podem ser sulfatados na posição 4- ou
Glicosaminoglicanos são componentes predominantes 6- da N-acetilgalactosamina. Cada cadeia contém 30-

BioQ.16 642 22.01.07 18:09:43


650 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

17
Fígado

Ácidos graxos Glicose


��������������
Acetil-CoA
Glicerol
Corpos
cetônicos

METABOLISMO DE
LIPÍDEOS I: SÍNTESE,
ARMAZENAMENTO
E UTILIZAÇÃO DE
ÁCIDOS GRAXOS E
TRIACILGLICERÓIS
Martin D. Snider, J. Denis McGarry e
Richard W. Hanson

17.1 VISÃO GERAL, 651 prometimento na síntese de ácidos graxos,


658
17.2 NATUREZA QUÍMICA DE ÁCIDOS GRAXOS E Seqüência de reações para a síntese de ácido
ACILGLICERÓIS, 652 palmítico, 658
Ácidos graxos são cadeias alquila terminando em Ácido graxo sintase de mamíferos é um poli-
um grupo carboxila, 652 peptídeo multifuncional, 659
A maioria dos ácidos graxos no homem ocorre Estequiometria da síntese de ácidos graxos,
como triacilgliceróis, 653 659
A hidrofobicidade dos triacilgliceróis é importan- Via de clivagem de citrato fornece acetil-CoA e
te para suas funções, 653 NADPH para lipogênese no citosol, 660
Modificação de ácidos graxos, 662
17.3 TRANSPORTE INTERÓRGÃOS DE ÁCIDOS Reações de elongação, 662
GRAXOS E SEUS PRODUTOS PRIMÁRIOS, 656 Formação de ácidos monoenóicos pela estea-
Transporte de lipídeos no estado alimentado, 656 roil-CoA dessaturase, 662
Transporte de lipídeos no estado de jejum, 657 Formação e modificação de ácidos graxos
poliinsaturados, 663
17.4 SÍNTESE DE ÁCIDOS GRAXOS: LIPOGÊNESE, Formação de hidroxiácidos graxos no tecido
657 nervoso, 664
Glicose é o principal precursor para síntese de Ácido graxo sintase pode produzir outros ácidos
ácidos graxos, 657 graxos além do palmitato, 664
Via de biossíntese de ácidos graxos, 658 Acil graxo-CoAs podem ser reduzidos a álcoois
Formação de malonil-CoA é a etapa de com- graxos, 664

BioQ.17 650 22.01.07 18:11:45


656 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

|
17.3 TRANSPORTE INTER- Transporte de Lipídeos no Estado
ÓRGÃOS DE ÁCIDOS Alimentado
GRAXOS E SEUS PRO- Triacilgliceróis da dieta são digeridos no estômago e
intestino delgado por lípases gástrica e pancreática
DUTOS PRIMÁRIOS (ver p. 1031). Os principais produtos são 2-monoacilgli-
ceróis e ácidos graxos livres, que são absorvidos pe-
Em todos os mamíferos, o transporte e o armazenamen- las células epiteliais que revestem o intestino delgado.
to de ácidos graxos são regulados pelo estado dietético. Estas células ligam os ácidos graxos e monoacilglice-
Triacilglicerol é armazenado no estado alimentado, róis absorvidos em triacilgliceróis (ver p. 1031), que são
com deposição em tecido adiposo. Durante jejum, tria- então empacotados em quilomícrons, uma lipoproteí-
cilglicerol do tecido adiposo é hidrolisado, e os produ- na plasmática rica em triacilglicerol (ver p. 1035). Qui-
tos são distribuídos por todo o corpo para serem usados lomícrons são secretados na linfa e, depois, circulam
para produção de energia. Em jejum prolongado (mais para a corrente sangüínea. O fígado é outra fonte de
de 2 dias), o fígado converte ácidos graxos em corpos triacilgliceróis no estado alimentado. Ácidos graxos são
cetônicos, acetoacetato e β-hidroxibutirato, que sintetizados nesse tecido a partir do excesso de carboi-
são liberados no sangue e são uma fonte importante de dratos e aminoácidos. Esses ácidos graxos são ligados
energia para muitos tecidos. Esses processos são resu- em triacilgliceróis e acondicionados em lipoproteínas
midos na Figura 17.6 de muito baixa densidade (VLDL), uma segunda li-

��� Estado alimentado Glicose e FIGURA 17.6


Fígado outros combustíveis Transporte interórgãos de ácidos graxos.
(A) No estado alimentado, há deposição de
Acetil-CoA
triacilglicerol no tecido adiposo. As fontes são
Intestino delgado Ácidos graxos gordura da dieta e ácidos graxos sintetizados
no fígado a partir de excesso de carboidratos e
Triacilglicerol aminoácidos. (B) No estado de jejum, triacilgliceróis
Triacilglicerol da dieta
são hidrolisados, e ácidos graxos livres e glicerol são
liberados no sangue.
Quilomícrons Lipoproteínas de *Durante jejum prolongado, o fígado sintetiza
densidade muito baixa corpos cetônicos, que se tornam um importante
Triacilglicerol em quilomícrons combustível no sangue.
Corrente sangüínea
e lipoproteínas de densidade muito baixa

Ácidos graxos
Ácidos graxos
�����������������������
����������� Triacilglicero l

Músculo
Tecido adiposo

��� Estado de jejum


Cérebro Fígado

Ácido graxo Glicose


Corpos cetônicos
������������ ��������������
����������� Acetil-CoA
Acetil-CoA Glicerol
����������� Corpos
��������������������
������������������ cetônicos

Corpos Ácidos graxos =


Corrente sangüínea Glicerol
ceetônicos albumina

Glicerol
+
Ácidos graxos
Ácidos graxos (+ corpos cetô-
nicos) ����������������������
����������� Triacilglicerol
Músculo e
outros tecidos Tecido adiposo

BioQ.17 656 22.01.07 18:11:51


668 | PARTE 4 VIA METABÓLICAS E SEU CONTROLE

CORRELAÇÃO CLÍNICA 17.3


Ciclo Triacilglicerol/Ácido Graxo
Triacilglicerol que é armazenado no tecido adiposo (PEPCK), que tem alta atividade em tecido adiposo
é hidrolisado a ácidos graxos livres (FFA) durante pardo e branco. Se a expressão do gene PEPCK for
jejum para fornecer energia para tecidos como os abolida no tecido adiposo de camundongos, glicero-
músculos esquelético e cardíaco, e também indire- neogênese é inibida e o estoque de triacilglicerol é
tamente para o cérebro, via corpos cetônicos. Hor- reduzido. Ao contrário, superprodução do gene PEP-
mônios, principalmente insulina, controlam este CK no tecido adiposo de camundongos transgênicos
processo. À medida que o nível de insulina cai du- aumenta a taxa de gliceroneogênese, resultando em
rante o jejum, a taxa de hidrólise de triacilglicerol obesidade.
(lipólise) aumenta, resultando em liberação de FFA A lógica metabólica do ciclo triacilglicerol/ácido
do tecido adiposo. Um aspecto surpreendente deste graxo reside provavelmente na importância dos áci-
processo é o destino de FFA; em seres humanos em dos graxos como combustíveis durante jejum. Para
jejum, até 65% destes FFA são reesterificados em garantir que exista FFA suficiente no sangue, mais
triacilgliceróis no fígado e em outros tecidos peri- FFA é liberado de células adiposas do que o necessá-
féricos. No fígado, aproximadamente 60% do FFA rio; o que não é usado é reesterificado a triacilglice-
captado é reesterificado em triacilglicerol, liberado rol e redepositado no tecido adiposo, com um custo
no sangue como VLDL, e enviado de volta para o energético mínimo. O ciclo triacilglicerol/ácido graxo
tecido adiposo para deposição como triacilglicerol. consome 3-6% da energia em uma molécula de tria-
Este processo foi chamado ciclo triacilglicerol/ácido cilglicerol. Aparentemente, é melhor ter o combustí-
graxo. vel necessário disponível, e pagar por isso energeti-
A síntese de triacilglicerol em tecidos de ma- camente, do que ficar sem! A taxa de reesterificação
míferos requer glicerol 3-fosfato, que é derivado da de FFA no ciclo triacilglicerol/ácido graxo é, muito
glicose da dieta via glicólise, no estado alimentado. provavelmente, um fator-chave na determinação da
Durante jejum, quando insulina baixa inibe a uti- concentração de estado estacionário de FFA no san-
lização de glicose, o glicerol 3-fosfato para a rees- gue, um parâmetro que está diretamente envolvido
terificação de FFA é gerado por gliceroneogênese, na etiologia do diabetes Tipo 2. As glitazonas, uma
uma versão abreviada da gluconeogênese. Nesta via, classe de drogas antidiabéticas, induzem a atividade
piruvato, ou compostos que podem gerar piruvato, de PEPCK em tecido adiposo e fígado, e aumentam
como alanina ou lactato, é convertido em glicerol 3- a taxa de reesterificação de FFA em triacilglicerol
fosfato via di-hidroxiacetona fosfato (Figura 17.19). via gliceroneogênese nesses tecidos, suportando o
A enzima que controla a velocidade da via de gli- importante papel deste processo na manutenção da
ceroneogênese é fosfoenolpiruvato carboxiquinase homeostase lipídica.

Fonte: Reshef, L. Olswang, Y. Cassuto, H. Blum, B. Croniger, C. M. Kalhan S. C, Tilghman, S. M. e Hanson R. W.


Glyceroneogenesis and the triglyceride/fatty acid cycle. J. Biol. Chem. 278:30413, 2003. Jensen, M. D., Ekberg, K.
e Landau, B. R. Lipid metabolism during fasting. Am. J. Physiol. Endocrinol. Metab. 281:E789 2001. Tordjman, J.
Khazan, W. Antoine, B. Chauvet, G. Quette, J Fouque, F. Beale, E. G. Benelli, C. e Forest, C. Regulation of glycero-
neogenesis and phosphoenolpyruvate carboxykinase by fatty acids, retinoic acid and thiazolidinediones. Biochimie
85:1213, 2003.

repouso. A maioria dos tecidos pode usar ácidos graxos -Oxidação de Ácidos Graxos de
como combustível. Ácidos graxos são uma importante
fonte de energia em músculos esquelético e cardíaco, Cadeia Linear É um Importante
mas o cérebro oxida pouco os ácidos graxos devido ao Processo de Produção de Energia
transporte limitado através da barreira hemato-encefá-
lica. Eritrócitos são incapazes de oxidar ácidos graxos, Ésteres de CoA dos ácidos graxos são os substratos para
porque não têm mitocôndrias, o local de oxidação de oxidação. Na maior parte, a via de oxidação de ácidos
ácidos graxos. Durante jejum prolongado, o fígado con- graxos é semelhante, mas não idêntica, ao reverso do
verte acetil-CoA gerado por oxidação de ácidos graxos processo de síntese de palmitato. Isto é, fragmentos de
e quebra de aminoácidos em corpos cetônicos, que se dois carbonos são removidos seqüencialmente a partir
tornam importantes combustíveis. A maioria dos teci- da extremidade carboxila do ácido graxo por desidro-
dos, incluindo o cérebro, adapta-se ao jejum pela utili- genação, hidratação e oxidação, para formar um β-
zação destes corpos cetônicos. cetoácido, que é então quebrado por tiólise.

BioQ.17 668 22.01.07 18:12:07


CAPÍTULO 17 METABOLISMO DE LIPÍDEOS I: | 679

|
17.7 REGULAÇÃO DO um aumento em epinefrina e glucagon, que elevam o
nível de cAMP e ativam proteína quinase A. No tecido
METABOLISMO DE adiposo, há uma fosforilação aumentada de lipase hor-
LIPÍDEOS mônio sensível e perilipina, resultando em um aumento
na quebra de triacilglicerol e liberação de ácidos gra-
xos livres e glicerol deste tecido (ver Tabela 17.2, p. 657,
Regulação no estado alimentado para um resumo destes controles).
No fígado, essas alterações hormonais levam a uma
O metabolismo de lipídeos no homem é controlado pelo diminuição na síntese de ácidos graxos, devido à redu-
estado dietético do indivíduo via um conjunto complexo ção nos níveis de enzimas chaves (ver Tabela 17.3, p.
de sinais hormonais. Depois de uma refeição que con- 661). Há também inibição da enzima limitante da ve-
tém lipídeos, carboidratos e proteínas, o lipídeo da die- locidade, acetil-CoA carboxilase, devido à fosforila-
ta é depositado como triacilglicerol no tecido adiposo. ção cAMP-dependente da enzima. Glicólise é também
Além disso, carboidrato e aminoácidos da dieta, em ex- inibida, com diminuição no suprimento de acetil-CoA
cesso em relação ao necessário para energia ou síntese para lipogênese. O fígado começa a produzir corpos ce-
de proteínas, são convertidos em ácidos graxos e depo- tônicos, à medida que o jejum progride, devido a um
sitados no tecido adiposo como triacilglicerol. O prin- aumento na taxa de oxidação de ácidos graxos e níveis
cipal hormônio anabólico, insulina, é necessário para aumentados de enzimas da síntese de corpos cetônicos.
síntese de ácidos graxos e para formação de triacilgli- Durante jejum prolongado, cerca de metade dos ácidos
cerol no tecido adiposo. Um resumo destas regulações é graxos que entram no fígado são convertidos em corpos
apresentado nas Tabelas 17.2, p. 657, e 17.3, p. 661. Este cetônicos e liberados no sangue para utilização por te-
hormônio age em dois níveis; induz a transcrição de ge- cidos como músculo, coração e (após 2 dias de jejum) o
nes que codificam enzimas críticas das vias de síntese e cérebro, economizando assim o uso de glicose.
armazenamento de lipídeos (regulação de longo prazo)
e controla processos como captação de glicose e hidró-
lise de triacilglicerol (regulação de curto prazo). Regulação da oxidação de ácidos
Insulina estimula síntese de ácidos graxos por au- graxos
mentar os níveis de enzimas-chaves, incluindo ácido
graxo sintase, NADP-malato desidrogenase (enzima A taxa de oxidação de ácidos graxos em mitocôndrias
málica) e acetil-CoA carboxilase, no fígado, por induzir é controlada pela regulação da entrada de substratos
a transcrição de seus genes. Insulina também estimula a nestas organelas. A enzima-chave é carnitina palmi-
síntese de glicose 6-fosfato desidrogenase e 6-fosfoglu- toiltransferase I (CPT I), que sintetiza acilcarnitina a
conato desidrogenase, as duas enzimas da porção oxi- partir de acil-CoA citosólico (Figura 17.20). No fígado,
dativa da via das pentoses, que geram parte do NADPH acetil-CoA carboxilase é ativada no estado alimenta-
que é necessário para síntese de ácidos graxos. O efeito do, porque os níveis de enzima são altos, fosforilação
de curto prazo da insulina na síntese hepática de ácidos cAMP-dependente é baixa e a enzima é ativada por ci-
graxos é exercido por ativação de uma fosfoproteína trato. A alta concentração de malonil-CoA resultante
fosfatase específica, que remove fosfato da acetil-CoA estimula síntese de ácidos graxos, mas bloqueia oxida-
carboxilase, ativando assim esta enzima. Fluxo aumen- ção de ácidos graxos por inibir CPT I. Esta regulação
tado pela glicólise é também importante para fornecer impede um ciclo fútil. Ao contrário, no estado de jejum,
acetil-CoA para síntese de ácidos graxos. a atividade de acetil-CoA carboxilase no fígado é baixa,
No tecido adiposo, insulina é necessária no estado porque os níveis de enzima são baixos, a enzima está
alimentado para captação de glicose via transportador fosforilada e oxidação de ácidos graxos ocorre em alta
GLUT 4. O metabolismo desta glicose via glicólise for- velocidade nessas condições, devido aos baixos níveis
nece glicerol 3-fosfato para a síntese de triacilglicerol. de malonil-CoA.
Insulina também bloqueia um ciclo fútil. Como no fíga- Oxidação de ácidos graxos em músculo é também
do, insulina exerce seus efeitos de curto prazo por ati- regulada por malonil-CoA, embora este tecido não sin-
var fosfoproteína fosfatases. Isso diminui a fosforilação tetize ácidos graxos. Músculo contém uma isoenzima da
de proteínas-chaves, incluindo lipase hormônio-sensí- acetil-CoA carboxilase, que produz malonil-CoA exclu-
vel e perilipina, levando à quebra diminuída de triacil- sivamente para regulação de CPT I. A enzima é ativada
gliceróis. por citrato e inibida por fosforilação. É fosforilada pela
proteína quinase A e por uma quinase dependente de
Regulação no estado de jejum AMP. Fosforilação pela primeira enzima permite que
a oxidação de ácidos graxos seja regulada pelo estado
Jejum resulta em uma alteração dramática do meta- dietético. No estado alimentado, a alta concentração de
bolismo de lipídeos. À medida que a concentração de insulina resulta em baixos níveis de fosforilação. A en-
glicose no sangue diminui, há um decréscimo paralelo zima produz malonil-CoA, que inibe CPT I e bloqueia
da concentração de insulina na circulação. Há também oxidação de ácidos graxos. Ao contrário, no estado de

BioQ.17 679 22.01.07 18:12:19


684 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

18.5 PROSTAGLANDINAS E TROMBOXANES, 714 Leucotrienos e ácidos hidroxieicosatetraenóicos


Prostaglandinas e tromboxanes são derivados de são hormônios derivados de HPETEs, 719
ácidos monocarboxílicos, 714 Leucotrienos e HETEs afetam vários processos
Síntese de prostaglandinas envolve uma ciclooxi- fisiológicos, 719
genase, 715
Produção de prostaglandinas é inibida por BIBLIOGRAFIA, 721
agentes antiinflamatórios esteroídicos e
não-esteroídicos, 717 QUESTÕES E RESPOSTAS, 722
Prostaglandinas têm muitos efeitos fisiológicos
718 CORRELAÇÕES CLÍNICAS
18.1 Síndrome do Desconforto Respiratório, 687
18.6 LIPOXIGENASE E ÁCIDOS OXIEICOSATETRAE- 18.2 Tratamento da Hipercolesterolemia, 703
NÓICOS, 718 18.3 Aterosclerose, 704
Ácidos mono-hidroperoxieicosatetraenóicos são 18.4 Diagnóstico da Doença de Gaucher em um
produtos da ação da lipoxigenase, 718 Adulto, 713

18.1 | VISÃO GERAL de hormônios farmacologicamente potentes derivados


do ácido araquidônico – a saber, prostaglandinas e leu-
cotrienos – serão discutidos. Ver o Apêndice para uma
discussão sobre nomenclatura e química dos lipídeos.
Lipídeo é um termo geral que descreve substâncias que
são relativamente insolúveis em água e que podem ser
extraídas por solventes apolares. Lipídeos complexos 18.2 | FOSFOLIPÍDEOS
do homem estão classificados em duas categorias am-
plas: lipídeos não-polares, tais como triacilgliceróis e
Duas classes principais de acilglicerolipídeos são
ésteres de colesterol, e lipídeos polares, que são anfipá-
triacilgliceróis e glicerofosfolipídeos, que têm em
ticos pois contêm tanto uma região hidrofóbica, como
seu núcleo o poliol C3 glicerol. Os dois grupos álcool pri-
uma região hidrofílica na mesma molécula. Este capí-
mário do glicerol não são estereoquimicamente idên-
tulo discute lipídeos polares, incluindo fosfolipídeos,
ticos; no caso de fosfolipídeos, geralmente é o mesmo
esfingolipídeos e eicosanóides. As regiões hidrofóbicas
grupo hidroxila que é esterificado ao resíduo de fosfato.
e hidrofílicas são unidas por um resíduo de glicerol
O sistema de numeração esteroespecífica é a melhor
em glicerofosfolipídeos, e por esfingosina em esfingo-
maneira de designar diferentes grupos hidroxila. Neste
mielina e glicoesfingolipídeos. Triacilglicerol está con-
sistema, quando a estrutura do glicerol é desenhada na
finado, em grande parte, a locais de armazenamento
projeção de Fischer, com o grupo hidroxila C2 projetan-
no tecido adiposo, enquanto lipídeos polares ocorrem
do-se para a esquerda da página, os átomos de carbono
primariamente em membranas celulares. Membranas
são numerados como mostra a Figura 18.1. Quando o
geralmente contêm 40% do seu peso seco como lipí-
sistema de numeração estéreo-específica (sn) é uti-
deo, e 60% como proteína.
lizado, o prefixo sn- é usado antes do nome do compos-
Reconhecimento célula-célula, fagocitose, inibição
to. Glicerofosfolipídeos geralmente contêm um resíduo
por contato e rejeição de tecidos e órgãos transplanta-
de sn-glicerol 3-fosfato. Embora ambos contenham o
dos são todos fenômenos de importância médica, que
resíduo de glicerol como um elemento estrutural fun-
envolvem sítios de reconhecimento muito específicos
damental, triacilgliceróis neutros e fosfolipídeos iônicos
na superfície das membranas plasmáticas. Glicoes-
carregados têm propriedades físicas e funções muito
fingolipídeos parecem desempenhar um papel nestes
diferentes.
eventos biológicos. Sua síntese será descrita. Vários
esfingolipídeos acumulam-se no fígado, no baço, no
rim e no sistema nervoso em certas doenças genéti-
cas chamadas esfingolipidoses. Glicolipídeos merecem
estudo, porque os determinantes antigênicos dos gru-
pos sangüíneos ABO são primariamente de natureza
Número
glicolipídica. do carbono
A via de biossíntese de colesterol e sua regulação, CH2OH 1
como colesterol funciona como um precursor de sais HO C H 2
biliares e hormônios esteróides, e o papel da lipopro-
CH2OH 3
teína de alta densidade (HDL, high density lipopro-
tein) e da lecitina:colesterol aciltransferase (LCAT) no
gerenciamento do colesterol plasmático são descritos. FIGURA 18.1
Finalmente, o metabolismo e a função de duas classes Numeração estéreo-específica do glicerol.

BioQ.18 684 22.01.07 19:25:50


694 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

O O

R1C CoA H2C O CR1 R2OH


H2COH C O O 2

C O O CoA H2C O P O–
H2C OR2
1
H2C O P O– O– R1CO–
C O O
O– O
H 2C O P O–
DHAP O–

O H2C OR2 NADPH + H+


3
R3C O CH O
+ NADP+
H2C O P OCH2CH2 N(CH3)3

O– H2C OR2
6 CMP
Colina plasmalogênio HOCH O

H 2C O P O–
CDP-colina O–
O H2C OR2 4 O
R3C O CH 5 R3C CoA
O H C OR2
H2C OH 2
CoA
R3C CH O
Pi H2O
H 2C O P O–

O–

FIGURA 18.25
Via de biossíntese de colina plasmalogênio a partir de DHAP.
1, acil-CoA:di-hidroxiacetona fosfato aciltransferase; 2, alquil-di-hidroxiacetona fosfato sintase; 3, NADPH:alquil-di-hidroxiacetona
fosfato óxi-redutase; 4, acil-CoA:1-alquil-2-liso-sn-glicero-3-fosfato aciltransferase; 5, 1-alquil-2-acil-sn-glicerol-3-fosfato fosfo-
hidrolase; 6, CDP-colina:1-alquil-2-acil-sn-glicerol colina fosfotransferase.

18.3 | COLESTEROL (não-esterificado); o restante é colesteril ésteres, nos


quais um ácido graxo de cadeia longa, geralmente ácido
linoléico, é esterificado ao C3 do anel A. Este resíduo
Colesterol, um Composto Alicíclico, É de ácido graxo aumenta a hidrofobicidade do colesterol
(Figura 18.28).
Amplamente Distribuído nas Formas
Livre e Esterificada 12
13
17
11 16

Colesterol é um composto alicíclico, cuja estrutura in- C D


1 9
clui (1) o núcleo peridrociclopentanofenantreno 2 10 14 15
8
com seus quatro anéis fundidos, (2) um único grupo A B
hidroxila em C3, (3) um centro insaturado entre C5 e 3 5 7
C6, (4) uma cadeia hidrocarbônica ramificada de oito 4 6

membros ligada ao anel D em C17 e (5) um grupo metil


FIGURA 18.26
(designado por C19) ligado à posição C10, e outro grupo O anel ciclopentanofenantreno.
metil (designado por C18) ligado à posição C13 (Figu-
ras 18.26 e 18.27).
21 22 24 26
Colesterol tem solubilidade muito baixa em água; a 20 25
25oC, o limite de solubilidade é aproximadamente 0,2 17
23
18 27
mg dL -1, ou 4,7 mM. A concentração real de colesterol
no plasma de uma pessoa sadia é geralmente 150 a 200
mg dL -1. Este valor é quase duas vezes a concentração 19

normal de glicose no sangue. Esta alta concentração de


3
colesterol no sangue é possível graças às lipoproteínas
HO
plasmáticas (principalmente LDL e VLDL), que contêm
grandes quantidades de colesterol (ver p. 698). Apenas FIGURA 18.27
cerca de 30% do total de colesterol no plasma está livre Estrutura do colesterol (5-colesteno-3-ol).

BioQ.18 694 22.01.07 19:26:07


704 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

Em tecidos especializados, como córtex adrenal e ácidos biliares são derivados de ácido colânico (Figu-
ovários, o colesterol derivado de LDL é o precursor de ra 18.41). Ácido cólico e ácido quenodesoxicólico
hormônios esteróides, como cortisol e estradiol, res- (Figura 18.42) são compostos C24, contendo três e dois
pectivamente. No fígado, o colesterol extraído de LDL grupos OH, respectivamente, e uma cadeia lateral C5
e HDL é convertido em sais biliares, que funcionam na que termina em um grupo carboxila, que é ionizado a
digestão intestinal de gordura. pH 7,0 (daí o nome sal biliar). O grupo carboxila é fre-
qüentemente conjugado, por uma ligação amida, com
Colesterol É Excretado glicina (NH2-CH2-COOH) (Figura 18.43) ou taurina
(NH2-CH2-CH2-SO3H), para formar ácido glicocólico ou
Primariamente como Ácidos Biliares taurocólico, respectivamente.
Os ácidos biliares primários são modificados por
Ácidos biliares são os produtos finais do metabolismo
microorganismos dos intestinos para ácidos biliares
de colesterol. Ácidos biliares primários são sintetizados
secundários: ácido desoxicólico e ácido litocólico são
em hepatócitos, diretamente a partir de colesterol. Os
derivados do ácido cólico e do ácido quenodesoxicólico,
respectivamente, por remoção de um grupo OH (Figura
18.42). Transformação de colesterol em ácidos biliares
requer: (1) epimerização do grupo 3β-OH, (2) redução
CORRELAÇÃO CLÍNICA 18.3 da dupla ligação C5, (3) introdução de grupos OH em
Aterosclerose C7 (ácido quenodesoxicólico) ou em C7 e C12 (ácido
cólico), e (4) conversão da cadeia lateral C27 em um
Aterosclerose é a principal causa de morte em ácido carboxílico C24 por eliminação de um equivalen-
países ocidentais industrializados. O risco de te propil.
desenvolvê-la é diretamente relacionado com a Ácidos biliares são secretados na bile, armazenados
concentração plasmática de LDL-colesterol e in- na vesícula biliar e depois secretados no intestino del-
versamente proporcional ao nível de HDL-coles- gado. Produção hepática de ácidos biliares é insuficien-
terol. Isso explica por que o primeiro é freqüen- te para atender as necessidades fisiológicas, de modo
temente chamado colesterol “ruim”, e o último, que o corpo depende de uma circulação êntero-hepáti-
colesterol “bom”, embora quimicamente não exis- ca, que carrega os ácidos biliares do intestino, de volta
ta diferença. Na aterosclerose, a parede arterial para o fígado, várias vezes por dia.
contém colesteril-ésteres acumulados em células Ácidos biliares e fosfolipídeos solubilizam colesterol
derivadas da linhagem monócito-macrófago, há na bile e, assim, impedem que colesterol se precipite na
também proliferação de células musculares lisas vesícula biliar. Ácidos biliares no intestino atuam como
e fibrose. A anomalia mais precoce é migração agentes emulsificantes para triacilgliceróis da dieta, fa-
de monócitos do sangue para o subendotélio da cilitando sua hidrólise pela lipase pancreática. Ácidos
artéria. Estas células então se diferenciam em biliares desempenham um papel direto na ativação da
macrófagos e acumulam colesteril-ésteres deri- lipase pancreática (ver p. 1031) e facilitam a absorção
vados de LDL plasmática. Parte da LDL pode ser de vitaminas lipossolúveis, particularmente vitamina
captada por vias que não requerem receptor de D, no intestino.
LDL. Por exemplo, existem receptores que cap-
tam LDL acetilada ou LDL complexada com dex-
tran sulfato; entretanto, esta via não é regulada
por conteúdo celular de colesterol. Distorção do
subendotélio leva à agregação plaquetária na su-
perfície do endotélio e liberação de mitógenos
derivados de plaquetas, como o fator de cresci-
mento derivado de plaquetas (PDGF, platelet de- 21
H3C 22
rived growth factor), que estimula o crescimen- 23
to de células musculares lisas. Morte das células 18
20

esponjosas leva à deposição do lipídeo celular e CH3 COOH


12 17 24
fibrose. A placa aterosclerótica resultante estrei- 11 13 16
19
ta o vaso sangüíneo e leva à formação de trombo, CH2 14 15
1 9
o que precipita o infarto do miocárdio (ataque 2 10 8
cardíaco).
3 5 7
4 6
H

Fonte: Wick, G, Knoflach, M. e Xu, Q. B. Autoimmu-


ne and inflammatory mechanisms in atherosclerosis. FIGURA 18.41
Annu. Rev. Immunol. 22:361,~2004. Estrutura do ácido colânico.

BioQ.18 704 22.01.07 19:26:18


718 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

|
Prostaglandinas Têm Muitos Efeitos 18.6 LIPOXIGENASE E ÁCI-
Fisiológicos DOS OXIEICOSATE-
Prostaglandinas são mediadores naturais da inflama- TRAENÓICOS
ção. Reações inflamatórias freqüentemente envolvem
as articulações (p. ex., artrite reumatóide), pele (p.
ex., psoríase) e olhos, e são tratadas, freqüentemen- Ciclooxigenase direciona ácidos graxos poliinsaturados
te, com corticosteróides que inibem síntese de prosta- para a via das prostaglandinas que tem ácido araquidô-
glandinas. Administração de PGE2 e PGE1 induz rubor nico como substrato. Lipoxigenase é uma dioxigenase
e calor (devido à vasodilatação arteriolar), juntamente que também atua sobre ácido araquidônico. Diferentes
com inchaço e edema resultantes de permeabilidade lipoxigenases são específicas para a dupla ligação do
capilar aumentada característica da inflamação. PGE2 ácido araquidônico, na qual o ataque inicial do oxigê-
gerada no sistema imune (p. ex., macrófagos, mastó- nio ocorre (p. ex., posições 5, 12 ou 15). No homem,
citos, células B) evoca quimiotaxia de células T. PGE2 os leucotrienos mais importantes são os produtos da 5-
em quantidades que não causam dor, antes da admi- lipoxigenase, que são mediadores de doenças inflama-
nistração de histamina e bradicinina, aumenta a in- tórias. Lipoxigenases ocorrem amplamente em plantas
tensidade e a duração da dor causada por esses dois e fungos, bem como em animais, mas estão ausentes
agentes. Acredita-se que pirógenos (agentes indutores em leveduras e na maioria dos procariotos. Elas contêm
de febre) ativem a via de síntese de prostaglandinas ferro não-hemínico e são ativas quando este ferro está
com liberação de PGE2 no hipotálamo, onde a tempe- no estado férrico.
ratura do corpo é regulada. Aspirina, uma droga anti-
pirética, inibe a ciclooxigenase. PGE2 e PGF2 têm sido Ácidos Mono-Hidroperoxieicosate-
utilizadas para induzir parto e para terminar gravidez
não-desejada, especificamente no segundo trimestre.
traenóicos São Produtos da Ação da
Também há evidências de que as prostaglandinas da Lipoxigenase
série PGE possam ser efetivas no tratamento da infer-
tilidade masculina. Lipoxigenase adiciona um grupo hidroperóxido ao áci-
Prostaglandinas sintéticas são muito eficientes do araquidônico para produzir ácidos mono-hidrope-
na inibição de secreção ácida gástrica em pacien- roxieicosatetraenóicos (HPETEs) (Figura 18.71).
tes com úlcera péptica. Parecem inibir a formação Em contraste com a ciclooxigenase da prostaglandina
de cAMP em células da mucosa gástrica e acelerar a endoperóxido sintase, que catalisa a bis-dioxigenação
cicatrização de úlceras gástricas. PGE, PGA e PGI 2 de ácidos graxos insaturados a endoperóxidos, lipoxi-
são vasodilatadores que baixam a pressão arterial sis- genases catalisam a monodioxigenação de ácidos gra-
têmica, aumentando assim o fluxo sangüíneo local e xos insaturados a hidroperóxidos alílicos. Substituição
diminuindo a resistência periférica. TXA 2 causa con- hidroperoxi de ácido araquidônico por lipoxigenases
tração da musculatura vascular lisa e do mesângio pode ocorrer nas posições 5, 12 ou 15. Uma 15-lipoxige-
glomerular. No feto, PGE2 mantém a desobstrução do nase (15-LOX) oxigena ácido araquidônico no carbono
ductus arteriosus antes do nascimento. Se o ductus 15. 5-HPETE é o principal produto em basófilos, leu-
permanecer aberto após o nascimento, o fechamento cócitos polimorfonucleares (PMN), macrófagos, mas-
pode ser acelerado por administração do inibidor de tócitos e qualquer órgão passando por resposta infla-
ciclooxigenase indometacina. Em bebês nascidos com matória; 12-HPETE predomina em plaquetas, células
anomalias congênitas, nos quais o defeito pode ser das ilhotas pancreáticas, musculatura lisa vascular e
corrigido cirurgicamente, infusão de prostaglandinas células glomerulares; 15-HPETE é o principal produto
manterá o fluxo sangüíneo através do ductus até que a em reticulócitos, eosinófilos, linfócitos T e células epite-
cirurgia seja feita. liais da traquéia. As 5-, 12- e 15-lipoxigenases ocorrem
PGI2 inibe agregação plaquetária, enquanto PGE2 principalmente no citosol. Como o átomo de carbono
e TXA 2 promovem esse processo de coagulação. TXA 2 oxigenado em HPETEs é assimétrico, existem dois es-
é produzido por plaquetas e é responsável por sua agre- tereoisômeros possíveis do ácido hidroperoxi, (R) ou
gação quando em contato com alguma superfície es- (S). Por exemplo, a estéreo-configuração é especifica-
tranha, colágeno ou trombina. Células endoteliais que da 12R-LOX ou 12S-LOX. Os três principais HPETEs
revestem os vasos sangüíneos liberam PGI2, que pode são da configuração (S). 5-LOX tem uma atividade de
responder pela não-aderência de plaquetas à parede do dioxigenase que converte ácido araquidônico em 5-
vaso sangüíneo sadio. PGE2 e PGD2 dilatam os vasos HPETE, e uma atividade de desidratase que transforma
sangüíneos renais e aumentam o fluxo sangüíneo pelo 5-HPETE em LTA4.
rim. Elas também regulam a excreção de sódio e o rit- A atividade 5-LOX é restrita a poucos tipos celu-
mo de filtração glomerular. lares, incluindo linfócitos B, mas não linfócitos T. É
ativada por uma proteína acessória chamada proteína
ativadora de 5-lipoxigenase (FLAP). Em leucócitos hu-

BioQ.18 718 22.01.07 19:26:40


CAPÍTULO 19 METABOLISMO DE AMINOÁCIDOS | 725

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

19
Fígado
piruvato
NH4+ glutamato

+
NH4
glutamato uréia �-cetoglutarato

glutamina

METABOLISMO DE
AMINOÁCIDOS
Marguerite W. Coomes

19.1 VISÃO GERAL, 726 Glutamato é o precursor de glutationa e γ-ami-


nobutirato, 736
19.2 INCORPORAÇÃO DE NITROGÊNIO EM AMI- Arginina é também sintetizada em intestinos e
NOÁCIDOS, 727 rins, 737
A maioria dos aminoácidos é obtida da dieta, Ornitina e prolina, 737
727 Serina e glicina, 738
Grupos amino são transferidos de um aminoáci- Tetra-hidrofolato é um cofator em algumas rea-
do para formar outro, 728 ções de aminoácidos, 741
Piridoxal fosfato é cofator de aminotransfera- Treonina, 744
ses, 729 Fenilalanina e tirosina, 744
Glutamato desidrogenase incorpora e produz Metabolismo de tirosina produz fumarato e
amônia, 729 acetoacetato, 744
Amônia livre é incorporada em e produzida a Dopamina, epinefrina e norepinefrina são
partir de glutamina, 730 derivados de tirosina, 746
O grupo amida da asparagina é derivado de Tirosina é necessária para síntese de melani-
glutamina, 732 na, hormônio tireoideano e quinoproteí-
Aminoácido oxidases removem grupos amino,
nas, 747
732
Metionina e cisteína, 747
Metionina primeiro reage com adenosina
19.3 TRANSPORTE DE NITROGÊNIO PARA FÍGADO
trifosfato, 749
E RIM, 732
S-Adenosilmetionina é um doador de grupo
Proteína é constantemente degradada, 732
Aminoácidos são transportados do músculo metil, 751
após proteólise, 733 S-Adenosilmetionina é o precursor de esper-
Amônia é liberada no fígado e no rim, 733 midina e espermina, 752
Metabolismo de cisteína produz compostos que
19.4 CICLO DA URÉIA, 733 contêm enxofre, 753
Átomos de nitrogênios da uréia vêm de amônia e Triptofano, 754
aspartato, 733 Triptofano é um precursor de NAD, 755
Síntese de uréia requer cinco enzimas, 734 Piridoxal fosfato é importante no metabolis-
Síntese da uréia é regulada por um efetor alos- mo de triptofano, 756
térico e indução enzimática, 735 Serotonina e melatonina são derivadas do
Doenças metabólicas da síntese da uréia têm triptofano, 756
resultados sérios, 735 Triptofano induz sono, 757
Aminoácidos de cadeia ramificada, 758
19.5 SÍNTESE E DEGRADAÇÃO DE AMINOÁCIDOS Reações iniciais do metabolismo de BCAA
INDIVIDUAIS, 736 são as mesmas, 758

BioQ.19 725 22.01.07 18:16:14


732 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

O Grupo Amida da Asparagina É Derivado Aminoácido Oxidases Removem


de Glutamina Grupos Amino
O grupo amida da asparagina vem da glutamina (Fi- Muitos aminoácidos são substratos para L-aminoácido
gura 19.17), e não de amônia livre, como na síntese de oxidase (Figura 19.19). O significado desta reação no
glutamina. ATP é necessário para ativar o grupo β-car- metabolismo é incerto, mas parece ser pequeno. A en-
boxila receptor. Asparagina é facilmente sintetizada na zima contém flavina mononucleotídeo (FMN) e produz
maioria das células, mas algumas células leucêmicas peróxido de hidrogênio. Catalase metaboliza o peróxido
parecem ter perdido esta capacidade. Uma abordagem de hidrogênio a oxigênio e água. Os produtos finais são
terapêutica que foi tentada em pacientes com tumores um α-cetoácido, amônia e água, os mesmos produtos
deficientes em asparagina sintetase é tratamento com da reação da glutamato desidrogenase. Na reação da
asparaginase exógena, para hidrolisar a asparagina aminoácido oxidase, diferentemente da reação catali-
originária do sangue, da qual estas células dependem sada pela glutamato desidrogenase, não há produção de
(Figura 19.18). Células normais sintetizam e degradam NADH e, portanto, nenhuma produção de ATP.
asparagina. Uma D-aminoácido oxidase ocorre em células
humanas. Muito pouco dos isômeros D-aminoácidos é
NH2 encontrado no homem, e a enzima pode degradar D-
C O
aminoácidos derivados de bactérias intestinais.

|
COO– CH2

CH2 CH2
19.3 TRANSPORTE DE
HC
+
NH3
+
HC
+
NH3 NITROGÊNIO PARA
COO– COO– FÍGADO E RIM
Aspartato Glutamina

ATP
Proteína É Constantemente
AMP + PPi
Degradada
Células morrem em uma base regular e programada,
NH2 COO–
um processo chamado apoptose (ver p. 993), e suas mo-
C O CH2 léculas componentes são metabolizadas. Proteínas indi-
CH2 + CH2
viduais também sofrem turnover regular em condições
+ + normais (ver p. 239). Embora muitas reações envolvidas
HC NH3 HC NH3

COO– COO–

Asparagina Glutamato COO–


+
FIGURA 19.17 HC NH3
Síntese de asparagina.
R
NH2 FMN H2O2
C O
FMNH2 O2
CH2
Asparagina
+ COO–
HC NH3
+
C NH2
COO–

R
H2O
+
NH4 H2O

COO–
COO–
CH2 Aspartato
+ +
C O + NH4
HC NH3

COO–– R

FIGURA 19.18 FIGURA 19.19


Reação catalisada pela asparaginase. Reação da L-aminoácido oxidase, uma flavoproteína.

BioQ.19 732 22.01.07 18:16:32


CAPÍTULO 19 METABOLISMO DE AMINOÁCIDOS | 745
+ tetra-hidrobiopterina di-hidrobiopterina + H
NH3 NH3 H2N N N H H
O2 H2O
CH2 CH COO– CH2 CH COO– H
fenilalanina hidroxilase
HN
N CH CH CH3
HO H
O OH
Fenilalanina Tirosina OH

Tetra-hidrobiopterina
FIGURA 19.46
Fenilalanina hidroxilase.
H
N N H H
HN

H
HN
FIGURA 19.47 N CH CH CH3
Biopterina. O
OH OH
A forma di-hidro- (quinonóide) é produzida durante
oxidação de aminoácidos aromáticos e depois reduzida à
forma tetra-hidro por uma desidrogenase, usando NADH. Di-hidrobiopterina

CORRELAÇÃO CLÍNICA 19.7


Fenilcetonúria
Fenilcetonúria (PKU) é a doença mais comum cau- cientes na síntese ou na redução de biopterina. Uma
sada por uma deficiência de uma enzima do meta- deficiência de BH4 pode ser causada por mutação na
bolismo de aminoácidos. O nome vem da excreção GTP ciclo-hidrolase (GTPCH), 6-piruvoiltetra-hidro-
do ácido fenilpirúvico, uma fenilcetona, na urina. biopterina sintetase (PTPS) ou sepiapterina reduta-
Fenil-lactato (Figura 19.47), a forma reduzida do fe- se (SPR), as três enzimas que convertem GTP em
nilpiruvato, e fenilacetato são também excretados. BH4. Duas enzimas são necessárias para regenera-
O último dá à urina um odor “murino”. Esses três ção de BH4: pterina-4a-carbinolamina desidratase
metabólitos são encontrados em quantidades muito (PCD) e di-hidropterina redutase (DHPR). Deficiên-
pequenas na urina de pessoas saudáveis. Os sinto- cia de BH4 ocorre a uma taxa de um em um milhão.
mas de retardo mental associados a esta doença po- Screening para hiperfenilalaninemia sem redução
dem ser evitados por uma dieta pobre em fenilalani- de atividade de fenilalanina hidroxilase in vitro in-
na. Teste de triagem de rotina é determinado pelos dica a possibilidade de uma deficiência de BH4. Se
governos de muitas partes do mundo. PKU clássica a condição não for tratada, pacientes apresentam
é uma deficiência autossômica recessiva de fenila- sintomas de hiperfenilalaninemia, cabelo vermelho,
lanina hidroxilase. Mais de 417 mutações no gene retardo psicomotor e deterioração neurológica pro-
foram descritas. Em alguns casos, há sintomas neu- gressiva. Estes últimos sintomas são um resultado
rológicos graves e QI muito baixo. Estes são geral- da incapacidade de produzir melanina, catecolami-
mente atribuídos aos efeitos tóxicos da fenilalanina, nas e serotonina. Tratamento é suplementação com
possivelmente devido ao transporte reduzido e me- BH4 e precursor de neurotransmissores. Distonia
tabolismo de outros aminoácidos aromáticos no cé- que responde a DOPA (DRD) e deficiência de SR não
rebro, devido à competição das altas concentrações podem ser detectadas em testes de screening para
de fenilalanina. A cor clara característica da pele e PKU. Fibroblastos de pele são úteis para o diagnós-
dos olhos deve-se à falta de pigmentação, devido à tico destas condições. A descoberta da deficiência
deficiência de tirosina. Tratamento convencional é de SR levou à descoberta de vias alternativas do
por uma dieta sintética, pobre em fenilalanina, mas metabolismo de BH4, incluindo um papel para di-hi-
incluindo tirosina, por cerca de quatro a cinco anos, drofolato redutase (DHFR). Baixos níveis de DHFR
seguida de restrição de proteínas na dieta por vários no cérebro permitem que di-hidrobiopterina se acu-
anos mais ou por toda a vida. mule e iniba tirosina e triptofano hidroxilases. DHP
Cerca de 3% das crianças com altos níveis de também desacopla óxido nítrico sintase e pode levar
fenilalanina têm hidroxilase normal, mas são defi- à morte de célula neuronal.

Fonte: Scriver, C. R. e Clow, L. L. Phenylketonuria: Epitome of human biochemical genetics. N. Engl. J. Med.
303:1336,1980. Woo, S. L. C. Molecular basis and population genetics of phenylketonuria. Biochemistry 28:1, 1989.
Shintaku, H. Disorders of tetrahydrobiopterin metabolism and their treatments. Curr. Drug. Metab. 3:123; 2002.
Blau, N., Bonafe, L. e Thony, B. Tetrahydrobiopterin deficiencies without hyperphenylalaninemia diagnosis and gene-
tics of dopa-responsive distonia and sepiapterin reductase deficiency. Mol. Genet. Metab. 74:172, 2001.

BioQ.19 745 22.01.07 18:16:49


760 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

(A partir de leucina) ATP CO2 H2O ADP + Pi CH3 CH2 C SCoA


–OOC CH2 C CH C SCoA
CH3 C CH C SCoA
O
CH3 O metilcrotonil-CoA CH3 O
Propionil-CoA
�–Metilcrotonil-CoA carboxilase �–Metilglutaconil-CoA

H 2O CO2
metilglutaconil-CoA
O hidratase propionil-CoA
carboxilase
CH3 C SCoA OH
Acetil-CoA –OOC CH2 C CH2 SCoA
C
hidroximetilglutaril-CoA liase CH3
CH3 O –OOC CH C SCoA
�–Hidroxi–�–metilglutaril-CoA
O
CH3 C CH2 C O– (HMG CoA)
D–Metilmalonil-CoA
O O
Acetoacetato
metilmalonil-CoA
FIGURA 19.70 racemase
Reações finais na degradação de leucina.

–OOC CH C SCoA
ocorre, de maneira dependente de piridoxal. Reações
CH3 O
subseqüentes levam a acetoacetil-CoA. Uma via mino-
ritária começa com remoção do α-amino-grupo e pros- L–Metilmalonil-CoA

segue via o composto cíclico pipecolato (Figura 19.73),


para se juntar à via principal no nível do intermediário metilmalonil-CoA
mutase
semialdeído. Esta não substitui a via principal, mesmo FIGURA 19.71
em uma deficiência de enzimas na parte inicial da via Interconversão de propionil-
CoA, metilmalonil-CoA e
(ver Corr. Clín. 19.16). succinil-CoA. –OOC SCoA
CH2 CH2 C
A mutase requer
5’-desoxiadenosilcobalamina O
para atividade. Succinil-CoA

CORRELAÇÃO CLÍNICA 19.15


Doenças do Metabolismo de Propionato e Metilmalonato
Deficiência de qualquer das três enzimas mostradas ingeridos para absorção, ou perda de biotina holocar-
na Figura 19.71 contribui para cetoacidose. Propiona- boxilase, que incorpora biotina em enzimas biotina-
to é formado na degradação de valina, isoleucina, me- dependentes. Acidose em crianças pode ser causada
tionina, treonina, cadeia lateral do colesterol e ácidos por altos níveis de metilmalonato, que normalmente
graxos de cadeia ímpar. Os aminoácidos parecem ser não é detectado no sangue. Fígado retirado de au-
os principais precursores, uma vez que diminuição tópsia ou fibroblastos em cultura mostraram em al-
ou eliminação de proteínas da dieta minimiza ime- guns casos, deficiência de metilmalonil-CoA mutase.
diatamente a acidose. Um defeito na propionil-CoA Algumas amostras foram incapazes de converter
carboxilase resulta em acúmulo de propionato, que metilmalonil-CoA em succinil-CoA em qualquer con-
é desviado para vias alternativas, incluindo incorpo- dição, mas outras amostras executaram a conversão
ração em ácidos graxos em lugar do primeiro grupo quando 5’-adenosilcobalamina foi adicionada. É claro
acetil, para formar ácidos graxos de cadeia ímpar. A que aqueles com defeito no sítio ativo da enzima, não
extensão dessas reações é muito limitada. Em um conseguem metabolizar metilmalonato, mas aqueles
caso, relatou-se que grandes quantidades de biotina com defeito no manuseio da vitamina B12 respondem
produziram efeitos benéficos, sugerindo que mais a altas doses da vitamina. Outros casos de acidúria
de um defeito diminua a atividade da propionil-CoA metilmalônica têm uma incapacidade mais funda-
carboxilase. As possibilidades são: uma perda de mental de usar vitamina B12, que leva a deficiência de
biotinidase intestinal, que libera biotina de alimen- metilcobalamina (co-enzima da recuperação de me-
to ingerido para absorção, ou uma perda de biotina tionina) e deficiência de 5’-adenosilcobalamina (co-
holocarboxilase, que incorpora biotina de alimentos enzima da isomerização de metilmalonil-CoA).

Fonte: Mahoney, M. J. e Bick, D. Recent advances in the inherited methylmalonic acidemias. Acta Paediatr. Scand.
76:689, 1987.

BioQ.19 760 22.01.07 18:17:07


770 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

20
HCO3–
Glicina

Amina de aspartato 6 7
5 N
1 N
8
2
"C1"–H4folato
4 N
"C1"–H4folato N 9
3

Amida de glutamina

METABOLISMO DE
PURINA E PIRIMIDINA
NUCLEOTÍDEOS
Joseph G. Cory

20.1 VISÃO GERAL, 771 20.5 FORMAÇÃO DE DESOXIRRIBONUCLEOTÍDE-


OS, 786
20.2 FUNÇÕES METABÓLICAS DOS NUCLEOTÍ- Desoxirribonucleotídeos são formados por redu-
DEOS, 771 ção de ribonucleosídeos 5’-difosfatos, 786
Distribuição de nucleotídeos varia com o tipo de Síntese de desoxitimidilato requer N5, N10 -meti-
célula, 771 leno H4folato, 788
Interconversões de pirimidinas com ênfase em
20.3 METABOLISMO DE PURINA NUCLEOTÍDEOS, desoxirribopirimidina nucleosídeos e nucleo-
772 tídeos, 788
Síntese de purina nucleotídeos, 772 Pirimidina nucleotídeos são degradados a β-ami-
Síntese de IMP, 772 noácidos, 789
IMP é precursor de AMP e GMP, 774
Síntese de purina nucleotídeos é muito regu- 20.6 NUCLEOSÍDEO E NUCLEOTÍDEO QUINASES,
789
lada, 774
Purina bases e nucleosídeos são recuperados
20.7 ENZIMAS QUE METABOLIZAM NUCLEOTÍDE-
para regenerar nucleotídeos, 775
OS COM UMA FUNÇÃO EM CICLO CELULAR E
Purina nucleotídeos são interconvertidos para
TAXA DE DIVISÃO CELULAR, 790
equilibrar níveis celulares de adenina e gua-
nina nucleotídeos, 778 20.8 SÍNTESE DE COENZIMAS NUCLEOTÍDEOS, 791
GTP é o precursor de tetra-hidrobiopterina , 778
Ácido úrico é o produto final da degradação 20.9 SÍNTESE E UTILIZAÇÃO DE 5-FOSFORRIBOSIL-
de purinas no homem, 778 1-PIROFOSFATO, 791
Formação de ácido úrico, 781
20.10 AGENTES QUIMIOTERÁPICOS QUE INTER-
20.4 METABOLISMO DE PIRIMIDINA NUCLEOTÍ- FEREM COM METABOLISMO DE PURINA E
DEOS, 783 PIRIMIDINA NUCLEOTÍDEOS, 793
Síntese de pirimidina nucleotídeos, 783 Inibidores do metabolismo de purina e pirimidi-
Síntese de pirimidina nucleotídeos é regula- na nucleotídeos, 794
da ao nível da carbamoil fosfato sintetase Antimetabólitos são análogos estruturais de
II, 784 bases ou nucleosídeos. 794
Bases pirimídicas são recuperadas para regene- Antifolatos inibem a formação de tetra-hi-
rar nucleotídeos, 786 drofolato, 795

BioQ.20 770 22.01.07 18:22:07


CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS | 783

CORRELAÇÃO CLÍNICA 20.5 CORRELAÇÃO CLÍNICA 20.6


Pacientes com Câncer em Subclasse de Pacientes com
Tratamento por Radiações ou Autismo
Quimioterapia
Recentemente demonstrou-se que uma subclas-
Pacientes com câncer com tumores grandes, em se de crianças com autismo infantil excreta ácido
tratamento por radioterapia ou quimioterapia úrico em mais de dois desvios padrões acima da
também apresentam concentrações aumentadas média normal. Este grupo de crianças represen-
de ácido úrico no soro e na urina. A fonte deste ta aproximadamente 20% da população autis-
ácido úrico aumentado não é síntese aumentada ta. Com cultura de fibroblastos destas crianças
de purina nucleotídeos, mas sim destruição de autistas, descobriu-se que a síntese de novo de
células tumorais que, por sua vez, liberam ácidos purina nucleotídeos, medida por incorporação de
nucléicos degradados e nucleotídeos celulares, [14C]-formato em purina nucleotídeos, estava au-
que são metabolizados a ácido úrico. Muitos dos mentada quatro vezes, em relação ao observado
protocolos de tratamento de câncer incluem alo- em fibroblastos de controles normais. A razão de
purinol como uma das drogas, com o único pro- adenina nucleotídeos para guanina nucleotíde-
pósito de limitar o acúmulo de ácido úrico nos os no pool estava alterada, sugerindo que a via
pacientes. Uma nova droga uricolítica (Rasburi- de interconversão de purina nucleotídeos estava
case, uma enzima bacteriana) que converte ácido comprometida. Até o momento, a base molecular
úrico em um composto hidrossolúvel está sendo para a síntese de novo aumentada de purina nu-
usada em crianças e adultos para lidar com os cleotídeos nestas crianças autistas não é conhe-
níveis aumentados de ácido úrico formado após cida. Um aspecto incomum da síntese aumentada
células tumorais terem sido destruídas. Embora de purina nucleotídeos nestas crianças é que a
o uso de uricase ter certas vantagens farmacoló- excreção de ácido úrico é elevada, mas a concen-
gicas sobre alopurinol, tem a desvantagem de ser tração de ácido úrico no soro está na faixa nor-
mais caro. mal. Em um relato recente, um paciente do sexo
masculino foi tratado com uma dose oral de uridi-
na por um período de dois anos. Como resultado,
Fonte: Smalley, R. V., Guaspari, A., Haase-\break o paciente teve notável melhora no desempenho
Statz, S., Anderson, S. A., Cederberg, D. e Hohneker, J. social, cognitivo, de linguagem e motor. Surpre-
A. Allopurinol: Intravenous use for prevention and tre- endentemente, quando a uridina foi descontinu-
atment of hyperuricemia. J. Clin. Oncol. 18:1758, 2000. ada, os sintomas de autismo voltaram, mas com o
Ribeiro, R. C. e Pui, C. H. Recombinant urate oxidase reinício do tratamento com uridina, o comporta-
for prevention of hyperuricemia and tumor lysis syn- mento do menino melhorou novamente.
drome in lymphoid malignancies. Clin. Lymphoma
3:252, 2003. Yim, B. T., Sims-McCallum, R. P. e Chong,
P. H. Rasburicase for the treatment and prevention of Page, T. e Coleman, M. Purine metabolism abnorma-
hyperuricemia. Ann. Pharmacother. 37:1047, 2003. lities in a hyperuricosuric subclass of autism. Biochim.
Biophys. Acta 1500:291, 2000. Page, T. e Moseley, C.
Metabolic treatment of hyperuricosuric autism. Prog.
causa de hiperuricemia/hiperuricúria pode ser defini- Neuro-Psychopharmacol. Biol. Psychiatry 26:397,
da como um defeito metabólico relacionado com a su- 2002.
perprodução de purina nucleotídeos, e outras situações
nas quais não há alterações metabólicas definidas (ver
Corr. Clín. 20.1, 20.2, 20.5 e 20.6). etapas. Hidrólise de ATP (ou equivalente) é necessária

|
para direcionar diversas etapas da via.
20.4 METABOLISMO
DE PIRIMIDINA Síntese de Pirimidina Nucleotídeos
NUCLEOTÍDEOS Em contraste com a síntese de novo de purina nucle-
otídeos, nem todas as enzimas para a síntese de novo
de pirimidina nucleotídeos são citosólicas. Reações que
A síntese de novo do anel pirimidínico em células de levam à formação de UMP são apresentadas na Figura
mamíferos utiliza aminoácidos como doadores de car- 20.13. Aspectos importantes da via devem ser observa-
bono e nitrogênio, além de CO2. Uridina 5’-monofosfa- dos. O anel pirimidina é formado primeiro, e depois ri-
to (UMP) é sintetizado em uma via metabólica de seis bose 5-fosfato é adicionada com PRPP, sendo o doador

BioQ.20 783 22.01.07 18:22:20


CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS | 791
O pool de desoxirribonucleotídeos é extremamen- coenzimas tenham um resíduo de AMP como parte de
te pequeno em células “em repouso” (inferior a 1 μM). sua estrutura, o resíduo de AMP não está diretamente
Como resultado do aumento de atividade de ribonucleo- envolvido nas reações em que cada uma delas funciona.
tídeo redutase, as concentrações de desoxirribonucleo- Em NAD e NADP, é o anel de nicotinamida que está
tídeos alcançam 10-20 μM durante síntese de DNA. En- envolvido na função de oxidação/redução; em FMN ou
tretanto, esta concentração suportaria síntese de DNA FAD, é o anel flavina que está envolvido na função de
por alguns minutos, enquanto a replicação completa oxidação/redução; na coenzima A, é o grupo sulfidri-
do DNA requer horas. Conseqüentemente, os níveis de la que é parte funcional da molécula. São sintetizadas
atividade da ribonucleotídeo redutase não só devem por uma variedade de tipos de células de mamíferos.
aumentar, mas devem ser mantidos durante a fase S, Figuras 20.27, 20.28 e 20.29 apresentam as vias biossin-
para fornecerem os substratos necessários à síntese téticas para cada uma. Síntese de NAD requer niacina,
de DNA. Tecidos em crescimento, como o fígado em síntese de FAD requer riboflavina, e CoA requer ácido
regeneração, tecidos embrionários, células da mucosa pantotênico. NAD é sintetizado por três vias diferentes,
intestinal e células eritropoiéticas estão inclinados em começando com triptofano (ver p. 754), nicotinato ou
direção à replicação de DNA e à síntese de RNA. Estes nicotinamida, respectivamente. Quando triptofano está
tecidos apresentarão níveis elevados das enzimas-cha- em excesso, em relação à quantidade necessária para
ves envolvidas com síntese e interconversões de purina síntese de proteínas e de serotonina (ver p. 773), ele
e pirimidina nucleotídeos, juntamente com diminuição pode ser usado para síntese de NAD. Esta situação não
complementar na quantidade de enzimas que catalisam é provável na maioria das dietas normais; conseqüente-
reações nas quais estes precursores são degradados. mente, niacina é necessária na dieta.
Estas mudanças refletem a proporção de células que Síntese de NAD + por qualquer uma das três vias re-
estão na fase S. quer PRPP como doador de ribose 5-fosfato. Nicotina-
Um padrão ordenado de alterações bioquímicas mida adenina dinucleotídeo fosfato (NADP+) é deriva-
ocorre em células tumorais. A partir de uma série de do por fosforilação do NAD +. NAD+ é usado não só como
tumores de fígado, cólon e rim, com diferentes velocida- cofator em reações de oxidação-redução, mas também
des de crescimento, estas alterações foram identificadas como um substrato em reações de ADP-ribosilação (p.
como: (1) ligadas à transformação (significando que to- ex., reparo de DNA e envenenamento por toxina per-
dos os tumores, independentemente da velocidade de tussis; ver p. 514). Estas reações levam ao turnover de
crescimento, apresentam quantidades de certas enzi- NAD+. O produto final da degradação de NAD + é 2-piri-
mas aumentadas e, de certas enzimas, diminuídas), (2) dona-5-carboxamida, que é excretado na urina.
ligadas à progressão (alterações que se correlacionam Síntese de coenzimas nucleotídeos é regulada de
com a velocidade de crescimento dos tumores) e (3) maneira que existam concentrações essencialmente
alterações coincidentes (não ligadas ao estado malig- constantes destas coenzimas na célula. Quando se diz
no). Os níveis de ribonucleotídeo redutase, timidilato que uma certa condição metabólica é favorecida quan-
sintase e IMP desidrogenase aumentam em função da do a concentração de NAD + é baixa, a concentração de
velocidade de crescimento do tumor. PRPP amidotrans- NADH é correspondentemente alta. Como um exemplo,
ferase, UDP quinase e uridina quinase estão aumenta- para que a glicólise continue em condições anaeróbicas,
das em todos os tumores, independentemente de serem NAD+ deve ser continuamente regenerado por redução
de crescimento lento ou rápido. de piruvato a lactato, catalisado pela lactato desidroge-
Alterações de expressão gênica em células tumorais nase (ver p. 582).
não são apenas alterações quantitativas em níveis enzi-

|
20.9 SÍNTESE E UTILIZAÇÃO
máticos, mas também alterações qualitativas (troca de
isozimas, isozyme shifts). Enquanto algumas enzimas
estão aumentadas em tecido normal de crescimento DE 5-FOSFORRIBOSIL-
rápido (p. ex., embrionário e fígado em regeneração) e
em tumores, os padrões gerais quantitativo e qualitativo
1-PIROFOSFATO
para tecidos normal e tumoral podem ser diferenciados.
5-Fosforribosil-1-pirofosfato (PRPP) é uma molé-

|
20.8 SÍNTESE DE cula chave na síntese de novo de purina e pirimidina
nucleotídeos, na recuperação de bases púricas e piri-
COENZIMAS mídicas, e na síntese de NAD+. PRPP sintetase catalisa
NUCLEOTÍDEOS a reação apresentada na Figura 20.30. Ribose-5-fosfato
usada nesta reação é gerada a partir do metabolismo
de glicose 6-fosfato, pela via das pentoses fosfato, ou da
Nicotinamida adenina nucleotídeo (NAD+), fla- ribose 1-fosfato gerada por fosforólise de nucleosídeos,
vina adenina nucleotídeo (FAD+) e coenzima A via nucleosídeo fosforilase. PRPP sintetase tem uma ne-
(CoA) são importantes coenzimas ou grupos prostéti- cessidade absoluta de fosfato inorgânico e é fortemente
cos do metabolismo intermediário. Embora todas essas regulada. A curva de velocidade versus concentração

BioQ.20 791 22.01.07 18:22:30


CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS | 793
H H H FIGURA 20.28
Síntese de flavina adenina
CH2 C C C CH2OH dinucleotídeo.
OH OH OH

N N
O
H3C
Riboflavina
H3C NH
N
O

ATP
riboflavina quinase
ADP

H H H O
CH2 C C C CH2 O P O–

OH OH OH O–

N N
O
H3C
Riboflavins fosfato (flavina mononucleotídeo, FMN)

H3C NH
N
O

ATP
FAD - pirofosforilase
PPi
NH2
N
N

N N

H H H O O
Flavins adenina dinucleotídeo (FAD)
CH2 C C C CH2 O P O P O CH2 O
OH OH OH –O –O

N N
O
H3C HO OH

H3C NH
N
O

|
5. Síntese de NAD +
20.10 AGENTES QUIMIOTE-
PRPP + nicotinato 
 nicotinato mononucleotídeo + PPi
RÁPICOS QUE INTER-
PRPP + nicotinamida 
FEREM COM META-
 nicotinamida mononucleotídeo + PPi BOLISMO DE PURINA
PRPP + quinolinato 
 nicotinato mononucleotídeo + PPi
E PIRIMIDINA NUCLE-
OTÍDEOS
Deve-se lembrar que os níveis celulares de pirofos-
fatase são muito altos em células, levando à hidrólise Síntese de novo de purina e pirimidina nucleotídeos
de pirofosfato a fosfato, e tornando as reações irrever- é crítica para replicação, manutenção e função da cé-
síveis. lula normal. Regulação destas vias é importante, uma
vez que foram identificadas doenças que surgem de
defeitos nas enzimas regulatórias. Compostos sintéti-
cos e produtos naturais de plantas, bactérias ou fun-
gos, que são análogos estruturais das nucleobases ou
dos nucleosídeos usados em reações metabólicas, têm

BioQ.20 793 22.01.07 18:22:33


CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO | 803

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

21
M V

� �
N
M M
N Fe N
P V
N
� �

P M
Heme

METABOLISMO DO HEME
E DO FERRO
William M. Awad, Jr.

21.1 METABOLISMO DO FERRO: VISÃO GERAL, 21.7 CATABOLISMO DO HEME, 821


804 Bilirrubina é conjugada para formar bilirrubina
21.2 PROTEÍNAS QUE CONTÊM FERRO, 804 diglucuronídeo no fígado, 821
Transferrina transporta ferro no soro, 804 Hemólise intravascular requer remoção de ferro,
Lactoferrina liga ferro no leite, 805 823
Ferritina é uma proteína envolvida no armazena- BIBLIOGRAFIA, 826
mento de ferro, 805
Proteínas que contêm ferro não-hemínico estão QUESTÕES E RESPOSTAS, 827
envolvidas em processos enzimáticos, 806
CORRELAÇÕES CLÍNICAS
21.3 ABSORÇÃO INTESTINAL DE FERRO, 807 21.1 Sobrecarga de Ferro e Infecção, 805
21.2 Patogenicidade Microbiana e Ferro, 805
21.4 REGULAÇÃO MOLECULAR DA UTILIZAÇÃO 21.3 Síntese do Grupo Ferro-Enxofre e Doença
DE FERRO, 808 Humana, 807
21.4 Ataxia de Friedreich, 807
21.5 DISTRIBUIÇÃO E CINÉTICA DO FERRO, 811 21.5 Absorção Duodenal de Ferro, 809
21.6 Elementos de Resposta ao Ferro Mutante,
21.6 BIOSSÍNTESE DO HEME, 813 811
Enzimas da biossíntese do heme ocorrem em 21.7 Deficiência de Ceruloplasmina, 812
mitocôndrias e citosol, 818 21.8 Anemia por Deficiência de Ferro, 812
Ácido δ-aminolevulínico sintase, 818 21.9 Hemocromatose Tipo I: Genética Mole-
Ácido aminolevulínico desidratase, 818 cular e a Questão das Dietas Enriquecidas
Porfobilinogênio deaminase e uroporfirinogê- em Ferro, 814
nio III sintase, 818 21.10 Hemocromatose Tipo III, 814
Uroporfirinogênio descarboxilase, 819 21.11 Porfiria Intermitente Aguda, 817
Coproporfirinogênio oxidase, 820 21.12 Papel Citoprotetor de Heme Oxigenase,
Protoporfirinogênio oxidase, 820 822
Ferroquelatase, 820 21.13 Hemólise Isoimune Neonatal, 824
ALA sintase catalisa a etapa limitante da veloci- 21.14 Deficiência de Bilirrubina UDP-Glucurono-
dade da biossíntese do heme, 821 siltransferase, 824
21.15 Elevação de Bilirrubina Conjugada no
Soro, 825

BioQ.21 803 22.01.07 18:25:39


CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO | 811

CORRELAÇÃO CLÍNICA 21.6


Elemento de Resposta ao Ferro Mutante
Mutações simples foram descritas no segmento de síntese muito aumentada de ferritina no cristalino
alça do elemento de resposta ao ferro do mRNA da pode levar a uma quantidade aumentada de reações
cadeia leve da ferritina, com uma quantidade au- catalisadas por ferro, com dano lenticular oxidativo
mentada de apoferritina sendo sintetizada, mas sem muito bem descrito. Uma mutação numa família ja-
um aumento no ferro total do corpo. Esta mutação ponesa ocorre no IRE do mRNA da cadeia H da fer-
leva a uma afinidade 28 vezes menor para IRP-1, em ritina, com um marcado aumento na afinidade por
um caso. O conteúdo de L-ferritina do cristalino IRP. O seqüestro de IRPs leva à síntese diminuída
pode aumentar nove vezes em comparação ao con- de cadeia H e síntese aumentada de cadeia L. Esta
teúdo no cristalino de indivíduos controles. Como condição está associada com aumento significativo
conseqüência, cristais de cadeias leves puras de fer- no conteúdo de ferro do corpo, mas aparentemente
ritina aparecem no cristalino, levando a catarata. A sem evidência de catarata.

Fonte: Girelli, D., Corrocher, R., Bisceglia, L., et al. Molecular basis for the recently described hereditary hyperferriti-
nemia-cataract syndrome: a mutation in the iron-responsive elements of ferritin L-subunit gene (the “Verona mutation”).
Blood 86: 4050, 1995. Beaumont, C., Leneuve, P., Devaux, I., Scoazec, J.Y., et al. Mutation in the iron responsive element of
the L ferritin mRNA in a family with dominant hyperferritinaemia and cataract. Nature Genet. 11: 444, 1995. Mumford,
A. D., Cree, I. A., Arnold, J. D., et al. The lens in hereditary hyperferritinemia cataract syndrome contains crystalline
deposits of L-ferritin. Br. J. Ophthalmol. 84:697, 2000. Kato, J., Fujikawa, K., Kanda, M., et al. A mutation in the iron-
responsive element of H-ferritin mRNA, causing autosomal dominant iron overload. Am. J. Hum. Genet. 69:191, 2001.

TABELA 21.2 Síndromes de Sobrecarga de Ferro


Nome Gene Cromossomo Herança Ocorrência Proteína

Síndrome GRACILE BCS1L 2q33 Recessiva Muito rara Chaperone mitocondrial

Hemocromatose juvenil HFE2 1q21 Recessiva Incomum Hemojuvelina

Hemocromatose juvenil HFE2B 19q13 Recessiva Incomum Hepcidina

Hemocromatose HFE1 6p21 Recessiva Comum Proteína HFE

Hemocromatose HFE3 7q22 Recessiva Incomum Receptor 2 de transferrina

Hemocromatose HFE4 2q32 Dominante Rara Ferroportina

Sobrecarga de ferro FTH1 11q13 Dominante Muito rara Ferritina H

Aceruloplasminemia CP 3q23 Recessiva Rara Ceruloplasmina

Fonte: Fellman, V. The GRACILE syndrome, a neonatal lethal metabolic disorder with iron overload. Blood Cells Mol. Dis. 29:444, 2002.
Ver Corr. Clín. 21.6, 21.7, 21.9 e 21.10 para maiores detalhes.

|
21.5 DISTRIBUIÇÃO E TABELA 21.3 Distribuição Aproximada de Ferro:
Homem de 70 kg
CINÉTICA DO FERRO g %

Hemoglobina 2,5 68
Um homem normal de 70 kg contém 3-4 g de ferro, dos
Mioglobina 0,15 4
quais apenas 0,1% (3,5 mg) no plasma. Aproximada-
mente 2,5 g estão na hemoglobina. Tabela 21.3 lista a Transferrina 0,003 0,1
distribuição de ferro no ser humano.
Ferritina, tecido 1,0 27
Normalmente, cerca de 33% dos sítios de transferri-
na contêm ferro. Ferro absorvido do intestino é entre- Ferritina, soro 0,0001 0,004
gue primariamente à medula óssea, para incorporação Enzimas 0,02 0,6
em hemoglobina dos eritrócitos.
Total 3,7 100

BioQ.21 811 22.01.07 18:25:46


CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO | 817

CORRELAÇÃO CLÍNICA 21.11


Porfiria Intermitente Aguda
Uma mulher de 40 anos de idade procurou o pron- rida, e aparentemente não existe expressão heredi-
to-socorro em um estado agitado, chorando e recla- tária da doença. Acredita-se que uma diminuição
mando de intensa dor abdominal. Estava constipada na porfobilinogênio deaminase leve a uma pequena
há vários dias e notou marcada fraqueza nos braços diminuição no conteúdo de heme do fígado. A con-
e nas pernas e que “as coisas não parecem estar centração menor de heme leva a uma insuficiência
completamente corretas”. Exame físico revelou uma na repressão da síntese e na inibição da atividade
velocidade de batimento cardíaco ligeiramente ace- da ALA sintase. Quase nunca manifestada antes da
lerada (100/min) e hipertensão moderada (pressão puberdade, acredita-se que a doença apareça ape-
sangüínea de 160/110 mmHg). Episódios anteriores nas com a indução da 5β-redutase, na adolescência.
de dor abdominal severa já haviam ocorrido; ope- Sem uma quantidade suficiente de 5α-redutase, o
rações realizadas em duas ocasiões não revelaram aumento observado nos 5β-esteróides é devido a um
nenhuma anormalidade. Os testes laboratoriais co- desvio de esteróides para a via da 5β-redutase. A im-
muns são normais. As queixas neurológicas não são portância de anomalias nesta última via metabólica
localizadas num foco anatômico. Decide-se que os na patogênese da porfiria é controversa. A doença é
sintomas presentes são amplamente de origem psi- um grande enigma: o desarranjo do metabolismo da
quiátrica e têm uma base funcional, e não orgânica. porfirina é confinado ao fígado, que anatomicamen-
A paciente é sedada com 60 mg de fenobarbital; um te parece normal, enquanto achados patológicos es-
psiquiatra consultado concorda, por telefone, em ver tão restritos ao sistema nervoso. No presente caso,
a paciente em aproximadamente 4 h. O corpo clíni- envolvimento de (1) cérebro leva ao estado agitado e
co percebe uma piora notável; fraqueza generalizada confuso e ao colapso respiratório, (2) sistema autô-
surge rapidamente, progredindo para um comprome- nomo leva à hipertensão, aumento na velocidade de
timento da função respiratória. Esta evolução ruim batimentos cardíacos, constipação e dor abdominal,
leva à incorporação imediata de um regime de ven- e (3) sistema nervoso periférico e medula espinhal
tilação assistida, com transferência para unidade de levam à fraqueza e distúrbios sensoriais.
terapia intensiva para monitoração fisiológica. Sua Experimentalmente, nenhum intermediário me-
condição piora e ela morre 48 h depois. Uma amos- tabólico conhecido da biossíntese do heme pode
tra de urina da paciente é relatada mais tarde como causar a patologia observada na porfiria intermi-
apresentando um nível muito elevado de porfobili- tente aguda. Deveria ter havido uma suspeita maior
nogênio. Esta paciente tinha porfiria intermitente da possibilidade de porfiria, logo após a chegada da
aguda, uma doença pouco entendida da biossíntese paciente. O tratamento incluiria infusão de glicose,
de heme. Há um padrão de herança dominante as- exclusão de qualquer droga que pudesse causar au-
sociado a uma superprodução de ALA e porfobilino- mento de ALA sintase (p.ex., barbituratos) e, se a
gênio, os precursores de porfirina. Três anomalias doença não respondesse satisfatoriamente apesar
enzimáticas foram observadas em casos que foram destas medidas, administração de hematina intra-
estudados cuidadosamente. Estas incluem: (1) um venosa para inibir a síntese e a atividade de ALA sin-
grande aumento de ALA sintase, (2) uma redução à tase. Porfiria hepática aguda é de interesse político
metade da atividade de porfobilinogênio deaminase, histórico. A doença foi diagnosticada em dois des-
e (3) uma redução à metade da atividade da esterói- cendentes do rei George III, sugerindo que o último
de 5α-redutase. A mudança no conteúdo da segunda tinha uma personalidade alterada antes e durante
enzima é consoante com uma expressão dominante. a Revolução Americana, que poderia talvez ser atri-
A mudança no conteúdo da terceira enzima é adqui- buída à porfiria.

Fonte: Meyer, U.A., Strand, L.J., Doss, M., et al. Intermittent acute porphyria: demonstration of a genetic defect
in porphobilinogen metabolism. N. Engl. J. Med. 286: 1277, 1972. Stein, J.A. e Tscudy, D.D. Acute intermittent por-
phyria: a clinical and biochemical study of 46 patients. Medicine (Baltimore) 49: 1, 1970.

BioQ.21 817 22.01.07 18:25:51


CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO | 821

|
21.7 CATABOLISMO DE
sensível aos efeitos de metais pesados, especialmente
chumbo, e, é claro, à deprivação de ferro. Nestes últi-
mos casos, zinco é incorporado em lugar do ferro, for- HEME
mando um complexo zinco-protoporfirina IX. Em con-
traste com heme, o complexo zinco-protoporfirina IX é
Catabolismo de proteínas contendo heme apresenta
muito fluorescente e facilmente detectável em pequenas
duas necessidades para o mamífero hospedeiro: (a) um
quantidades. Ferroquelatase procariótica não contém
meio para processar os produtos hidrofóbicos de cliva-
um grupo prostético; enquanto a enzima de mamíferos
gem do anel porfirínico e (b) retenção e mobilização
contém um grupo Fe2S2.
do ferro contido, de forma que possa ser reutilizado.
Eritrócitos têm um tempo de vida de aproximadamente
ALA Sintase Catalisa a Etapa 120 dias. Células senescentes são reconhecidas por al-
Limitante da Velocidade da terações em suas membranas, e removidas pelo sistema
retículoendotelial em locais extravasculares. As cadeias
Biossíntese do Heme de globina desnaturam, liberando heme no citoplasma.
A globina é degradada até seus aminoácidos constituin-
ALA sintase controla a etapa limitante da velocidade
tes, que são reutilizados para suprir necessidades me-
de síntese de heme em todos os tecidos. Succinil-CoA e
tabólicas gerais.
glicina são substratos para uma variedade de reações.
Figura 21.12 mostra os eventos do catabolismo de
A modulação da atividade de ALA sintase determina a
heme. Heme é degradado primariamente por um siste-
quantidade de substratos que será desviada para bios-
ma de enzimas do retículo endoplasmático em células
síntese de heme. Heme e hematina agem como repres-
retículoendoteliais, que requerem oxigênio molecular
sores da síntese de ALA sintase e como inibidores de
e NADPH. Heme oxigenase tem dois isômeros; tipo I
sua atividade. Como heme não se assemelha nem com
é induzido por substrato e tipo II é constitutivo. A en-
os substratos nem com o produto da ação da enzima, é
zima catalisa clivagem da ponte α-meteno, que une os
provável que atue sobre um sítio alostérico. Quase 100
dois resíduos pirrólicos contendo substituintes vinil.
drogas e metabólitos diferentes podem causar indução
O carbono α-meteno é convertido, quantitativamente,
de ALA sintase; por exemplo, um aumento de 40 vezes
em monóxido de carbono. Esta é a única fonte endóge-
é observado em rato após tratamento com 3,5-dicar-
na de monóxido de carbono no homem. Uma fração
betoxi-1,4-di-hidrocolidina. O efeito dos agentes far-
do monóxido de carbono é liberada pelo trato respi-
macológicos levou a uma característica clínica impor-
ratório. Assim, a medida de monóxido de carbono na
tante: alguns pacientes com certos tipos de porfiria
respiração exalada fornece um índice da quantidade
tiveram exacerbação de sua condição após adminis-
de heme que é degradada em um indivíduo. O oxigênio
tração inadequada de certas drogas (p. ex., barbitu-
presente no monóxido de carbono e nos anéis lactâmi-
ratos). ALA desidratase é também inibida por heme;
cos recém-derivados é gerado totalmente a partir de
mas isto tem poucas conseqüências fisiológicas, uma
oxigênio molecular. A estequiometria da reação requer
vez que a atividade de ALA desidratase é cerca de 80
3 moles de oxigênio para cada clivagem de anel. Heme
vezes maior do que a de ALA sintase e, portanto, efei-
oxigenase só usará heme como substrato, com o ferro
tos inibitórios do heme refletem-se primeiro na ativi-
possivelmente participando no mecanismo de cliva-
dade de ALA sintase.
gem. Assim, protoporfirina IX livre não é substrato. O
Glicose ou um de seus metabólitos proximais inibe
tetrapirrol linear biliverdina IX é formado por heme
biossíntese de heme por um mecanismo desconhecido.
oxigenase. Biliverdina IX é reduzida por biliverdina
Isto é de relevância clínica, uma vez que alguns pa-
redutase a bilirrubina IX. Descobriu-se que os pro-
cientes manifestam seu estado porfírico pela primei-
dutos de ação da heme oxigenase são citoprotetores
ra vez quando colocados em dieta muito hipocalórica
(ver Corr. Clín. 21.12).
(e, portanto, de pouca glicose). Outros reguladores do
metabolismo de porfirinas incluem certos esteróides.
Hormônios esteróides (p. ex., pílulas contraceptivas Bilirrubina É Conjugada para Formar
orais) com uma dupla ligação no anel A entre os áto- Bilirrubina Diglucuronídeo no Fígado
mos C4 e C5 podem ser reduzidos por duas redutases
diferentes. O produto da redução de 5α tem pouco efei- Bilirrubina é derivada de glóbulos vermelhos senes-
to sobre a biossíntese de heme; entretanto, o produto centes, mas também do turnover de outras proteínas
da 5β-redução serve com um estímulo para síntese de que contêm heme, como os citocromos. Estudos, com
ALA sintase. glicina marcada como um precursor, revelaram que uma
bilirrubina marcada precocemente, com um pico em 1-3
h, aparece muito rapidamente após uma administração
em pulso do precursor marcado. Uma quantidade maior
de bilirrubina aparece muito mais tarde, em aproxima-
damente 120 dias, refletindo o turnover do heme em

BioQ.21 821 22.01.07 18:25:56


CAPÍTULO 22 INTER-RELAÇÕES METABÓLICAS | 829

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

22
Fígado
Glicose Glicogênio
Amino-
ácidos
Uréia
Piruvato
Síntese
protéica
Gordura
Lactato Cérebro
Síntese
protéica CO2 + H2O
(todos os
tecidos)

INTER-RELAÇÕES
METABÓLICAS
Robert A. Harris e David W. Crabb

22.1 VISÃO GERAL, 830 Obesidade, 853


Fazendo dieta, 853
22.2 CICLO JEJUM-ALIMENTAÇÃO, 830 Diabetes mellitus tipo 2, 855
No estado bem alimentado a dieta supre as ne- Diabetes mellitus tipo 1, 856
cessidades energéticas, 830 Câncer, 858
No estado de jejum inicial, glicogenólise hepática Exercícios aeróbico e anaeróbico, 858
é uma importante fonte de glicose sangüínea, Gravidez, 860
834 Lactação, 860
O estado de jejum requer gluconeogênese a partir Estresse e trauma, 861
de aminoácidos e glicerol, 835 Doença hepática, 862
No estado de realimentação inicial, glicogênio é Doença renal, 863
formado por uma via indireta, 837 Álcool, 863
Importantes interações metabólicas interórgãos, Equilíbrio ácido-base, 864
838 Cólon, 866
Necessidades energéticas, reservas e homeostase
calórica, 839 BIBLIOGRAFIA, 866
Homeostase da glicose tem cinco fases, 842
QUESTÕES E RESPOSTAS, 868
22.3 MECANISMOS ENVOLVIDOS NA MUDANÇA
DO METABOLISMO HEPÁTICO ENTRE OS ES- CORRELAÇÕES CLÍNICAS
TADOS BEM-ALIMENTADO E DE JEJUM, 843 22.1 Obesidade, 831
Disponibilidade de substratos controla muitas 22.2 Subnutrição Protéica, 832
vias metabólicas, 843 22.3 Jejum, 833
Efetores alostéricos regulam enzimas-chaves, 843 22.4 Síndrome de Reye, 837
Modificação covalente regula enzimas-chaves, 22.5 Coma Hiperglicêmico, Hiperosmolar, 841
845 22.6 Hiperglicemia e Glicação de Proteínas, 841
Mudanças nas quantidades de enzimas-chaves 22.7 Diabetes Mellitus Tipo 2, 855
fornecem adaptação de longo prazo, 849 22.8 Diabetes Mellitus Tipo 1, 857
22.9 Via do Poliol e Complicações do Diabetes,
22.4 INTER-RELAÇÕES METABÓLICAS DE TECIDOS 857
EM VÁRIOS ESTADOS NUTRICIONAIS E HOR- 22.10 Caquexia do Câncer, 858
MONAIS 852

BioQ.22 829 22.01.07 18:27:18


CAPÍTULO 22 INTER-RELAÇÕES METABÓLICAS | 843
corpos cetônicos se acumularam até concentrações explica alguns tipos de hipoglicemia, como as obser-
suficientemente elevadas para que entrem no cérebro vadas durante gravidez ou jejum avançado. Síntese de
e supram parte de suas necessidades energéticas. Glu- uréia também é regulada por suprimento de substratos.
coneogênese renal também se torna significativa nesta Metabolismo de aminoácidos no intestino fornece uma
fase. Fase V ocorre após jejum muito prolongado de in- fração substancial da amônia usada pelo fígado para
divíduos extremamente obesos, e é caracterizada por produção de uréia. O intestino libera citrulina, como
dependência ainda menor da gluconeogênese. Nesta discutido acima, o precursor metabólico de ornitina.
fase, as necessidades energéticas de quase todos os te- Um pool maior de ornitina permite síntese aumentada
cidos são supridas, em grande parte, por oxidação de de uréia após uma refeição rica em proteínas. Na defi-
ácidos graxos ou de corpos cetônicos. ciência de proteínas, a velocidade de formação de uréia
Enquanto as concentrações de corpos cetônicos es- diminui.
tiverem elevadas e os níveis de glicose mantidos, prote- Podemos concluir que suprimento de substratos é
ólise será um tanto restrita, talvez por pequenas quan- um importante determinante da velocidade em que
tidades de insulina ainda produzidas pelo pâncreas, e operam virtualmente todos os processos metabóli-
preservação de proteínas musculares e enzimas ocor- cos do corpo. Entretanto, variações no suprimento de
rerá. Isto continua até que praticamente toda a gordura substratos não são suficientes para explicar as mudan-
tenha sido consumida, e os níveis de corpos cetônicos ças marcantes no metabolismo, que devem ocorrer no
caem. Depois que toda a gordura se esgotou, o corpo ciclo jejum-alimentação. Ajuste mais fino das vias é
precisa usar proteína muscular para manter a glicose necessário.
sangüínea. Antes que ela se acabe, você se acabou (ver
Corr. Clín. 22.3). Efetores Alostéricos Regulam

|
Enzimas-Chaves
22.3 MECANISMOS ENVOL-
Figuras 22.10 e 22.11 resumem os efeitos de efetores
VIDOS NA MUDANÇA alostéricos no fígado, em estados bem-alimentado e je-
DO METABOLISMO jum, respectivamente. Como mostra a Figura 22.10, gli-
cose ativa glucoquinase [indiretamente por promover
HEPÁTICO ENTRE OS seu deslocamento do núcleo para o citoplasma (p. 590)],
ESTADOS BEM-ALI- promovendo assim fosforilação da glicose. Glicose tam-
bém inativa glicogênio fosforilase e ativa glicogênio sin-
MENTADO E DE JEJUM tase indiretamente, dessa forma impedindo degradação
e promovendo síntese de glicogênio. Frutose 2,6-bisfos-
O fígado de pessoas bem-alimentadas sintetiza ativa- fato estimula 6-fosfofruto-1-quinase e inibe frutose
mente glicogênio e triacilglicerol; tal fígado é glicogê- 1,6-bisfosfatase, desta forma estimulando glicólise e
nico, glicolítico e lipogênico. Em contraste, o de uma inibindo gluconeogênese.
pessoa em jejum é glicogenolítico, gluconeogênico, ce- Frutose 1,6-bisfosfato ativa piruvato quinase, desta
togênico e proteolítico. A estratégia empregada é arma- forma estimulando glicólise, e piruvato ativa o comple-
zenar calorias quando alimento está disponível, e mobi- xo piruvato desidrogenase [indiretamente, por inibição
lizá-las quando o resto do corpo estiver precisando. O da piruvato desidrogenase quinase (ver p. 628)]. Citra-
fígado muda entre estes extremos metabólicos por uma to ativa acetil-CoA carboxilase, desta forma esti-
variedade de mecanismos regulatórios: suprimento de mulando síntese de ácidos graxos, e malonil-CoA inibe
substratos, efetores alostéricos, modificação covalente carnitina palmitoiltransferase I, desta forma inibindo
e indução-repressão de enzimas. oxidação de ácidos graxos. Como mostra a Figura 22.11,
acetil-CoA estimula gluconeogênese em estado de je-
jum por ativar piruvato carboxilase e inibir o complexo
Disponibilidade de Substratos piruvato desidrogenase [diretamente por estímulo da
Controla Muitas Vias Metabólicas piruvato desidrogenase quinase (ver p. 531)]. Ésteres
de acil-CoA de cadeia longa inibem acetil-CoA carboxi-
Este mecanismo de controle é freqüentemente ignora- lase, o que diminui o nível de malonil-CoA e aumenta
do. Entretanto, a concentração de ácidos graxos no san- atividade de carnitina palmitoiltransferase I e oxi-
gue que entra no fígado é um importante determinante dação de ácidos graxos. Frutose 6-fosfato inibe gluco-
da taxa de cetogênese. Síntese de glicose pelo fígado é quinase [indiretamente por promover seu deslocamen-
afetada pela velocidade com que substratos gluconeogê- to do citoplasma para o núcleo (ver p. 590)]. Citrato, que
nicos fluem para o fígado. Entrega de aminoácidos para está aumentado em concentração como conseqüência
o fígado no diabetes, em virtude de proteólise acelerada de maior oxidação de ácidos graxos, inibe 6-fosfofruto-
e descontrolada, estimula gluconeogênese e exacerba 1-quinase e 6-fosfofruto-2-quinase (não mostrado); e
hiperglicemia. Por outro lado, incapacidade de suprir NADH, produzido pela oxidação de ácidos graxos, inibe
o fígado adequadamente com substratos glucogênicos o ciclo dos ácidos tricarboxílicos.

BioQ.22 843 22.01.07 18:27:34


852 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

22.22). Insulina se opõe a esta ação do glucagon. Vários zo. Por exemplo, no jejum prolongado ou no diabetes
mecanismos estão envolvidos, mas o mais importante não-controlado, mudança na concentração de efetores
envolve inibição da atividade de fatores de transcrição alostéricos de acetil-CoA carboxilase terá pouco efeito
forkhead que são necessários para a transcrição dos quando a enzima estiver virtualmente ausente, devido à
genes contendo elementos de resposta à insulina (IRE) regulação negativa da expressão do seu gene. Uma pes-
e codificando enzimas gluconeogênicas (Figura 22.21). soa em jejum crônico não pode utilizar eficientemente
Deficiência de energia leva à inibição de síntese de uma carga de glicose devido à ausência de enzimas-
gordura, colesterol e glicose pelas células do fígado. Ati- chaves necessárias ao metabolismo de glicose. Isto é a
vação de AMPK por AMP reduz a transcrição de SREBP intolerância a glicose do jejum. Uma carga de glicose,
e inibe sua atividade transcripcional e, portanto, inibe entretanto, colocará em ação as adaptações necessárias
síntese de gordura e de colesterol (Figura 22.21). Ativa- e o restabelecimento dos mecanismos regulatórios de
ção de AMPK também inibe a atividade transcripcional curto prazo.

|
de fator nuclear hepático 4α (HNF-4α), que é neces-
sário para transcrição de genes que codificam enzimas
gluconeogênicas.
22.4 INTER-RELAÇÕES
Receptor de peroxissomos proliferador-ativa- METABÓLICAS
do α (PPARα), um membro da família de receptores
nucleares, é um receptor de ácidos graxos, e é expresso
DE TECIDOS EM
em altos níveis em tecidos que oxidam ácidos graxos (fí- VÁRIOS ESTADOS
gado, rim e coração). Ácidos graxos poliinsaturados es-
timulam o receptor para ativar transcrição de genes en-
NUTRICIONAIS E
volvidos em utilização de ácidos graxos (Figura 22.23), HORMONAIS
que contém um elemento de resposta a prolifera-
dor de peroxissomo (PPRE) em seus promotores, Muitas mudanças que ocorrem nos diferentes estados
incluindo aqueles para enzimas dos sistemas de pero- nutricionais e hormonais são variações do ciclo jejum-
xissomos, microssomos e mitocôndrias para oxidação alimentação. Alguns exemplos são dados na Figura
de ácidos graxos (FOX), genes de apolipoproteínas 22.24. Outros são óbvios – por exemplo, o rápido cres-
necessárias para exportação de triacilgliceróis hepá- cimento de uma criança, quando aminoácidos são dire-
ticos como VLDL, e enzimas da cetogênese. No tecido cionados do catabolismo para síntese de proteínas. As
adiposo, a isoforma PPARγ é expressa. Quando ativada mudanças que ocorrem em algumas situações fisiolo-
(talvez por derivados de ácidos graxos, como prosta- gicamente importantes, entretanto, são bastante sutis
glandinas), orquestra a diferenciação de pré-adipócitos e pouco conhecidas. Por exemplo, no envelhecimento
em adipócitos, aumentando a capacidade de armazenar parece haver uma sensibilidade diminuída dos prin-
triacilglicerol. A atividade de ambas as formas de PPAR cipais tecidos do corpo a hormônios, com capacidade
é aumentada pelo PPARγ-coativador 1 (PGC-1), que é diminuída dos tecidos de responderem normalmente
induzido por cAMP. durante o ciclo jejum-alimentação. Se isso é um fator
Estas mudanças adaptativas também influenciam a que contribui ou uma conseqüência do processo de en-
eficiência dos mecanismos regulatórios de curto pra- velhecimento, não se sabe.

Ácidos graxos FIGURA 22.23


Ativação de PPAR por ácidos graxos promove
transcrição de genes de oxidação de ácidos
+ graxos (FOX) e cetogênese.

PPAR�

+ + +

PPRE PPRE PPRE


Mitocôndria Peroxissomo Genes de
genes FOX genes FOX cetogênese

Oxidação de ácidos graxos Cetogênese

BioQ.22 852 22.01.07 18:27:50


858 | PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

excesso, de combustíveis provenientes do intestino. De


fato, pacientes com diabetes tipo I ficam presos ao es- CORRELAÇÃO CLÍNICA 22.10
tado de jejum, sem o benefício da parada geralmente
imposta, durante o jejum, pela baixa, mas constante, Caquexia do Câncer
produção de insulina pelo pâncreas. Isto leva a severo
desgaste dos tecidos do corpo e, no final, à morte, a me- Perda de peso sem explicação pode ser um sinal
nos que insulina seja administrada. de malignidade, e perda de peso é comum no cân-
cer avançado. Isto não é completamente explica-
do por perda de apetite e diminuição na ingestão
Câncer de alimentos. A perda de peso deve-se principal-
Tumores são compostos de células cancerosas, que mente a músculo esquelético e tecido adiposo,
precisam se alimentar como todas as células, mas ao sendo relativamente poupadas as proteínas vis-
contrário da maioria dos tecidos normais, tumores fun- cerais (i.é, fígado, rim e coração). Embora tumo-
cionam independentemente do ciclo jejum-alimentação res comumente apresentem velocidades altas de
(ver Corr. Clín. 22.10). Sua demanda por glicose como glicólise, a necessidade energética do tumor pro-
fonte de energia e aminoácidos para síntese protéica é vavelmente não explica a perda de peso, uma vez
incessante. Geralmente, preferem glicose e raramente que pode ocorrer mesmo com tumores peque-
se adaptam, na fase de jejum do ciclo jejum-alimenta- nos. Anomalias endócrinas foram identificadas
ção, ao uso de ácidos graxos e corpos cetônicos para em pacientes com câncer. Os pacientes tendem
minimizar seu uso de glicose, para benefício do resto do a ser resistentes à insulina, têm níveis elevados
corpo. A maioria dos tumores não responde a mudan- de cortisol, e têm alta taxa de metabolismo basal.
ças hormonais que alteram os processos metabólicos Alguns tumores sintetizam e secretam peptídeos
em tecidos normais. Estabelecem um ciclo de Cory com biologicamente ativos como ACTH, fator de cres-
o fígado, mas ainda assim podem oxidar completamen- cimento neural, e fator de crescimento tipo-insu-
te quantidades substanciais de glicose, contanto que lina, que podem modificar o metabolismo ener-
oxigênio esteja disponível (Figura 22.24e). Células do gético. A resposta do hospedeiro a um tumor, por
centro de um tumor estão freqüentemente em hipóxia analogia com infecção crônica, inclui liberação
porque cânceres muitas vezes ultrapassam o desenvol- de interleucina-1 (IL-1), interleucina-6 (IL-6) e
vimento de vasos sangüíneos, que trazem oxigênio. Fal- fator de necrose tumoral α (TNF-α) por células
ta de oxigênio em qualquer célula, normal ou cancero- imunes. TNF-α é também chamado caquexina,
sa, leva a um aumento em fator 1 hipóxia induzidoα porque produz depauperamento. TNF-α e IL-1
(HIF-1α), um fator de transcrição excepcionalmente podem atuar de modo parácrino, uma vez que
potente para ativação de genes que codificam trans- seus níveis plasmáticos não ficam elevados. Es-
portadores de glicose e as enzimas da glicólise. HIF-1α tas citocinas estimulam febre, proteólise, lipólise
também se torna constitutivamente ativo em algumas e secreção de reagentes de fase aguda pelo fíga-
células cancerosas devido a mutações que ativam certos do. Estudos mais recentes identificaram o fator
oncogenes. Como uma conseqüência da ação de HIF-1α, indutor de proteólise (PIF) e o fator mobilizador
a maioria dos tumores de câncer tem excepcional capa- de lipídeo (LMF) como produtos de tumores que
cidade de gerar ATP por glicólise. Glicólise não é um estimulam catabolismo de proteína esquelética e
processo eficiente, em comparação com oxidação com- consumo do tecido adiposo, respectivamente.
pleta de glicose, mas utilização eficiente dos recursos
do corpo não é característica de um câncer. Capacidade
excepcional de gerar ATP por glicólise permite às célu- Fonte: Beutler, B. e Cerami, A. Tumor necrosis, ca-
las cancerosas sobreviverem e crescerem enquanto se chexia, shock, and inflammation: a common mediator.
espalham e dão metástases em regiões de baixa tensão Annu. Rev. Biochem. 57:1505, 1988. Tracey, K. J. e Ce-
de oxigênio. rami, A. Tumor necrosis factor: A pleitropic cytokine
and therapeutic target. Annu. Rev. Med. 45:491, 1994.
Nitenberg, G. e Raynard, B. Nutritional support of the
Exercícios Aeróbico e Anaeróbico cancer patients: issues and dilemmas. Crit. Rev. On-
Exercício aeróbico é exemplificado por corrida de longa col. Hematol. 34:137, 2000. Tisdale, M. J. Cancer ano-
distância, exercício anaeróbico por corrida de velocida- rexia and cachexia. Nutrition 17:438, 2001. Wray, C. J.,
de ou levantamento de peso. Durante exercício anaeró- Mammen, J. M. e Hasselgren, P. O. Catabolic response
bico, existe pouca cooperação interórgãos. to stress and potential benefits of nutrition support.
Os vasos sangüíneos do interior dos músculos são Nutrition 18:971, 2002.
comprimidos durante o pico de contração, de modo que
suas células ficam isoladas do resto do corpo e depen- para síntese de ATP (Figura 22.6), até que glicogenó-
dem muito de seu próprio glicogênio e fosfocreatina. lise e glicólise sejam estimuladas. Por falta de oxigê-
Fosfocreatina é uma fonte de fosfato de alta energia nio, glicólise torna-se a fonte primária de ATP. Durante

BioQ.22 858 22.01.07 18:27:58


870 | PARTE 5 PROCESSOS FISIOLÓGICOS

PARTE 5 PROCESSOS FISIOLÓGICOS

23
ACTH

AC

2
Proteína G cAMP
ATP
PKA
PKAi

BIOQUÍMICA
DE HORMÔNIOS
Thomas J. Schmidt e Gerald Litwack

23.1 VISÃO GERAL, 871 Sistemas hormonai s cíclicos, 887


Síntese de melatonina e serotonina é con-
23.2 HORMÔNIOS E O SISTEMA DE CASCATA trolada por ciclos claro/escuro, 887
HORMONAL, 872 Ciclo ovariano é controlado por secreção pulsátil
Sistema de cascata amplifica sinais específicos, e cíclica de hormônio liberador de gonadotro-
872 pina, 888
Principais hormônios polipeptídicos e suas ações, Ausência de fertilização, 888
874 Fertilização, 889
Hormônios polipeptídicos e pituitária
anterior, 874 23.5 RECEPTORES DE HORMÔNIOS DE MEMBRA-
NA, 891
23.3 SÍNTESE DE HORMÔNIOS POLIPEPTÍDICOS E Algumas interações hormônio-receptor envolvem
HORMÔNIOS DERIVADOS DE AMINOÁCIDOS, múltiplas subunidades hormonais, 891
875 Receptor β-adrenérgico, 892
Hormônios polipeptídicos: codificação gênica, 875 Internalização de receptores, 893
Pró-opiomelanocortina é precursor de oito Clatrina direciona internalização de
hormônios, 875 complexos hormônio-receptor da membra-
Genes de hormônios polipeptídicos podem na plasmática, 894
codificar peptídeos adicionais, 880
Um gene pode codificar múltiplas cópias 23.6 CASCATA HORMONAL INTRACELULAR: PRO-
de um hormônio, 881 TEÍNAS QUINASES, 894
Hormônios derivados de aminoácidos, 882 Receptor de insulina: transdução por tirosina
Epinefrina é sintetizada a partir de tirosina, quinase, 895
882 Atividade de vasopressina: proteína quinase A,
Síntese de hormônio da tireóide requer incor- 897
poração de iodo em tirosinas da tireoglo- Hormônio liberador de gonadotropina (GnRH):
bulina, 883 proteína quinase C, 898
Inativação e degradação de hormônios derivados Atividade do fator natriurético atrial (ANF):
de aminoácidos, 883 proteína quinase G, 900

23.4 PROTEÍNAS DE SINALIZAÇÃO HORMONAL, 23.7 HORMÔNIOS ESTERÓIDES, 902


883 Estruturas e funções de hormônios esteróides,
Visão geral da sinalização, 883 902
Receptores de membrana, 883 Biossíntese de hormônios esteróides, 902
Cascata de sinalização intracelular: se- Metabolismo de hormônios esteróides, 905
gundos mensageiros, 885 Regulação da síntese de hormônios esteróides, 907

BioQ.23 870 22.01.07 18:32:35


CAPÍTULO 23 BIOQUÍMICA DE HORMÔNIOS | 875
dia), prolactina (PRL), hormônio folículo-estimulante
CORRELAÇÃO CLÍNICA 23.1 (FSH) e hormônio luteinizante (LH). Todos são cadeias
polipeptídicas únicas, exceto TSH, FSH e LH, que são
Testando a Atividade da dímeros que compartilham uma subunidade α seme-
Pituitária Anterior lhante ou idêntica. Como o lóbulo intermediário no ho-
mem é rudimentar, os níveis circulantes de α e β-MSH
Hormônios liberadores e análogos químicos, par- livres são relativamente baixos. É de interesse, parti-
ticularmente dos peptídeos menores, são hoje cularmente no homem, o fato dos receptores de MSH
sintetizados rotineiramente. O hormônio libe- reconhecerem e serem ativados por ACTH, já que os
rador de gonadotropina, um decapeptídeo, está 13 primeiros aminoácidos do ACTH contêm a seqüên-
disponível para uso na avaliação da função da cia do α-MSH. Por esta razão, ACTH pode ser um fator
pituitária anterior. Isto é de importância quan- contribuinte importante para a pigmentação da pele e
do uma situação de doença puder envolver o hi- pode exceder a importância de MSH, especialmente em
potálamo, a pituitária anterior ou o órgão final. condições em que o nível circulante de ACTH é alto. As
Esterilidade é um exemplo de tal situação. O que conseqüências clínicas do hipopituitarismo são apre-
precisa ser avaliado é qual o órgão defeituoso na sentadas na Correlação Clínica 23.2.

|
cascata hormonal. Isto pode ser conseguido por
injeção do hormônio da pituitária anterior LH ou
FSH. Se a secreção de hormônio sexual foi de-
23.3 SÍNTESE DE HORMÔ-
sencadeada, então a glândula final parece estar NIOS POLIPEPTÍDICOS
funcionando adequadamente. A seguir, a pituitá-
ria anterior deveria ser analisada. Isto pode ser
E HORMÔNIOS DERI-
feito por administração i.v. de GnRH sintético; VADOS DE AMINOÁCI-
por esta via, GnRH pode chegar às células gona-
dotrópicas da pituitária anterior e desencadear
DOS
secreção de LH e FSH. Rotineiramente, os níveis
de LH são medidos no sangue como uma função
do tempo após a injeção. Estes níveis são medi- Hormônios Polipeptídicos:
dos por radioimunoensaio (RIA), no qual LH ou Codificação Gênica
hCG é deslocado da ligação com uma proteína de
ligação ao LH na amostra de soro. A extensão da Genes de hormônios polipeptídicos contêm a seqüência
competição é proporcional à quantidade de LH codificadora do hormônio e os elementos de controles
no soro. Deste modo, uma progressão da respos- a montante (upstream) do gene estrutural. Em alguns
ta é medida e estará dentro dos limites normais casos, mais de um hormônio é codificado em um gene.
ou claramente deficientes. Se a resposta for de- Por exemplo, pró-opiomelanocortina gera pelo menos
ficiente, as células da pituitária anterior não es- oito hormônios a partir de um único produto gênico.
tão funcionando normalmente e são a causa da Ocitocina e vasopressina são codificados por genes se-
síndrome. Por outro lado, resposta normal da pi- parados, juntamente com suas respectivas proteínas
tuitária a GnRH indicaria que o hipotálamo não neurofisinas. Neurofisinas são co-secretadas com
está funcional. Tal descoberta sugeriria exame seus respectivos hormônios, mas não têm ação endó-
do hipotálamo, quanto a condições que levam à crina conhecida.
disponibilidade/produção insuficiente de hormô-
nios liberadores. Obviamente, o conhecimento da Pró-opiomelanocortina É Precursor de
estrutura do hormônio e a capacidade de sinteti- Oito Hormônios
zar hormônios específicos permite o diagnóstico
destas doenças. Pró-opiomelanocortina é um precursor de hormônios
para os seguintes hormônios: ACTH, β-lipotropina, γ-li-
Fonte: Marshall, J. C. e Barkan, A. L. Disorders of the potropina, γ-MSH, α-MSH, CLIP, β-endorfina e poten-
hypothalamus and anterior pituitary. Em: W. N. Kelley cialmente β-MSH e encefalinas (Figura 23.5). Nem to-
(Ed.), Internal Medicine. New York: Lippincott, 1989, dos estes produtos são expressos simultaneamente em
p. 2159. Conn, P. M. The molecular basis of gonadotro- um único tipo celular, mas são produzidos em células
pin-releasing hormone action. Endocr. Rev. 7: 3, 1986. separadas com base em seu conteúdo de proteases es-
pecíficas necessárias, controles metabólicos específicos
e a presença de reguladores. Assim, enquanto pró-opio-
melacortina é expressa em corticotropos da pituitária
anterior e em células da pars intermedia, o estímulo
e os produtos são diferentes (Tabela 23.3). Pars inter-
media é uma estrutura anatômica discreta, localizada

BioQ.23 875 22.01.07 18:32:42


CAPÍTULO 23 BIOQUÍMICA DE HORMÔNIOS | 897
tas seqüências de aminoácidos em torno de um resíduo Atividade de Vasopressina: Proteína
de fosfotirosina. Várias vias diferentes são ativadas, e
estas incluem ativação de PI3 quinase (fosfatidilinositol Quinase A
3´-OH quinase), Ras (proteína pequena que liga GTP), a Arginina angiotensina (AVP), ou hormônio antidiu-
cascata da MAP quinase (proteína quinase ativada por rético, causa reabsorção de água aumentada da urina
mitose) e TC10 (proteína pequena que liga GTP). Uma no rim distal. Um mecanismo para este sistema é apre-
vez ativada por troca de GTP por GDP, TC10 promove sentado na Figura 23.30. Neurônios que sintetizam AVP
translocação de vesículas de GLUT4 para a membrana (neurônios vasopressinérgicos) liberam AVP em res-
plasmática, talvez por estabilização de filamentos de posta a estímulos de barorreceptores que respondem
actina corticais. Estas vias atuam de modo orquestra- a uma queda na pressão do sangue ou de osmorrecep-
do para coordenar a regulação do tráfego de vesículas tores que respondem a um aumento na concentração
[incorporação de transportador 4 de glicose (GLUT4) à extracelular de sal. VP liga-se a seu receptor de mem-
membrana plasmática], síntese de proteínas, ativação e brana cognato no rim distal, na pituitária anterior, em
inativação de enzimas e expressão gênica. O resultado hepatócitos e, talvez, em outros tipos celulares, No rim,
final destas diversas vias é regulação do metabolismo a ligação de AVP a seu receptor acoplado a proteína G
de glicose, lipídeos e proteínas, bem como crescimento estimula a atividade de adenilato ciclase e ativa proteí-
e diferenciação celular. A importância da atividade da na quinase A, que fosforila subunidades que se agregam
quinase do receptor de insulina e da via geral de trans- para formar canais aquosos específicos, ou aquapori-
dução de sinal da insulina é enfatizada na Correlação nas (ver p. 459).
Clínica 23.3. Água atravessa a célula do rim para o lado basolate-
ral e depois entra na circulação geral, onde dilui a con-
centração de sal. Mutações específicas nas seqüências

CORRELAÇÃO CLÍNICA 23.3


Atividade Reduzida do Receptor de Insulina Quinase no Diabetes
Mellitus Gestacional

Durante a gravidez, uma importante adaptação me- GDM. Dados recentes indicam que defeitos na ação
tabólica materna é uma redução na sensibilidade à da insulina, e não diminuição na afinidade da insuli-
insulina. Esta adaptação ajuda a fornecer glicose na pelo receptor, podem contribuir para a patogêne-
adequadamente para o feto em desenvolvimento. se de GDM. Mais especificamente, células de múscu-
Entretanto, em 3-5% das mulheres grávidas, de- lo esquelético de sujeitos com GDM aparentemente
senvolve-se intolerância a glicose. Diabetes mellitus expressam excesso de glicoproteína-1 de membrana
gestacional (GDM) é caracterizada por um decrés- plasmática (PC-1), que se verificou inibir a atividade
cimo adicional na sensibilidade a insulina e uma in- de tirosina quinase do receptor de insulina, por inte-
capacidade de compensar com secreção aumentada ragir diretamente com as subunidades α e bloquear
de insulina. Embora ambos resistência à insulina a mudança conformacional induzida por insulina.
induzida pela gravidez e GDM sejam geralmente re- Além disso, excessiva fosforilação de resíduos de se-
versíveis após a gravidez, aproximadamente 30-50% rina/treonina localizados nos receptores de insulina
das mulheres com história de GDM desenvolvem do músculo parece regular negativamente (down-
diabetes tipo 2 mais tarde na vida, especialmente regulate) a atividade de tirosina quinase em GDM.
se forem obesas. Embora os mecanismos celulares Assim, uma superexpressão de PC-1 e um decrés-
responsáveis pela resistência à insulina em GDM cimo na atividade quinase do receptor, acoplados
não sejam totalmente conhecidos, a resistência ao com expressão e fosforilação (resíduos de tirosina)
transporte de glicose mediado por insulina pare- diminuídas do substrato 1 do receptor de insulina
ce ser maior em músculo esquelético de indivíduos (IRS-1; ver Figura 20.29), podem estar por trás da
com GDM do que em mulheres grávidas que não têm resistência à insulina em GDM.

Fonte: Shao, J., Catalono, P. M., Hiroshi, Y., Ruyter, I., Smith, S., Youngreen, J. e Friedman, J. E. Decreased insulin
receptor tyrosine kinase activity and plasma cell membrane glycoprotein-1 overexpression in skeletal muscle from
obese women with gestational diabetes mellitus (GDM). Diabetes 49(4): 603, 2000. Maddux, B. A. e Goldfine, I. D.
Membrane glycoprotein PC-1 inhibition of insulin receptor function occurs via direct interaction with the receptor
alpha-subunit. Diabetes 49(1): 13, 2000.

BioQ.23 897 22.01.07 18:33:26


914 | PARTE 5 PROCESSOS FISIOLÓGICOS

Transporte de Hormônios disso, a concentração total (ligada mais não-ligada)


de testosterona é cerca de 40 vezes maior em homens.
Esteróides: Proteínas de Ligação A própria testosterona reduz os níveis de SHBG (au-
Quatro proteínas plasmáticas principais respondem menta a porcentagem de testosterona livre) no sangue,
pela ligação dos hormônios esteróides no sangue. Elas enquanto 17β-estradiol e hormônio da tireóide elevam
são globulina de ligação a corticoesteróides, proteína os níveis de SHBG no sangue. Durante a gravidez e no
de ligação a hormônios sexuais, proteína de ligação a hipertireoidismo, as porcentagens de testosterona e de
andrógenos e albumina. A maior parte do cortisol cir- 17β-estradiol não-ligados estariam reduzidas.
culante (75-80%) ocorre ligado a uma α2 -globulina de Proteína de ligação a andrógeno (ABP) é produ-
ligação a corticosteróide (CBG) específica, também zida pelas células de Sertoli em resposta a testosterona
conhecida como transcortina. Cada molécula desta e FSH, que estimulam síntese de proteínas nessas cé-
glicoproteína liga uma única molécula de cortisol, com lulas. ABP é também chamada globulina de ligação
Ka de 2,4  107 M-1. A concentração normal de transcor- a testosterona-estrógeno (TeBG). Esta proteína é
tina no plasma é 3 mg/dl, e sua capacidade de ligação é semelhante a SHBG, exceto que se localiza no testículo
20 μg de cortisol/dl. Cerca de 15% do cortisol do plas- e ajuda a manter níveis locais elevados de andrógeno no
ma ocorre ligado a albumina, com uma afinidade muito testículo e no líquido seminal. Estes níveis locais de an-
mais baixa (Ka = 103 M-1). Portanto, embora albumina drógeno elevados são importantes no desenvolvimento
esteja presente em concentração 1.000 vezes superior e maturação dos espermatozóides. Progesterona liga-se
à de CBG, cortisol vai preencher primeiro os sítios de fracamente a transcortina e albumina, e sua meia-vida
ligação em CBG. A concentração de transcortina, e por- circulante é apenas cerca de 5 minutos.
tanto de cortisol, está aumentada durante a gravidez e

|
administração de estrógeno. Durante o estresse, quan-
do os níveis de cortisol são altos, os sítios de ligação de
23.8 RECEPTORES DE
CBG estarão saturados, e o excesso de cortisol se ligará HORMÔNIOS
a albumina. Apenas 5-10% do cortisol plasmático está
normalmente livre (não-ligado). Cortisol livre difunde-
ESTERÓIDES
se através da membrana plasmática, liga-se aos recep-
tores intracelulares de cortisol, e medeia uma resposta
biológica. Em contraste com cortisol, apenas 50-70% da Hormônios Esteróides Ligam-se a
aldosterona circulante fica ligada com baixa afinidade Proteínas Receptores Intracelulares
a albumina e transcortina. Portanto, aldosterona tem
uma meia-vida mais curta no plasma (20 minutos) em Receptores de hormônios esteróides e receptores de
comparação com cortisol (70 minutos). não-esteróides (i. é, hormônio da tireóide, ácido retinói-
Globulina de ligação a hormônios sexuais co, vitamina D3) localizam-se intracelularmente. O re-
(SHBG) liga andrógenos com uma constante de afini- ceptor de glucocorticóide não-ligado e, possivelmente,
dade de cerca de 109 M-1. Cerca de 65% da testostero- o receptor de aldosterona parecem residir no citoplas-
na são ligados a esta glicoproteína derivada do fígado. ma, enquanto os outros receptores não-ligados locali-
Apenas 1-2% da testosterona circulante está na forma zam-se dentro do núcleo, provavelmente em associação
livre, e o andrógeno restante está ligado a albumina e com a cromatina. Na Figura 23.48, a Etapa 1 mostra
a outras proteínas. As frações ligadas a SHBG servem, um hormônio esteróide se dissociando de uma proteína
portanto, como reservatórios circulantes de testoste- plasmática transportadora. O esteróide livre entra na
rona. Cerca de 60% dos estrógenos são transportados célula por difusão, através da bicamada lipídica (Etapa
ligados a SHBG, 20% são ligados a albumina , e 20% na 2). Cortisol liga-se a seu receptor com uma constante
forma livre. Entretanto, estradiol liga-se a SHBG com de afinidade de 109 M-1, comparada a uma constante
uma afinidade muito mais baixa do que testosterona. de afinidade de cerca de 107 M-1 para CBG. O receptor
Assim, estradiol ligado a SHBG dissocia-se muito rapi- não-ligado (neste caso, receptor de glucocorticóide) é
damente e é captado pelos tecidos alvos. Por esta ra- um complexo (~300 kDa) que contém outras proteínas
zão, mudanças nos níveis de SHBG no homem podem associadas, incluindo um dímero de uma proteína de
alterar a razão de andrógenos para estrógenos livres. A choque térmico 90 kDa, que mascara o domínio de li-
concentração plasmática de SHBG antes da puberdade gação ao DNA do receptor (Figura 23.49), e outra prote-
é aproximadamente a mesma em homens e mulheres. ína de choque térmico designada por Hsp56, que é uma
Entretanto, na puberdade, há um pequeno decréscimo imunofilina que liga várias drogas imunossupressoras.
em mulheres e um decréscimo maior em homens, ga- Ligação do ligante esteróide (Etapa 3) causa uma mu-
rantindo uma quantidade relativamente maior de tes- dança conformacional, chamada “ativação”, da própria
tosterona circulante não-ligada em homens. Homens proteína do receptor, resultando em liberação das prote-
adultos têm cerca da metade da SHBG circulante de ínas associadas, incluindo o dímero Hsp90, e exposição
mulheres, de modo que testosterona livre é cerca de 20 dos resíduos de aminoácidos carregados positivamente
vezes mais alta em homens do que em mulheres. Além localizados no domínio de ligação ao DNA (Etapa 4).

BioQ.23 914 22.01.07 18:34:18


CAPÍTULO 24 BIOLOGIA MOLECULAR DAS CÉLULAS | 925

PARTE 5 PROCESSOS FISIOLÓGICOS

�� �
���
��
����

24
��

BIOLOGIA MOLECULAR
DAS CÉLULAS
Thomas E. Smith

24.1 VISÃO GERAL, 926 Estrutura e caracterização de algumas proteínas


envolvidas nos processos contráteis, 956
24.2 TECIDO NERVOSO: METABOLISMO E FUN- Miosina forma filamentos grossos do múscu-
ÇÃO, 926 lo, 956
ATP e potencial elétrico transmembrânico em Actina, tropomiosina e troponina são proteí-
neurônios, 928 nas de filamentos finos, 957
Interação neurônio-neurônio ocorre por meio de Contração muscular requer Ca 2+, 961
sinapses, 929 Reservatórios de energia para contração muscu-
Síntese, armazenamento e liberação de neuro- lar, 961
transmissores, 930 Modelo de contração do músculo esquelético: o
Terminação de sinais em junções sinápticas, 934 golpe de força, 963
Acetilcolina, 934 Cálcio Regula a Contração do Músculo Liso,
Catecolaminas, 935 963
5-Hidroxitriptamina (serotonina), 936 Envolvimento de óxido nítrico e monóxido de
γ-Aminobutirato (GABA), 936 carbono na contração muscular, 964
Neuropeptídeos são derivados de proteínas pre- Outras classes de miosinas e motores molecula-
cursoras, 937 res, 965
Miosinas não-convencionais e suas funções,
24.3 OLHO: METABOLISMO E VISÃO, 938 965
Córnea deriva ATP de metabolismo aeróbico, 938 Cinesinas, 966
Cristalino consiste principalmente de água e Dineína, 967
proteína, 939
Retina deriva ATP de glicólise anaeróbica, 941 24.5 MECANISMO DA COAGULAÇÃO DO SANGUE,
Transdução visual envolve eventos fotoquímicos, 967
bioquímicos e elétricos, 941 Processos bioquímicos da hemostasia, 967
Bastonetes e cones são células fotorreceptoras, 943 Fase pró-coagulante da hemostasia (fase 1),
Visão de cores origina-se nos cones, 951 969
Visão de cores é tricromática, 951 Via extrínseca e início da coagulação, 969
Outras diferenças entre bastonetes e cones, 952 Formação de trombina, 970
Reações da via intrínseca, 970
24.4 MOTORES MOLECULARES E PROTEÍNAS AS- Algumas propriedades das proteínas envolvi-
SOCIADAS, 952 das na formação do coágulo, 971
Contração muscular, 953 Formação da rolha de plaquetas, 975
Contração do músculo esquelético, 953 Fase anticoagulante da hemostasia (fase 2), 975
Organização estrutural dos componentes do Inibição da via extrínseca, 975
músculo esquelético, 953 Inativação de FVa e FVIIIa, 978

BioQ.24 925 22.01.07 19:35:10


938 | PARTE 5 PROCESSOS FISIOLÓGICOS

TABELA 24.3 Peptídeos Encontrados no Tecido Cerebrala


Peptídeo Estrutura

β-Endorfina YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Met-encefalina YGGFM

Leu-encefalina YGGFL

Somatostatina AGCKNFFW
| |
CSTFTK

Hormônio liberador de hormônio luteinizante p-E H W S Y G L R P G NH2

Hormônio liberador de tirotropina p-E H P-NH2

Substância P R P K P E E F F G L M-NH2

Neurotensina p-E L Y E N K P R R P Y I L

Angiotensina I DRVYIHPFHL

Angiotensina II DRVYIHPF

Peptídeo intestinal vasoativo H S D A V F T D N Y T R L R K E M A V K K Y L N S I L N-NH2

a
Peptídeos com “p” precedendo a estrutura indicam que o N-terminal é piroglutamato. Aqueles com NH2 na extremidade indicam
que o C-terminal é uma amida.

Cinesinas e miosinas, proteínas motores molecula- rem nutrição contínua obtida pelo uso de metabólicas
res (ver p. 966), facilitam este processo de transporte. convencionais apropriadas a suas necessidades espe-
Neuropeptídeos são mediadores de respostas senso- cíficas. Estruturas pigmentadas, como citocromos e
riais e emocionais, tais como as associadas com fome, mitocôndrias, ou não estão presentes em algumas es-
sede, sexo, prazer, dor e assim por diante. Incluídas nes- truturas ou estão arranjadas e distribuídas de modo a
ta categoria estão encefalinas, endorfinas e substân- não interferirem com o processo visual. Além disso, o
cia P. Substância P é um neurotransmissor excitatório cérebro desenvolveu um sistema de filtro enormemente
que desempenha um papel na percepção de dor. Está eficiente que torna objetos dentro do olho invisíveis, os
em uma classe de neuropeptídeos chamados neuroci- quais poderiam levar a distorção visual. Um diagrama
ninas. Seu receptor, NK-1 (ou neurocinina-1), é uma esquemático de um corte transversal do olho é apresen-
proteína tipo-G consistindo de sete elementos de héli- tado na Figura 24.16.
ces transmembrânicas. Endorfinas e opióides ligam-se A luz que entra no olho passa progressivamente por
a receptores que também têm sete elementos de hélices (a) a córnea, a câmara anterior que contém humor
transmembrânicas. Endorfinas desempenham papéis aquoso, (b) o cristalino, e (c) o corpo vítreo, que con-
na eliminação da sensação de dor. Alguns dos peptí- tém humor vítreo; finalmente focaliza na retina, que
deos encontrados no tecido cerebral são apresentados contém o aparelho sensor visual. Lágrimas banham o
na Tabela 24.3. Note que Met-encefalina é derivada da exterior da córnea, enquanto o interior é banhado pelo
região N-terminal da β-endorfina. Os aminoácidos da humor aquoso, um fluido isosmótico contendo sais, al-
extremidade N-terminal ou de ambas as extremidades bumina, globulina, glicose e outros constituintes.
N- e C-terminal de muitos neuropeptídeos transmisso- O humor aquoso traz nutrientes para a córnea e para
res são modificados. o cristalino, e remove produtos finais do metabolismo
deles. O humor vítreo é uma massa gelatinosa que ajuda

|
24.3 OLHO: METABOLISMO a manter a forma do olho, enquanto o mantém um tanto
flexível.
E VISÃO
Córnea Deriva ATP de Metabolismo
O olho, nossa janela para o mundo exterior, nos permite Aeróbico
ver as belezas da natureza, as belezas da vida e, consi-
derando o conteúdo deste livro, as belezas da bioquími- O olho é uma extensão do sistema nervoso e, como ou-
ca. Uma vista através de qualquer janela ou de qualquer tros tecidos do sistema nervoso central, seu principal
lente de câmera é mais clara quando não obstruída. O combustível metabólico é glicose. A córnea não é um
olho evoluiu de tal modo que um objetivo semelhante tecido homogêneo e obtém uma porcentagem relativa-
foi alcançado. É composto de tecidos vivos que reque- mente alta do seu ATP de metabolismo aeróbico. Cer-

BioQ.24 938 22.01.07 19:35:53


956 | PARTE 5 PROCESSOS FISIOLÓGICOS

Estrutura e Caracterização de
Algumas Proteínas Envolvidas nos CORRELAÇÃO CLÍNICA 24.7
Processos Contráteis Glicação e Estrutura e Função
de Miosina
Miosina Forma Filamentos Grossos do
Músculo Hiperglicemia prolongada afeta a função de mui-
tos sistemas. Glicose pode formar bases de Schiff
Miosina, uma molécula fibrosa longa com duas cabe- com amino grupos livres em proteínas e alterar
ças globulares em uma extremidade, consiste de duas sua função. Experimentos in vitro usando es-
cadeias pesadas de cerca de 230 kDa cada. Ligada perto pectroscopia de massa demonstram que miosina
de cada grupo de cabeça está um par não-semelhante também poderia ser glicada. A importância desta
de cadeias leves, cada uma das quais com aproxima- observação em envelhecimento e diabetes ainda
damente 20 kDa. As cadeias leves são proteínas “tipo- não foi determinada.
calmodulina” e estão envolvidas em vários aspectos da
regulação do processo, sendo que nem todos foram de- Fonte: Ramamurthy, B., Hook, P., Jones, A. D. e
finidos com clareza. Elas ligam motivos IQ em miosinas, Larsson, L. Changes in myosin structure and function
que estão localizados próximos dos grupos de cabeça e in response to glycation. FASEB J. 15:2415, 2001.
têm a seqüência consenso IQXXXRGXXXR.
A extremidade carboxila de cada cadeia de miosi-
na localiza-se na região da cauda, onde as duas cadeias A cabeça da miosina contém atividade de ATPase,
pesadas são enroladas uma na outra, num arranjo es- que fornece energia para contração, e sítios de ligação
piral-espiral (Figura 24.29m). Tripsina cliva a cauda de actina. O fragmento S-1 também contém sítios de
em cerca de um terço do seu comprimento a partir da ligação para a cadeia leve essencial e a cadeia leve
cabeça para produzir meromiosina pesada (o grupo regulatória que se liga nos motivos IQ, como mencio-
da cabeça e uma cauda curta) e meromiosina leve (o nado anteriormente. Um modelo da estrutura tridimen-
restante da região da cauda). Só a meromiosina leve sional do fragmento S-1 da miosina é apresentado na
pode agregar em condições fisiológicas in vitro, suge- Figura 24.31. A região de ligação à actina localiza-se no
rindo que agregação seja um dos seus papéis na forma- canto inferior direito, na região da fenda visível.
ção da cadeia pesada in vivo. A região da cabeça pode O fragmento S-1 tem várias regiões estruturais tipo-
ser clivada do restante da região de cauda por papaí- domínio com massas de 25, 50 e 20 kDa, coloridos em
na (Figura 24.29n), resultando em um fragmento do verde, vermelho e azul, respectivamente. A cadeia leve
grupo de cabeça chamado Subfragmento 1 ou S-1. A essencial (ELC) e a cadeia leve regulatória (RLC) são
ação destas proteases também demonstra que a molé- mostradas em amarelo e lilás, respectivamente (ver
cula tem pelo menos duas regiões de articulação, perto Corr. Clín. 24.8).
da junção cabeça-cauda. O sítio de ligação ao ATP, logo acima da fenda visível,
Análise de cDNAs de miosinas de muitas espécies também é uma fenda aberta de cerca de 13 Å de profun-
diferentes e tipos diferentes de músculos indicam didade e 13 Å de largura. É separada do sítio de ligação
que existe um grau muito alto de homologia entre
miosinas de diferentes fontes, particularmente na re-
gião da cabeça. Existe um pouco menos de homologia
de seqüência na região da cauda, mas homologia fun-
cional existe em um grau extraordinariamente alto,
independentemente do comprimento, que vai de cer-
ca de 86 a cerca de 150 nm para espécies diferentes.
A cabeça da miosina contém quase metade (cerca de
839 a cerca de 850) dos resíduos de aminoácidos da
molécula inteira, em mamíferos (ver Corr. Clín. 24.7).
Miosina forma um agregado simétrico cauda-cau-
da em torno da linha M da zona H dos sarcômeros.
Regiões de cauda são alinhadas de modo paralelo em
FIGURA 24.31
ambos os lados da linha M, com os grupos de cabeça Um modelo de preenchimento de espaço dos resíduos de
apontando para a linha Z. Cada filamento grosso con- aminoácidos no fragmento S-1 da miosina.
tém cerca de 400 moléculas de miosina. A proteína Os domínios de 25, 50 e 20 kDa da cadeia pesada são cinza-
escuro, cinza e cinza quase preto, respectivamente. As cadeias
C (Tabela 24.7) está envolvida em sua montagem. A leves essencial e regulatória são cinza-claro e cinza-médio,
proteína M também está envolvida, presumivelmen- respectivamente.
te, na manutenção das regiões de cauda juntas e em Reimpresso com permissão de Rayment, I., Rypniewski, W. R.,
Schmidt-Base, K., Smith, R., et al. Science 261:50, 1993. Direitos
sua ancoragem na linha M. autorais (1993) AAAS.

BioQ.24 956 22.01.07 19:36:31


CAPÍTULO 24 BIOLOGIA MOLECULAR DAS CÉLULAS | 967
Cinesina-13 também é uma cinesina cromossômica (+) Microtúbulo (–) �1
e está provavelmente envolvida no movimento mitótico
dos cromossomos. 5 4
Cinesina-14 está entre os motores de extremidade- 6 Golpe de força
3
menos como a cinesina mitótica Ncd em Drosophila, (sem carga)
que funciona nos estágios iniciais da mitose. Localiza- 2
1
se nos fusos de oócitos. ADP + Pi
ATP
Cinesinas-1 e -2 estão mais relacionadas com o ma- Carga
terial discutido neste capítulo, embora as outras este- ATP or ADP

jam associadas com aspectos mais gerais da divisão ce- �2


lular e do movimento associado de vários componentes
associados com este processo. A
Golpe de força
A
Dineína A (sob carga)

Existem duas classes de motores dineínas: (a) axonê- ATP


ADP + Pi
mica, que funciona na realização do movimento de fla-
gelos e cílios, e (b) citoplasmática, que efetua a distri- FIGURA 24.39
buição e a organização de estruturas citoplasmáticas. Dineína funciona como uma molécula motora.
Redesenhado de Mallik, R., Carter, B. C., Lex, S. A., King, S. J. e
Estas funções incluem seleção e movimento de prote- Gross, S. P. Cytoplasmic dynein functions as a gear in response
ínas; organização dos cromossomos durante vários es- to load. Nature 427:649, 2004.
tágios de sua função; distribuição e/ou redistribuição
de organelas como endossomos, lisossomos e outros;

|
e transporte axonal retrógrado – isto é, transporte de
carga na direção oposta à da maioria das cinesinas. 24.5 MECANISMO DA
A estrutura da dineína é muito mais complexa do
que as das outras duas classes de motores. Dineína tem
COAGULAÇÃO DO
uma estrutura em anel plano de seis membros que tem, SANGUE
no total, aproximadamente 10 vezes a massa molecular
das cinesinas. Uma representação esquemática de sua
A circulação do sangue ocorre em um tipo muito es-
estrutura é mostrada na Figura 24.39.
pecializado de sistema fechado no qual o volume do lí-
ATP liga com um motivo AAA no domínio 1. Sua liga-
quido circulante é mantido quase constante. Múltiplas
ção e hidrólise induz mudanças conformacionais que são
funções do sistema tornam a transferência de solutos
transmitidas pelos domínios 2-4 para a haste que intera-
através de seus limites uma função necessária. Como
ge com microtúbulos e causa movimentos de passos de
em qualquer sistema de canos e tubos, vazamentos po-
24-32 nm para uma dineína descarregada. O movimento
dem ocorrer como resultado de vários tipos de agres-
de dineína responde à carga de modo parecido com mu-
sões e devem ser reparados para manter um estado de
dança para marcha mais lenta e, com carga pesada, dá
hemostasia, isto é, sem sangramento.
passos de aproximadamente 8 nm. Essa mudança pare-
ce estar associada com mudanças conformacionais em
vários de seus outros domínios e com a disponibilidade Processos Bioquímicos da
de ATP. Em condições de carga pesada, ATP também pa- Hemostasia
rece ligar motivos AAA no domínio 3. Motivos AAA são
regiões conservadas de 220-230 resíduos de aminoácidos Hemostasia implica em que o processo de formação
que existem em uma família de proteínas que participam do coágulo (pró-coagulação, designada como Fase
em várias atividades celulares diferentes, que dependem 1) esteja em equilíbrio com processos de parada de
de energia de hidrólise de ATP para afetar suas fun- formação do coágulo (anticoagulação, Fase 2) e de
ções, que podem incluir proteólise, dobramento e des- dissolução do coágulo (fibrinólise, Fase 3). Pró-co-
dobramento de proteínas, metabolismo de íon de metal, agulação leva à produção de fibrina a partir de fibrino-
e outras atividades, além das associadas com dineína. O gênio e agregação em uma rede insolúvel, ou coágulo,
nome do motivo AAA refere-se a “ATPase Associada com que recobre a área da ruptura e impede maior perda de
diversas Atividades celulares”. sangue. Concomitantemente, agregação de plaquetas do
Note que (1) dineínas como motores são estrutural- sangue ocorre no local da lesão. Agregação plaquetária
mente mais complexas do que miosinas ou cinesinas, (2) forma uma rolha física para ajudar a parar o vazamento.
estão geralmente envolvidas em movimento retrógrado Plaquetas também sofrem alterações morfológicas que
de material celular, (3) estão envolvidas em vários outros liberam (a) alguns compostos químicos que ajudam em
aspectos de organização estrutural, e (4) seu movimento outros aspectos do processo todo, como vasoconstrição
de passo ao longo dos microtúbulos é carga-dependente. para reduzir o fluxo de sangue para a área e (b) enzi-

BioQ.24 967 22.01.07 19:37:01


CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER | 987

PARTE 5 PROCESSOS FISIOLÓGICOS

25
(Separação de cromátides e divisão celular)
M

G2 G1 G0

S
(Duplicação do DNA)

CICLO CELULAR, MORTE


CELULAR PROGRAMADA E
CÂNCER
Richard M. Schultz

25.1 VISÃO GERAL, 988 Metástase de células de câncer, 999


Angiogênese induzida por células de câncer,
25.2 CICLO CELULAR, 988 1000
Regulação do ciclo celular, 989 Múltiplas mutações são necessárias para formar
Regulação de Rb, 990 um câncer, 1001
Regulação de p53, 991 Heterogeneidade genética e bioquímica de cân-
Transdução de sinal de fator de crescimento, ceres, 1001
991 Agentes mutagênicos e promotores causam cân-
cer, 1004
25.3 APOPTOSE: MORTE CELULAR Análise bioquímica de cânceres, 1004
PROGRAMADA, 993
Principais vias, 994 BIBLIOGRAFIA, 1005
Via do receptor de morte, 994
Vias mitocondriais, 995 QUESTÕES E RESPOSTAS, 1007
Apoptose induzida por p53, 996
Regulação de apoptose por MAPK, 996 CORRELAÇÕES CLÍNICAS
25.1 Vírus Oncogênicos de DNA, 999
25.4 CÂNCER, 997 25.2 Droga Anti-Câncer Molecularmente Dirigi-
Oncogenes e genes supressores de tumor, 997 da, 1002
Propriedades de células de câncer, 998 25.3 Causa Ambiental de Cânceres Humanos,
Imortalidade das células de câncer, 999 1003

BioQ.25 987 22.01.07 18:41:43


CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER | 993
te um sinal por meio de uma mudança conformacional e
associações proteína-proteína. �������
Grb2 contém ambos os domínios SH2 e SH3. Liga-
ção de Grb2 ao receptor de PDGF por seu domínio SH2
induz uma mudança conformacional que abre seus do- ������
mínios SH3 para ligar uma região de hélice poliprolina
na proteína GEF Ras, que depois se liga a Ras e catali-
sa a troca de seu GDP ligado por GTP (Figura 25.8).
GPT-Ras é a forma ativa de Ras. Ras é uma enzima
GTPase e se inativa por catalisar a hidrólise do GTP ������

ligado em GDP.
Mutações no gene Ras que resultam em Ras consti-
tutivamente ativo ocorrem em aproximadamente 30%
dos cânceres humanos. As mutações comumente en- ����
contradas são nos resíduos de aminoácidos 12, 13 e 61,
que participam da atividade de Ras GTPase, de modo
que Ras mutado não pode se desativar e permanece em
uma conformação GTP-Ras ativa.
No Ras normal, a atividade de Ras GTPase é aumen- ����������������������
���������
tada 100 a 1000 vezes pela ligação de Ras a GAPRas
(GAP, proteína ativadora de GTPase). Entretanto, a li-
gação de GAPRas ao Ras mutado cataliticamente inerte FIGURA 25.9
GTP-Ras ativa uma cascata de quinases.
não tem efeito, porque sua atividade de GTPase está Ras-GTP ativa uma cascata de quinases resultando na
ausente. fosforilação e ativação da quinase terminal MAPK. MAPK
Ras também precisa se associar com a membra- ativada entra no núcleo e fosforila fatores de transcrição que
regulam a expressão de proteínas envolvidas na fase S. MAPK
na plasmática para ser ativado. Isto é conseguido por é mitógeno-ativada proteína quinase, MAPKK é MAP quinase
modificações pós-tradução que incluem remoção por quinase, e MAPKKK é MAP quinase quinase quinase.
uma protease do tetrapeptídeo C-terminal, metilação
do novo grupo ácido carboxílico C-terminal e adição de
um grupo ácido graxo farnesil a uma cadeia lateral de fatores de transcrição, como Jun e Fos, aumentando as-
cisteína na extremidade COOH-terminal. Em algumas sim a transcrição de genes como o fator de transcrição
isoformas de Ras, um segundo grupo acil graxo é adi- Myc e as ciclinas de G1 envolvidas na divisão celular.
cionado, perto da extremidade COOH-terminal. Myc aumenta a expressão de muitos genes envolvidos
Três genes Ras diferentes existem no homem – H- na fase S, incluindo as S-ciclinas e o fator de transcri-
ras, N-ras e K-ras – que produzem proteínas homólo- ção E2F (ver p. 211). Entretanto, se as condições não
gas de 21 kDa. As seqüências de aminoácidos de seus forem adequadas para divisão celular, Myc pode iniciar
primeiros 85 resíduos são idênticas, e os seguintes um processo levando à morte celular.
80 resíduos mostram 85% de homologia, mas as ex-

|
tremidades C-terminais diferem mais dramaticamen-
te. Embora existam diferenças em alguns dos sinais 25.3 APOPTOSE:
posteriores entre as isoformas de Ras, em geral seus
sinais se sobrepõem. Estas isoformas são caracteris-
MORTE CELULAR
ticamente expressas em diferentes tipos celulares, e PROGRAMADA
mutações nos resíduos 12, 13 e 61 ativam constitutiva-
mente todas elas. Apoptose é a palavra grega para “folhas que caem”,
Como ativação da atividade de Ras promove o fe- e apoptose descreve um processo bioquímico freqüente
nótipo câncer, genes Ras são conhecidos como proto- natural de morte celular. Morte apoptótica é necessá-
oncogenes. Proto-oncogenes são transformados em ria durante processos de desenvolvimento, bem como
oncogenes por uma mutação ativadora que promove para manter a homeostase de um organismo inteiro. À
ou mantém uma célula cancerosa. O oncogene ras dá medida que novas células são geradas no homem, mor-
continuamente um sinal de fator de crescimento que te de um número semelhante de células é necessária
promove divisão celular, em ausência de ativação an- na mesma escala de tempo para manter um estado es-
terior. tacionário. Morte apoptótica difere da morte celular
GTP-Ras transmite seu sinal de divisão celular por necrótica. Na última, lise de uma membrana celular
ativação de MAP quinase quinase quinase (MAPKKK) leva à liberação dos conteúdos celulares no espaço ex-
(Figura 25.9). MAPKKK inicia uma cascata de quina- tracelular e a uma resposta inflamatória, como freqüen-
ses que inclui MAPKK e MAPK. MAPK ativada (fosfo- temente acontece em infecções bacterianas ou virais e
rilada) se desloca para o núcleo, onde fosforila e ativa em trauma. Em contraste, apoptose é freqüentemente

BioQ.25 993 22.01.07 18:42:05


CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER | 997

��� quinases ativadas por Ras transmitem sinais opostos de


��� vida e morte, e o resultado depende do contexto celular
e do tipo de célula.
�����������
������� �������
��������������
25.4 | CÂNCER
������ ������
Oncogenes e Genes Supressores de
Tumor
����� �����
O ciclo celular e a apoptose são críticos para um enten-
dimento do câncer. Genes que codificam proteínas que
promovem divisão celular ou que promovem resistên-
���������������������� ���������������������� cia a apoptose são proto-oncogenes (Tabela 25.2). Suas
FIGURA 25.14
mutações ativadoras ou super-expressão resultam em
Múltiplas vias podem ser reguladas por Ras. atividade aumentada, o que leva a divisão celular des-
MAPKKK são MAPK quinase quinases. MAPKs, após ativação regulada ou resistência a apoptose. Mutações em um
por uma MAPKK, podem se deslocar para o núcleo para
fosforilar fatores de transcrição. As quinases também podem
proto-oncogene podem convertê-lo em um oncogene.
fosforilar proteínas outras, além dos fatores de transcrição. Duas cópias (ou alelos) de cada gene autossômico (i.é,
Alvos alternativos para as quinases incluem proteínas aqueles em cromossomos que não os cromossomos X e
tipo-Bcl-2 e p53.
Y) estão presentes no genoma de toda célula somática
[cada célula somática tem um alelo derivado da mãe e
sobrevivência. Os resultados dos sinais são dependen- outro do pai para cada gene autossômico]. Uma muta-
tes do tipo celular. Em algumas circunstâncias, JNK ção ativadora em um único alelo de um proto-oncoge-
promove morte por fosforilação de Bcl-2 para promo- ne é suficiente para causar um efeito pró-proliferativo
ver sua dissociação da membrana mitocondrial (Figura ou anti-apoptótico em uma célula. Tais mutações são
25.15), o que aumenta as concentrações mitocondriais portanto autossômicas dominantes para progressão do
de Bak e Bax livres e promove morte celular. JNK tam- câncer.
bém pode fosforilar p53, tornando-a mais resistente a Proto-oncogenes, cujos produtos promovem di-
Mdm-2, resultando em um aumento na concentração de visão celular ou resistência a apoptose incluem genes
p53 e morte celular. Também a MAPK ERK, a MAPKKK de fatores de crescimento, receptores de fatores de
Raf, e a quinase Akt promovem sobrevivência celular crescimento, moléculas adaptadoras tipo-Grb, tirosina
por fosforilação da proteína facilitadora pró-apoptótica quinases tipo-Src, quinases das cascatas MAPK, Cdks,
Bad ou por ativação da expressão dos genes anti-apop- ciclinas, CAKs, Cdc25, e fatores de transcrição (como
tóticos tipo-Bcl-2 (Figura 25.15). Portanto, diferentes Jun, Fos, Myc e E2F) que aumentam a expressão de

FIGURA 25.15
��������������������� ��� Interação de quinases ativadas por Ras com proteínas que
������� ��� regulam apoptose.
S, sobrevive (via promove sobrevivência celular); D, morre (die)
����� (via promove morte celular apoptótica). ERK, JNK, Raf e Akt
são quinases Pi3K, 1-fosfatidilinositol-3 quinase.

������������
���
������
������������������������������

���
�����
��� ����
������� �

� ���

��� �

���
����
������������

������������������������������ ��������������������������
���������������������

BioQ.25 997 22.01.07 18:42:10


CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER | 1003

CORRELAÇÃO CLÍNICA 25.3


Causa Ambiental de Cânceres Humanos

Fatores ambientais e culturais são as causas predomi- metilenotetra-hidrofolato redutase, uma enzima en-
nantes do câncer humano. Se estes fatores puderem volvida no metabolismo de ácido fólico, que resulta
ser regulados, a incidência de câncer pode ser redu- em atividade diminuída. Deficiência de folato causa
zida em mais de 75%. Fumar cigarros é responsável incorporação excessiva de uracil no DNA e quebras
por aproximadamente 30% das mortes por câncer cromossômicas. Deficiência de folato é comum em
nos EUA Além disso, estima-se que dieta pode pre- alcoólatras e pode ser a razão para um aumento na
venir o desenvolvimento de aproximadamente 30% incidência de certos cânceres com álcool. A dieta e o
dos cânceres nos EUA (estimativas variam entre 10 estilo de vida de pré-adolescentes afetam o início da
e 70%). Estes números são baseados primariamente menarca, e início precoce de menarca e extensão do
em dados epidemiológicos da incidência de tipos de período de tempo entre menarca e menopausa estão
câncer em diferentes localizações geográficas, cultu- associados com risco aumentado de câncer de mama
ras e ambientes (ver tabela anexa). Na migração de em mulheres. Obesidade correlaciona-se inversa-
uma cultura ou localização para outra, a incidência mente com risco de câncer de mama em mulheres
de um tipo de câncer freqüentemente se aproxima pré-menopausa, e correlaciona-se positivamente na
à da população na nova cultura, à medida que os in- pós-menopausa. Muita gordura animal na dieta foi
divíduos ou seus descendentes assimilam. Também associada com risco aumentado de câncer de có-
rápidas mudanças de dieta ou estilo de vida ao longo lon, mas os dados são inconsistentes. Ao contrário
do tempo em um país mostram a importância destes da gordura animal total na dieta, os dados podem
fatores na incidência de câncer. sugerir que é a razão entre gordura poliinsaturada
A quarta parte da população americana que tem e saturada que se correlaciona com risco de câncer
maior quantidade de frutas e vegetais na dieta tem cólon-retal. A incidência de câncer de cólon também
uma incidência 30-40% menor de muitos tipos de tem sido inversamente correlacionada com falta de
câncer. Entretanto, os constituintes destes alimen- atividade ou exercício.
tos que inibem a formação do câncer não foram de- Estudos ambientais e dietéticos são difíceis, uma vez
terminados. Níveis inadequados de ácido fólico na que grandes populações devem ser estudadas ao longo
dieta americana foram implicados como um fator de do tempo de uma geração, e múltiplas variáveis devem
risco para cânceres de cólon e de mama. A inges- ser controladas. Entretanto, avanços no nosso conhe-
tão de ácido fólico pode ser particularmente crítica cimento e controle destes fatores podem ter enormes
em indivíduos com um polimorfismo em seu gene da efeitos na diminuição da incidência de câncer.

Variação na Incidência de Tipo de Câncer em uma Comparação de Dois Locais


Comparação de Localização Incidência na Incidência na Diferença em
Localização 1 Localização 2 Vezes a Incidência

Pulmão New Orleans (negros) – Madras (Índia) 110 5,8 19

Mama Hawaii (havaianos) – Israel (não-judeus) 94 14 7

Próstata Atlanta (negros) - China (Tianjin) 91 1,3 70

Colo uterino Brasil (Recife) – Israel (não-judeus) 83 3,0 18

Fígado China (Xangai) – Canadá (Nova Escócia) 34 0,7 49

Cólon Estados Unidos (Connecticut, brancos) 34 1,8 19


– Índia (Madras)

Melanoma Austrália (Queensland) – Japão (Osaka) 31 0,2 155

* Incidência em número de novos casos por ano por 100.000 pessoas, ajustado para variação de idade com a população
específica. Dados retirados de Alberts, B., Johnson, A.,. Lewis, J., Raff, M., Roberts, K., e Watson, J. D. Molecular Biology of the
Cell, 4th ed. New York: Garland, 2002, Tabela 24-2, que foi adaptada de DeVita, V. T., Hellman, S., e Rosenberg, S. A. (Eds.).
Cancer: Principles and Practice of Oncology, 4th ed. Philadelphia: Lippincott, 1993; baseado em dados de C. Muir et al. Cancer
Incidence in Five Continents, Vol. 5, Lyon: International Agency for Research on Cancer, 1987. Referências Gerais: Shibuya, K.,
Mathers, C. D., Boschi-Pinto, C., Lopez, A. D., e Murray, C. J. L. Global and regional estimates of cancer mortality and incidence
by site: II. Results for the global burden of disease 2000. BMC Cancer 2:37, 2002. Pisani, P., Parkin, D. M., Bray, F. e Ferlay, J.
Estimates of the worldwide mortality from 25 cancers in 1990. Int. J. Cancer 93:18, 1999.
(continua na página seguinte)

BioQ.25 1003 22.01.07 18:42:17


CAPÍTULO 26 DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS | 1009

PARTE 5 PROCESSOS FISIOLÓGICOS

26
2Na+
Galactose
SGLT1

Glicose

GLUT5
Frutose

DIGESTÃO E ABSORÇÃO DE
CONSTITUINTES
NUTRICIONAIS BÁSICOS
Ulrich Hopfer

26.1 VISÃO GERAL, 1010 Dissacarídeos e polissacarídeos requerem hidróli-


Vários órgãos gastrointestinais contribuem para a se, 1028
digestão de alimentos, 1010 Transportadores de monossacarídeos, 1030

26.2 CONSIDERAÇÕES GERAIS, 1012 26.6 DIGESTÃO E ABSORÇÃO DE LIPÍDEOS, 1031


Diferentes locais de digestão intestinal, 1012 Digestão de lipídeos requer vencer sua solubilida-
Enzimas digestivas são secretadas como pró-en- de limitada em água, 1031
zimas, 1013 Lipídeos são digeridos por lipases gástrica e pan-
Secreção é regulada por muitos secretagogos, 1014 creática, 1031
Micelas de ácidos biliares solubilizam lipídeos
26.3 TRANSPORTE EPITELIAL, 1016 durante a digestão, 1032
Transporte de solutos pode ser transcelular ou A maior parte dos lipídeos absorvidos é incorpo-
paracelular, 1016 rada a quilomícrons, 1037
Absorção de NaCl tem componentes ativos e pas-
sivos, 1017 26.7 METABOLISMO DE ÁCIDOS BILIARES, 1037
Secreção de NaCl depende da ATPase trocadora Química e síntese de ácidos biliares, 1037
de Na+/K+ contraluminal, 1019 Transporte de ácidos biliares, 1038
Gradientes de concentração ou potenciais elétri-
cos dirigem transporte de nutrientes, 1021 BIBLIOGRAFIA, 1040
Células gástricas parietais secretam HCl, 1023
QUESTÕES E RESPOSTAS, 1040
26.4 DIGESTÃO E ABSORÇÃO DE PROTEÍNAS, 1024
Peptidases garantem digestão eficiente de proteí- CORRELAÇÕES CLÍNICAS
nas, 1024 26.1 Cloridorréia Familiar Causa Alcalose Meta-
Pepsinas catalisam digestão gástrica de proteí- bólica, 1017
nas, 1024 26.2 Fibrose Cística, 1020
Zimogênios pancreáticos são ativados no intesti- 26.3 Diarréias Toxigênicas Bacterianas e Terapia
no delgado, 1024 de Reposição de Eletrólitos, 1021
Peptidases da borda em escova e citoplasmáticas 26.4 Aminoacidúria Neutra: Doença de Hartnup,
digerem peptídeos pequenos, 1025 1026
Transportadores de aminoácidos e di e tripeptí- 26.5 Deficiência de Dissacaridases, 1030
deos, 1026 26.6 Intervenções Farmacológicas para Evitar
Absorção de Gordura e Obesidade, 1033
26.5 DIGESTÃO E ABSORÇÃO DE CARBOIDRATOS, 26.7 Cálculos de Colesterol, 1036
1028 26.8 A-β-Lipoproteinemia, 1038

BioQ.26 1009 22.01.07 18:43:16


1012 | PARTE 5 PROCESSOS FISIOLÓGICOS

funções, o trato gastrointestinal contém glândulas es- gam a 30 g de proteínas por dia, pelo menos, em um
pecializadas e superfícies epiteliais: adulto saudável. Enzimas pancreáticas, juntamente
com a bile, são derramadas no lúmen da segunda parte
Órgão Função Principal em Digestão e
(descendente) do duodeno, de modo que a maior parte
Absorção da digestão intraluminal ocorre na porção distal, em
relação a este ponto. Entretanto, mesmo após exausti-
Glândulas salivares Elaboração de fluido e enzimas
digestivas
vo contato com enzimas gástricas e pancreáticas, uma
parte substancial dos carboidratos e aminoácidos per-
Estômago Elaboração de HCl e enzimas manece como dímeros e oligômeros, e depende, para
digestivas
continuar a quebra, de enzimas digestivas das células
Pâncreas Elaboração de NaHCO3 e enzimas para epiteliais intestinais (enterócitos).
a digestão intraluminal
A membrana plasmática luminal dos enterócitos é
Fígado Elaboração dos ácidos biliares aumentada por uma matriz organizada de projeções,
Vesícula biliar Armazenamento e concentração da
chamadas microvilosidades, o que lhe confere a apa-
bile rência de uma escova e que levou ao nome borda em
escova. Esta borda em escova fornece uma grande
Intestino delgado Digestão terminal dos alimentos,
absorção de nutrientes e eletrólitos área, que é coberta em sua superfície mais externa por
muitas di- e oligossacaridases, amino- e dipeptida-
Intestino grosso Absorção de eletrólitos ses, e esterases (Tabela 26.2). Muitas destas enzimas
projetam-se a até 100 Å em direção ao lúmen, ligadas
à membrana plasmática por um polipeptídeo de anco-
O pâncreas e o intestino delgado são essenciais ragem. Este arranjo permite eficiente digestão na su-
para digestão e absorção de todos os nutrientes básicos. perfície, gerando moléculas nutrientes que podem ser
Felizmente, ambos os órgãos têm grandes capacidades absorvidas pelos enterócitos. Uma questão interessante
de reserva. Assim, má digestão devido a insuficiência é como as enzimas de superfície, que são elas próprias
pancreática torna-se um problema clínico só quando proteínas, escapam da digestão por proteases solúveis.
a taxa de secreção pancreática de enzimas digestivas Parece que sua grande glicosilação confere alguma pro-
cai abaixo de um décimo da taxa normal. Secreção de teção, impedindo o acesso de proteases a ligações pep-
bile pelo fígado é importante para digestão e absorção tídicas relevantes.
eficientes de lipídeos, que dependem de ácidos biliares.
Em contraste, a digestão gástrica de alimentos é não-
essencial para nutrição adequada, e perda desta função TABELA 26.2 Enzimas Digestivas da Superfície do
pode ser compensada pelo pâncreas e pelo intestino Intestino Delgado
delgado. No entanto, digestão gástrica normal aumenta Enzima (Nome Comum) Substrato
muito a facilidade e a eficiência do processo digestivo Maltase Maltose
total. O estômago ajuda a digestão por sua função de re- Sacarase/isomaltase Sacarose/dextrina α-limite
servatório, sua capacidade de misturar, e pelo início da Glucoamilase Amilose
hidrólise de proteínas e lipídeos que, embora pequena,
Trealase Trealose
é importante para estimular a secreção pancreática e
biliar. Peptídeos, aminoácidos e ácidos graxos liberados β-Glucosidase Glucosilceramida
no estômago estimulam a liberação coordenada do suco Lactase Lactose
pancreático e da bile no lúmen do intestino delgado, as- Endopeptidase Proteína (clivagem de
segurando assim digestão eficiente dos alimentos. aminoácidos hidrofóbicos
internos)

|
26.2 CONSIDERAÇÕES Aminopeptidase A Oligopeptídeo com NH2
terminal acídico
GERAIS Aminopeptidase N Oligopeptídeo com NH2
terminal neutro
Dipeptidil aminopeptidase Oligopeptídeo com X-Pro ou
Diferentes Locais de Digestão IV X-Ala na extremidade NH2
terminal
Intestinal Leucina aminopeptidase Peptídeos com aminoácido
neutro na extremidade NH2
As primeiras etapas da quebra dos alimentos são catali- terminal
sadas por enzimas solúveis e ocorrem dentro do lúmen γ-Glutamiltransferase Glutationa + aminoácido
do estômago e do intestino delgado. Enzimas digestivas
Enteropeptidase Tripsinogênio
são secretadas pelas glândulas salivares, estômago e (enteroquinase)
pâncreas, sendo que o pâncreas faz as contribuições
Fosfatase alcalina Fosfatos orgânicos
maiores e mais importantes. Enzimas secretadas che-

BioQ.26 1012 22.01.07 18:43:19


1026 | PARTE 5 PROCESSOS FISIOLÓGICOS

duz aminoácidos livres e di e tripeptídeos, que são ab-


sorvidos por sistemas transportadores específicos CORRELAÇÃO CLÍNICA 26.4
de aminoácidos e peptídeos, respectivamente. Di e
tripeptídeos transportados são geralmente hidrolisados Aminoacidúria Neutra:
dentro da célula epitelial intestinal, antes de saírem da Doença de Hartnup
célula. Isto explica por que praticamente só aminoáci-
dos livres são encontrados no sangue portal após uma Doença de Hartnup é um defeito genético no
refeição. A ausência virtual de peptídeos era tida como transportador Na+ -acoplado que normalmen-
evidência de que a digestão luminal de proteínas pros- te medeia absorção de aminoácidos neutros do
seguia até aminoácidos livres antes de ocorrer absor- lúmen do intestino delgado e dos túbulos proxi-
ção. Entretanto, agora está estabelecido que uma gran- mais. Foi assim denominada pela família na qual
de parte do nitrogênio amino da dieta é absorvida na a anomalia foi identificada pela primeira vez, e
forma de pequenos peptídeos, com subseqüente hidróli- o homólogo em camundongo foi recentemente
se intracelular. Exceções são di e tripeptídeos contendo clonado (família gênica SLC6). No rim, a inca-
prolina, hidroxiprolina ou aminoácidos incomuns, como pacidade de reabsorver aminoácidos neutros do
β-alanina na carnosina (β-alanil-histidina) ou anserina ultrafiltrado leva à sua excreção na urina (ami-
(β-alanil-1-metil-histidina). Estes peptídeos são absor- noacidúria neutra). No intestinal, o defeito re-
vidos e liberados intactos no sangue portal, Embora in- sulta em má absorção de aminoácidos neutros da
comum, β-alanina é parte da dieta, porque está presen- dieta. Os sintomas clínicos são os que se espe-
te, por exemplo, em carne de frango. rariam para uma deficiência de triptofano, com
características semelhantes às da pelagra (ver p.
1074), que é uma expressão da disponibilidade
Transportadores de Aminoácidos e diminuída de triptofano para conversão em nico-
Di e Tripeptídeos tinamida. Entretanto, os sintomas são variáveis
e mais brandos do que os esperados no bloqueio
O intestino delgado tem uma alta capacidade de absor- total de reabsorção de aminoácidos neutros. In-
ver aminoácidos livres e di e tripeptídeos. A maior par- vestigações de pacientes com doença de Hart-
te dos L-aminoácidos pode ser transportada através do nup revelaram a existência de transportadores
epitélio contra um gradiente de concentração, embora intestinais para di ou tripeptídeos, que são dife-
a necessidade de transporte concentrador in vivo não rentes daqueles para aminoácidos livres. PEPT1
seja óbvia, uma vez que as concentrações luminais são (SLC5A1) é o principal transportador intestinais
geralmente mais altas do que os níveis plasmáticos de para absorção de produtos peptídicos pequenos
0,1-0,2 mM. A captação para dentro das células é media- da digestão.
da por vários transportadores diferentes na membrana
luminal, enquanto a liberação no sangue é mediada por Fonte: Broer, A., Klingel, K., Kowalczuk, S., Rasko, J.
vários transportadores adicionais, diferentes, na mem- E., Cavanaugh, J. e Broer, S., Molecular cloning of mou-
brana contraluminal (Tabela 26.7). se amino acid transport system B0, a neutral amino acid
É notável que várias mutações com perda de função transporter related to Hartnup disease. J. Biol. Chem.
em transportadores de aminoácidos foram descobertas, 279:24467, 2004. Daniel, H. Molecular and integrative
porque o intestino delgado e os túbulos proximais renais physiology of intestinal peptide transport. Annu. Rev.
compartilham tipos de transportadores, e perda renal Physiol. 66:361, 2004.
de qualquer transportador de aminoácidos em particu- http://www.emedicine.com/derm/topic713.htm
lar produz um resultado facilmente detectável, a saber,
a excreção do aminoácido na urina (aminoacidúria). De funcionalmente caracterizados nas membranas luminal
mesma forma, a importância da absorção de di e tripeptí- e contraluminal, respectivamente.
deos para a nutrição foi descoberta quando uma mutação O transporte da borda em escova para outros ami-
com perda de função no principal transportador de ami- noácidos, não os neutros, é energizado de modos mais
noácidos neutros (aminoacidúria neutra) não foi acom- complicados. Por exemplo, aminoácidos ácidos podem
panhada por uma deficiência esperada nos aminoácidos ser concentrados por co-transporte com 2 íons Na+ e
correspondentes, sugerindo pelo menos um transporta- contra-transporte com 1 íon K+ (SLC12A1), enquanto
dor adicional mediando captação (ver Corr. Clín. 26.4). aminoácidos básicos dependem do co-transporte de uma
O mecanismo de absorção ativa de aminoácidos neu- carga positiva e do potencial negativo do interior da célu-
tros parece ser semelhante à discutida para a D-glicose la (SLC3A1/SLC7A9). Conclusões sobre transportadores
(ver Figura 26.18). Um co-transportador Na+ -depen- envolvidos em absorção dos aminoácidos alanina, serina
dente da família SLC6 (também chamado NBB para e cisteína estão associadas com alguma incerteza porque
aminoácido neutro da borda em escova ou B0AT), e estes aminoácidos são substratos de vários transporta-
transportador facilitador, Na+ -independente (SLC3A2/ dores, um dos quais parece catalisar uma troca obrigató-
SLC7A8 ou sistema L para preferência a leucina) foram ria aminoácido/aminoácido (SLC1A5).

BioQ.26 1026 22.01.07 18:44:07


CAPÍTULO 26 DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS | 1037
Micelas de ácidos biliares contornam este problema dos para o retículo endoplasmático, onde são converti-
para os lipídeos, por aumentarem sua concentração efe- dos em triacilgliceróis. Glicerol para este processo é de-
tiva na camada não-misturada. O aumento na veloci- rivado dos 2-monoacilgliceróis absorvidos e, em menor
dade de transporte é quase proporcional ao aumento grau, da glicose. Colesterol é esterificado pela colesterol
na concentração efetiva e pode ser 1000 vezes superior aciltransferase. Os triacilgliceróis recém-sintetizados e
à de ácidos graxos individuais solubilizados, de acordo os colesteril ésteres formam glóbulos lipídicos aos quais
com as diferentes solubilidades em água dos ácidos gra- fosfolipídeos e apolipoproteínas adsorvem. Os glóbu-
xos como micelas e como moléculas individuais. Esta los são chamados quilomícrons porque podem crescer
relação entre fluxo e concentração efetiva permanece, até vários micrômetros e diâmetro, e deixam o intesti-
porque a constante de difusão é só um pouco menor no pelos vasos linfáticos (quilo = linfa leitosa derivada
para micelas do que para moléculas de lipídeos em solu- do grego chylos, que significa suco). passam através da
ção. Em ausência de ácidos biliares, a absorção de tria- célula para o sangue portal, sem modificação. Ácidos
cilgliceróis não pára completamente, mas a eficiência graxos de cadeia longa (>12 átomos de carbono) são
é drasticamente reduzida. Absorção residual depende ligados a uma proteína citoplasmática de ligação a ácidos
da baixa solubilidade em água dos ácidos graxos li- graxos (FABP intestinal ou I-FABP, intestinal fatty-acid
vres e dos monoacilgliceróis. Lipídeos não-absorvidos binding protein) e são transportados para o retículo
chegam ao intestino inferior, onde uma pequena par- endoplasmático, onde são convertidos novamente em
te pode ser metabolizada por bactérias. A maior parte triacilgliceróis. Quilomícrons são sintetizados no lúmen
dos lipídeos não-absorvidos, entretanto, é excretada do retículo endoplasmático, de onde migram pelo Golgi e
nas fezes (esteatorréia). depois para vesículas e para a membrana contraluminal.
Micelas também transportam colesterol e as vita- São liberados no espaço intercelular por fusão destas ve-
minas lipossolúveis A, D, E e K através das camadas sículas com a membrana plasmática. É interessante que
fluidas não-misturadas. Secreção de ácidos biliares é quilomícrons não entram no espaço capilar e na veia por-
essencial para sua absorção. ta, mas sim viajam pelos vasos linfáticos intestinais (ou
lacteals) e o ducto torácico para o sistema venoso sistê-
mico. As apolipoproteínas intestinais são designadas por
A Maior Parte dos Lipídeos A-1 e B48 (ver Corr. Clín. 26.8); são diferentes daquelas
Absorvidos É Incorporada a do fígado, com funções semelhantes (ver p. 698).
Enquanto ácidos graxos de cadeia média da dieta
Quilomícrons chegam ao fígado diretamente com o sangue portal, áci-
Captação de lipídeos por células epiteliais intestinais dos graxos de cadeia longa chegam primeiro ao tecido
ocorre por difusão através da membrana plasmática. adiposo e ao músculo via circulação sistêmica, antes de
Além disso, captação de ácidos graxos de cadeia longa é entrarem em contato com o fígado. Células adiposas e
aumentada por um transportador (FATP4 ou SLC27A4) musculares captam grandes quantidades de lipídeos da
e de colesterol por um canal (proteína tipoC1 de Nie- dieta para armazenamento ou metabolismo. Um atalho
mann-Pick ou NPC1L1) na membrana luminal. Esteróis sem passar pelo fígado pode ter evoluído para proteger
também podem ser bombeados de volta para fora por este órgão da sobrecarga lipídica após uma refeição.
um transportador ABC (ver p. 479) consistindo de dois O manuseio diferencial de ácidos graxos de cadeia
meios-transportadores (ABCG5 e ABCG8) e uma parte média e longa por células intestinais pode ser explorado
do colesterol é realmente devolvida ao compartimento para fornecer ao fígado nutrientes altamente calóricos,
luminal. Exportação de esteróis por transportador ABC na forma de ácidos graxos. Ácidos graxos de cadeia cur-
ta e média têm cheiro e gosto rançoso, e não são muito
é particularmente importante para rejeitar esteróis de
palatáveis; entretanto, triacilgliceróis que contêm estes
plantas; normalmente, esteróis de plantas não são en-
ácidos graxos são bastante palatáveis e podem ser usa-
contrados no soro. Mutações com perda de função em
dos como parte da dieta. Ácidos graxos de cadeia curta
qualquer dos meios-transportadores estão associadas
são produzidos fisiologicamente, particularmente no
com uma elevação no soro do esterol de planta sintoste-
cólon, por bactérias, a partir de carboidratos residuais.
rol (fitosterolemia ou sitosterolemia).
Estes ácidos graxos são absorvidos no sangue portal.
Absorção é virtualmente completa para ácidos gra-
xos e monoacilgliceróis, que são ligeiramente solúveis
em água. É menos eficiente para lipídeos insolúveis em
água. Por exemplo, apenas 30-40% do colesterol da die-
ta é geralmente absorvido.
|
26.7 METABOLISMO DE
ÁCIDOS BILIARES
Dentro das células epiteliais que fazem absorção, o Química e Síntese de Ácidos Biliares
destino dos ácidos graxos absorvidos depende do com-
primento da cadeia. Ácidos graxos de cadeias curtas Ácidos biliares são sintetizados em células do fígado
ou médias (≤10 átomos de carbono) ou seus monoacil- (hepatócitos) a partir de colesterol, secretados na bile
gliceróis são ligados a uma proteína citosólica que liga juntamente com fosfolipídeos, e modificados por enzi-
ácido graxo (FAB intestinal o I-FABP) e são transporta- mas bacterianas no lúmen intestinal.

BioQ.26 1037 22.01.07 18:44:59


CAPÍTULO 27 PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES | 1043

PARTE 5 PROCESSOS FISIOLÓGICOS

27
PRINCÍPIOS DE NUTRIÇÃO I:
MACRONUTRIENTES
Stephen G. Chaney

27.1 VISÃO GERAL, 1044 27.8 FIBRAS, 1052


27.2 METABOLISMO ENERGÉTICO, 1044
Conteúdo energético dos alimentos é medido em 27.9 COMPOSIÇÃO DOS MACRONUTRIENTES DA
quilocalorias, 1044 DIETA, 1054
Gasto energético é influenciado por quatro fato- Composição da dieta afeta colesterol do soro,
res, 1044 1054
Carboidratos, índice glicêmico e carga glicêmica,
27.3 METABOLISMO DE PROTEÍNAS, 1045 1056
Proteínas da dieta cumprem muitas funções Mistura de proteínas vegetais e animais satisfaz
incluindo produção de energia, 1045 as necessidades nutricionais de proteína, 1056
Balanço de nitrogênio relaciona ingestão com Fibra de fontes variadas é desejável, 1057
excreção de nitrogênio, 1045 Recomendações dietéticas, 1057
Aminoácidos essenciais devem estar presentes
na dieta, 1045 BIBLIOGRAFIA, 1059
Economia de proteínas está relacionada com o
conteúdo de carboidratos e gorduras, 1046 QUESTÕES E RESPOSTAS, 1060
Necessidades de proteína para adulto normal,
1046 CORRELAÇÕES CLÍNICAS
Necessidades de proteína aumentam durante 27.1 Dietas Vegetarianas e Necessidades Protéi-
crescimento e doenças, 1047 co-Energéticas para Crianças, 1047
27.2 Ingestão de Proteínas na Dieta e Doença
27.4 DESNUTRIÇÃO PROTÉICO-ENERGÉTICA, 1048 Renal, 1048
27.3 Oferecendo Proteínas e Calorias Adequadas
27.5 EXCESSIVA INGESTÃO PROTÉICO- a Pacientes Hospitalizados, 1049
ENERGÉTICA, 1050 27.4 Carga de Carboidratos e Resistência Atléti-
Obesidade tem componentes dietéticos e genéti- ca, 1052
cos, 1050 27.5 Dietas Ricas em Carboidratos Versus Dietas
Obesidade tem implicações significativas para a Ricas em Gorduras para Diabéticos, 1053
saúde, 1050 27.6 Ácidos Graxos Poliinsaturados e Fatores de
Risco para Doença Cardíaca, 1055
27.6 CARBOIDRATOS, 1051 27.7 Adaptação Metabólica: Relação entre In-
gestão de Carboidratos e Triacilgliceróis no
27.7 GORDURAS, 1051 Soro, 1059

BioQ.27 1043 22.01.07 18:46:45


CAPÍTULO 27 PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES | 1045
correr mais de uma hora para queimar as calorias pre- adequada na dieta deve ser fornecida em todas as refei-
sentes em um pedaço de torta de maçã. ções. Entretanto, na realidade, isto não é muito correto.
Exercício regular aumenta a taxa de metabolismo Embora não exista uma classe separada de proteínas de
basal, permitindo que calorias sejam queimadas mais “armazenamento”, existe certa percentagem da proteí-
rapidamente, 24 horas por dia. Um programa de exer- na do corpo que sofre um processo constante de quebra
cícios regulares deve ser planejado para aumentar a e síntese. No estado de jejum, a quebra desta proteína
massa muscular magra e deve ser repetido 3-5 dias por aumenta, e os aminoácidos resultantes são utilizados
semana, mas não precisa ser exercício aeróbico para ter para produção de glicose, síntese de outros compostos
efeito sobre a taxa de metabolismo basal. Para um indi- nitrogenados não-proteínas, e das proteínas plasmáti-
víduo idoso ou enfermo, mesmo caminhada diária pode cas e secretórias essenciais mencionadas acima. Mes-
ajudar a aumentar a um pouco a taxa de metabolismo mo no estado alimentado, parte destes aminoácidos é
basal. utilizada para produção de energia e como precursores
Níveis hormonais também são importantes, uma vez biossintéticos. Assim, o turnover de proteínas do corpo
que tiroxina, hormônios sexuais, hormônio de cresci- é um processo normal – e uma característica essencial
mento e, em menor grau, epinefrina e cortisol aumen- do assim chamado balanço de nitrogênio.
tam BMR. Os efeitos da epinefrina e do cortisol prova-
velmente explicam, em parte, porque estresse severo Balanço de Nitrogênio Relaciona
e trauma importante aumentam significativamente as
necessidades energéticas. Finalmente, a própria inges- Ingestão com Excreção de
tão energética tem uma relação inversa com o gasto, Nitrogênio
porque durante períodos de jejum ou semijejum, BMR
pode cair a até 50%. Isto é de grande valor para sobrevi- Balanço de nitrogênio (Figura 27.2) é uma relação
vência em casos de genuína falta de alimento, mas não entre ingestão de nitrogênio (principalmente na forma
ajuda muito a pessoa que quer perder peso com uma de proteínas) e excreção de nitrogênio (principalmen-
dieta de restrição calórica. te na forma de proteína não-digerida nas fezes e uréia e
amônia na urina). Um adulto normal está em equilíbrio

|
de nitrogênio, com perdas exatamente equilibradas por
27.3 METABOLISMO DE ingestão. Balanço de nitrogênio negativo resulta de in-
PROTEÍNAS gestão inadequada de proteína, uma vez que os amino-
ácidos utilizados para energia e reações de biossínte-
se não são substituídos. Isto também ocorre em lesão
Proteínas da Dieta Cumprem Muitas quando há destruição dos tecidos, e em traumas graves
Funções Incluindo Produção de ou doenças, quando resposta adaptativa do corpo causa
catabolismo aumentado de proteína. Balanço de nitro-
Energia gênio positivo ocorre quando há um aumento final na
proteína do corpo, como em crianças em crescimento,
Proteína carrega certa mística como alimento de
mulheres grávidas ou adultos convalescentes.
“construção do corpo”. Embora seja componente es-
trutural essencial de todas as células, é também im-
portante para manutenção de secreções essenciais, Aminoácidos Essenciais Devem Estar
como enzimas digestivas e hormônios peptídicos e pro- Presentes na Dieta
téicos. Proteína também é necessária para síntese de
proteínas plasmáticas, que são essenciais para manter Vários fatores devem ser considerados, além da quan-
equilíbrio osmótico, transporte de substâncias no san- tidade de proteína na dieta. Um é o complemento de
gue e manutenção da imunidade. Entretanto, o adulto aminoácidos essenciais ingeridos. Aminoácidos es-
norte-americano médio consome muito mais proteína senciais são aminoácidos que não podem ser sintetiza-
do que o necessário para desempenhar estas funções dos pelo corpo (Tabela 27.2). Se apenas um destes ami-
essenciais. O excesso de proteína é tratado como uma noácidos essenciais estiver faltando na dieta, o corpo
fonte de energia, com aminoácidos glucogênicos sendo não poderá sintetizar novas proteínas para substituir a
convertidos em glicose e aminoácidos cetogênicos, em perdida no turnover normal, e balanço de nitrogênio
ácidos graxos e cetoácidos. Ambos os tipos de aminoá- negativo resulta (Figura 27.2).
cidos são eventualmente convertidos em triacilglicerol Obviamente, o complemento de aminoácidos essen-
no tecido adiposo, se os suprimentos de gordura e car- ciais na proteína da dieta determina o quanto ela pode
boidratos já forem adequados para suprir as necessida- ser usada pelo corpo.
des energéticas. Assim, para a maioria de nós, a única A maioria das proteínas animais contém todos os
construção corporal obtida com dietas ricas em proteí- aminoácidos essenciais, mais ou menos nas quantida-
nas é no tecido adiposo. des necessárias ao corpo humano. Proteínas vegetais,
Tem sido comum dizer que o corpo não tem depósitos por outro lado, freqüentemente não têm um ou mais
para armazenamento de proteína e, portanto, proteína aminoácidos essenciais e podem, em alguns casos, ser

BioQ.27 1045 22.01.07 18:46:50


1052 | PARTE 5 PROCESSOS FISIOLÓGICOS

CORRELAÇÃO CLÍNICA 27.4


Carga de Carboidratos e Resistência Atlética
A prática de dar uma carga de carboidratos vem insulina e hormônio de crescimento, e as reservas
de observações feitas no início da década de 1960 de glicogênio chegavam a quase duas vezes as quan-
de que a resistência durante exercício vigoroso era tidades normais. Esta prática realmente aumentava
limitada primariamente pelos estoques de glicogê- significativamente a resistência. Em um estudo, in-
nio muscular. Claro, glicogênio não é a única fon- divíduos em teste com dieta rica em gordura e prote-
te de energia para o músculo. Ácidos graxos livres ína tinham menos do que 1,6 g de glicogênio por 100
aumentam no sangue durante exercício vigoroso e g de músculo e conseguiam realizar uma carga de
são utilizados pelo músculo, juntamente com seus trabalho padronizado por apenas 60 min. Quando os
estoques de glicogênio. Uma vez que o glicogênio mesmos indivíduos consumiram uma dieta rica em
tenha se esgotado, entretanto, o músculo não pode carboidratos por 3 dias, suas reservas de glicogênio
depender inteiramente de ácidos graxos livres sem aumentaram para 4 g por 100 g de músculo, e a mes-
se cansar rapidamente, provavelmente porque o ma carga de trabalho pôde ser realizada por até 4 h.
músculo fica cada vez mais hipóxico durante exer- Embora a técnica evidentemente funcionasse,
cício vigoroso. Enquanto glicogênio é utilizado ae- os atletas freqüentemente se sentiam letárgicos e
robicamente e anaerobicamente, ácidos graxos só irritáveis durante a fase pobre em carboidratos do
podem ser utilizados aerobicamente. Em condições regime, e a dieta rica em gordura estava em desa-
anaeróbicas, ácidos graxos não podem fornecer cordo com as recomendações atuais para saúde.
ATP em velocidade suficiente para servir como úni- Estudos recentes indicam que o consumo regular
ca fonte de energia. de uma dieta rica em carboidratos complexos e po-
A prática de dar uma carga de carboidratos para bre em gordura durante o treinamento aumenta as
aumentar as reservas de glicogênio foi introduzida reservas de glicogênio, sem mudanças súbitas de
para atletas de enduro e outras provas de resistên- dieta. Recomendações atuais são de que atletas de
cia. O regime de carga de carboidratos original con- provas de resistência consumam uma dieta rica em
sistia de um período de 3 a 4 dias de exercício pesa- carboidratos (com ênfase em carboidratos comple-
do com uma dieta pobre em carboidratos, seguidos xos) durante o treinamento. Depois, a ingestão de
por 1-2 dias de exercício leve com dieta rica em carboidratos é aumentada ainda mais (para 70%
carboidratos. O período inicial de baixo carboidra- das calorias) e o exercício é diminuído durante os
to e alta demanda energética causava uma depleção 2-3 dias que antecedem um evento atlético. Isto au-
das reservas musculares de glicogênio. A mudança menta as reservas de glicogênio muscular até níveis
subseqüente para uma dieta rica em carboidratos comparáveis aos descritos anteriormente no regime
resultava na produção de níveis acima do normal de de carga de carboidratos.

Fonte: Lambert, E. V. e Goedecke, J. H. The role of dietary micronutrients in optimizing endurance performance.
Curr. Sports Med. Rep. 2:194, 2003. Hargreaves, M., Hawley, J. A. e Jeukendrup, A. Pre-exercise carbohydrate and
fat ingestion: Effects on metabolism and performance. J. Sports Sci. 22:31, 2004. Burke, L. M., Kiens, B. e Ivey, J. L.
Carbohydrates and fat for training and recovery. J. Sports Sci. 22:15, 2004.

de ácidos graxos essenciais é uma dermatite com des- que ácidos graxos poliinsaturados da série ω-6 possam
camação. Deficiência de EFAs é muito rara nos Estados ser mais tumorigênicos do que outros ácidos graxos in-
Unidos, ocorrendo primariamente em bebês prematuros saturados. A razão para isso é desconhecida, mas suge-
em peso alimentados com fórmulas artificiais desprovi- riu-se que prostaglandinas derivadas de ácidos graxos
das de EFA e em pacientes hospitalizados mantidos em ω-6 possam estimular progressão de tumores.
alimentação totalmente parenteral por longos períodos.
Na outra extremidade, há preocupação de que excesso
de gordura na dieta cause elevação de lipídeos do soro
27.8 | FIBRAS
e, assim, risco aumentado de doença cardíaca.
Estudos recentes sugerem que dietas ricas em gor- Fibras da dieta compreendem os componentes do ali-
dura estejam associadas com risco aumentado de cân- mento que não podem ser quebrados por enzimas di-
cer de cólon, mama e próstata, mas não está claro se o gestivas humanas. É incorreto, entretanto, assumir que
risco de câncer está associado com ingestão de gordura fibras são não-digeridas, uma vez que algumas fibras
per se ou com o excesso de calorias associado a uma são, de fato, quebradas, pelo menos parcialmente, por
dieta rica em gorduras. Estudos em animais sugerem bactérias intestinais. Nosso conhecimento atual das

BioQ.27 1052 22.01.07 18:46:56


CAPÍTULO 27 PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES | 1059

CORRELAÇÃO CLÍNICA 27.7


Adaptação Metabólica: Relação entre Ingestão de Carboidratos e
Triacilgliceróis no Soro

Quando se avalia a literatura de nutrição, é importante de doença cardíaca, uma noção que se popularizou por
lembrar que a maioria dos testes clínicos é de duração re- meio de best sellers nutricionais como “Sugar Blues”
lativamente curta (2-6 semanas), enquanto algumas adap- e “Sweet and Dangerous”. Infelizmente, enquanto as
tações metabólicas podem ser consideravelmente mais conclusões originais eram promovidas na imprensa lei-
demoradas. Portanto, mesmo estudos clínicos aparente- ga, os experimentos propriamente ditos eram questio-
mente bem projetados podem levar a conclusões erradas, nados. Estudos subseqüentes demonstraram que se es-
que serão repetidas na literatura popular por anos a fio. Por tes testes fossem continuados por períodos mais longos
exemplo, vários estudos realizados nas décadas de 1960 e (3-6 meses), os níveis de triacilglicerol geralmente se
1970 tentaram verificar os efeitos de ingestão de carboi- normalizavam. A natureza desta adaptação metabólica
dratos sobre os níveis de triacilglicerol no soro. Tipicamen- lenta é desconhecida. Também é importante considerar
te, jovens estudantes do sexo masculino receberam uma o tipo de carboidrato da dieta. Para muitos americanos,
dieta na qual até 50% de suas calorias em gordura foram uma dieta rica em carboidratos significa uma dieta que
substituídas por sacarose ou outro açúcar simples por um é rica em açúcares simples. Os níveis de triacilgliceróis
período de 2-3 semanas. Na maioria dos casos, os níveis de nestes indivíduos respondem dramaticamente a dietas
triacilglicerol no soro aumentaram muito (até 50%). Isto que substituem alimentos contendo ou gordura ou car-
levou à conclusão de que alta ingestão de açúcares sim- boidratos complexos e fibras por alimentos contendo
ples, particularmente sacarose, poderia aumentar o risco açúcares simples como fonte de carboidrato.

Fonte: Leahy, P., Croniger, C. e Hanson, R.W. Molecular and cellular adaptations to carbohydrate and fat intake.
Eur. J. Clin. Nutr. 53(Suppl 1):S6, 1999. Parks, E. J. e Hellerstein, M. K. Carbohydrate-induced hypertriacylglycero-
lemia: Historical perspective and review of biological mechanisms. Am. J. Clin. Nutr. 71:412, 2000.

| BIBLIOGRAFIA |
Desnutrição Protéico-Energética em Pacientes Hospitali- Ochoa, M. C., Marti, A., Azcona, C., Cheuca, M., Oyaizabal, M.,
zados Pelach, R. et al. Gene-gene interactions between PPAR
Biffl, W. L., Moore, E. E. e Haenel, J. B. Nutrition support of gamma 2 and ADR beta 3 increases obesity risk in chil-
the trauma patient. Nutrition 18:960, 2002. dren and adolescents. Int. J. Obes. Relat. Metab. Disord.
Wilmore, D. W. Metabolic response to severe surgical illness: 28 (Suppl. 3):S37, 2004.
An overview. World J. Surg. 24:705, 2000. Pihlajamaki, J., Vanhala, M., Vanhala, P. e Laakso, M. The
Wolfe, R. R. e Martini, W. Z. Changes in intermediary meta- Pro12Ala polymorphism of the PPAR gamma 2 gene regula-
bolism in severe surgical illness. World J. Surg. 24:639, tes weight from birth to adulthood. Obes. Res. 12:187, 2004.
2000. Saper, C. B., Chou, T. C. e Elmquist, J. K. The need to feed:
Homeostatic and hedonic control of eating. Neuron
Conseqüências Metabólicas da Obesidade 36:199, 2002.
Boden, G. Free fatty acids, insulin resistance, and type 2 Zigman, J. M. e Elmquist, J. K. Minireview: From anorexia to
diabetes mellitus. Proc. Assoc. Am. Physicians 111, 241, obesity – The yin and yang of body weight control. Endo-
1999. crinology 144:3749, 2003.
Hotamisligii, G. S. The role of TNF� and TNF receptors in
obesity and insulin resistance. J. Intern. Med. 245:621, Dieta e Doença Cardiovascular
1999. Holub, D. J. e Holub, B. J. Omega-3 fatty acids from fish oils
Le Roith, R. e Zick, Y. Recent advances in our understanding and cardiovascular disease. Mol. Cell. Biochem. 263:217,
of insulin action and insulin resistance. Diabetes Care 2004.
24:588, 2001. Krauss, R. M., Eckel, R. H., Howard, B., Appel, L. J., Daniels,
Pi-Sunyer, F. X. Health implications of obesity. Am. J. Clin. S. R., Deckelbaum, R. J., et al. AHA Dietary Guidelines
Nutr. 53:15955, 1991. Revision 2000: A statement for healthcare professionals
from the nutrition committee of the American Heart As-
Predisposição Genética à Obesidade sociation. Circulation 102:2284, 2000.
Fliers, J. S. Obesity wars: Molecular progress confronts an Kris-Etherton, P. M., Harris, W. S. e Appel, L. J. Omega-3 fat-
expanding epidemic. Cell 116:337, 2004. ty acids and cardiovascular disease. New recommenda-
Evans, R. M., Barish, G. D. e Wang, Y. X. PPARs and the com- tions from the American Heart Association. Arterioscler.
plex journey to obesity. Nat. Med. 10:355, 2004. Thromb. Vasc. Biol. 23:151, 2003.

BioQ.27 1059 22.01.07 18:47:02


CAPÍTULO 28 PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES | 1063

PARTE 5 PROCESSOS FISIOLÓGICOS

28
Necessidades
nutricionais Má-absorção
aumentadas

Ingestão
inadequada
da dieta

PRINCÍPIOS DE NUTRIÇÃO II:


MICRONUTRIENTES
Stephen G. Chaney

28.1 VISÃO GERAL, 1064 28.8 OUTRAS VITAMINAS HIDROSSOLÚVEIS,


1082
28.2 AVALIAÇÃO DE MÁ NUTRIÇÃO, 1064 Ácido ascórbico funciona em reações de redu-
ção e hidroxilação, 1082
28.3 INGESTÃO DIETÉTICAS DE REFERÊNCIAS, Colina e carnitina desempenham várias fun-
1064 ções, 1083

28.4 VITAMINAS LIPOSSOLÚVEIS, 1066 28.9 MACROMINERAIS, 1084


Vitamina A é derivada de carotenóides de plan- Cálcio tem muitas funções fisiológicas, 1084
tas, 1066 Magnésio é requerido por muitas enzimas, 1084
Síntese de vitamina D requer luz do sol, 1068
Vitamina E é uma mistura de tocoferóis e toco- 28.10 MINERAIS TRAÇOS, 1084
trienóis, 1071 Deficiência de ferro causa anemia e imunocom-