Você está na página 1de 20

3-264-401-11 (1)

Auto-rádio FM estéreo/AM
com toca-discos a laser
Manual de Instruções

Com relação à instalação e conexões, veja o manual de


instalação/conexões fornecido.
Antes de utilizar o aparelho, leia este manual
cuidadosamente e conserve-o para futuras consultas.

CDX-S2007X
CDX-S2007XG
CDX-S2007XB
CDX-S2007XP
© 2004 Sony Corporation Impresso no Brasil
Parabéns !
Você acaba de adquirir um auto-rádio FM
estéreo/AM com toca-discos a laser Sony.
Desfrute das várias funções oferecidas pelo
aparelho através do painel de controle e controle
remoto sem fio.
• Acessório fornecido: Controle Remoto sem fio
RM115, somente para o CDX-S2007XB.
• Acessório opcional: Controle Remoto sem fio
RM115 para os modelos CDX-S2007X,
CDX-S2007XG e CDX-S2007XP.

ADVERTÊNCIA
Este aparelho não pode realizar gravações
em CDs (cópias de CDs). O termo
“Reprodução”, quando citado neste manual,
significa exclusivamente a produção de som
para que se possa ouvir as músicas de um
CD/RÁDIO ou de outra fonte sonora
conectada ao aparelho.

2
Índice
Localização dos controles . . . . . . . . . . . . . . . 4 Outras Funções
Precauções . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Ajustando o balanço e fader . . . . . . . . . . . . 12
Notas sobre os discos. . . . . . . . . . . . . . . . . . . 6 Atenuando o som rapidamente . . . . . . . . . . 12
Operaçõe iniciais Alterando os ajustes do som
e do visor . . . . . . . . . . . . . . . . . . . . . . . . 12
Inicializando o aparelho . . . . . . . . . . . . . . . . 7 Ajustando o equalizador (EQ3) . . . . . . . . . 13
Colocando/destacando o painel frontal . . . . . 7
Ajustando o relógio . . . . . . . . . . . . . . . . . . . . 8 Informações Adicionais
Reprodutor de CD Manutenção. . . . . . . . . . . . . . . . . . . . . . . . . 14
Removendo o aparelho . . . . . . . . . . . . . . . . 15
Reproduzindo um disco . . . . . . . . . . . . . . . . . 9 Especificações técnicas. . . . . . . . . . . . . . . . 16
Visualizando as informações . . . . . . . . . . . . . 9 Guia para solução de problemas . . . . . . . . . 17
Reproduzindo as faixas repetidamente Código de erros/Mensagens . . . . . . . . . . . . 18
— Repeat Play . . . . . . . . . . . . . . . . . . . . 10
Reproduzindo as faixas em ordem aleatória
— Shuffle Play . . . . . . . . . . . . . . . . . . . . 10
Rádio
Memorização automática de emissoras
— BTM (Best Tuning Memory). . . . . . . 10
Sintonizando as emissoras memorizadas. . . 11
Memorizando somente as emissoras
desejadas . . . . . . . . . . . . . . . . . . . . . . . . . 11

3
Localização dos controles
Consulte as páginas listadas para detalhes.

SEL

SEEK

MODE OFF

SOURCE REP SHUF EQ3

ATT SENS 1 2 3 4 5 6 BTM DSPL

a Tecla Volume +/– m Tecla BTM (Memorização Automática


b Tecla SEL (seleção) de Emissoras) 10
Seleciona itens. n Tecla DSPL (altera o modo de
c Tecla MODE visualização) 8, 9
Mudança de função o Tecla EQ3 (ajuste do equalizador) 13
d Indicações do visor p Receptor do controle remoto
e Tecla OFF (Parar/Desligar)* 7, 9 q Tecla SEEK +/–
f Tecla Z (ejetar) 9 Rádio: 11
g Tecla (libera o painel frontal) 7 Sintoniza as emissoras automaticamente/
h Tecla SOURCE (Ligar/Rádio/CD) encontra uma emissora manualmente.
Seleciona a fonte de som. CD: 9
i Tecla ATT (atenuar o som) 12 Pulando faixas/Avanço rápido e retrocesso
j Tecla SENS de faixas.
(busca local de emissoras) 11
k Tecla RESET (localizado na parte frontal * Advertência para a instalação em um
do aparelho, atrás do painel) 7 automóvel que não possui a posição ACC
l Teclas numéricas (acessório) na chave de ignição
Rádio: 11 Certifique-se de pressionar (OFF) no
Armazena a emissora desejada em cada tecla aparelho por aproximadamente 2 segundos
numérica. para desativar a visualização do relógio após
CD: 10 desligar o automóvel.
(3): REP Caso contrário, a indicação do relógio não
(4): SHUF será desativada, podendo descarregar a
bateria do automóvel.

4
Notas sobre a bateria de lítio
Controle remoto RM-X115 (fornecido • Mantenha a bateria de lítio fora do alcance das
crianças. Se a bateria for engolida, consulte um
somente para CDX-S2007XB) médico imediatamente.
(opcional para CDX-S2007X, • Limpe a bateria com um pano seco para
CDX-S2007XG e CDX-S2007XP) assegurar um bom contato.
• Certifique-se de observar a polaridade correta
quando instalar a bateria.
DSPL MODE • Não segure a bateria com pinças metálicas,
caso contrário, pode ocorrer curto-circuito.

+
PRESET
Atenção!
A bateria poderá explodir se for mal utilizada.
SEEK– SOURCE SEEK+
Não recarregue, desmonte nem jogue a
bateria ao fogo.

PRESET Nota
Caso o controle remoto sem fio deixe de
OFF + ATT
VOL operar, primeiro substitua a bateria por uma
– nova. Se o problema persistir, consulte um
Serviço Autorizado Sony.
Importante
Quando o painel estiver com a visualização
As teclas correspondentes do controle do relógio, você poderá ligar o aparelho com
remoto sem fio têm as mesmas funções a tecla (SOURCE) do controle remoto sem
daquelas no aparelho. fio. Quando o painel estiver completamente
apagado, não será possível ligar o aparelho
a Tecla DSPL através do controle remoto sem fio.
b Tecla SOURCE (liga o aparelho)
c Teclas SEEK/AMS (–/+)
d Tecla OFF (desliga o aparelho)
e Teclas VOL (+/–)
f Tecla MODE
g Teclas DISC/PRESET (+/–)
h Tecla ATT
Nota
Quando o aparelho for desligado, pressionado-se a
tecla (OFF) por aproximadamente 2 segundos, este
não poderá ser operado através do controle remoto
sem fio, a menos que se pressione a tecla (SOURCE)
no aparelho ou um CD seja inserido para ativá-lo.

Trocando a bateria de lítio


Quando a bateria ficar fraca, o alcance do
controle remoto sem fio diminuirá. Troque a
bateria por outra (CR2025). Utilizar qualquer
outro tipo de bateria pode apresentar risco de
fogo ou explosão.

x
lado + para cima

5
Precauções Notas sobre os discos
• Se o automóvel ficar estacionado sob o sol, • Para manter um som perfeito, segure o disco
resultando em uma elevação considerável de pelas bordas. Para mantê-lo limpo, não toque
temperatura, aguarde o aparelho retornar à em sua superfície.
temperatura normal antes de utilizá-lo • Deixe os discos dentro da caixa ou dentro do
novamente. magazine. Não exponha os discos à luz solar
• Se o automóvel estiver equipado com uma direta ou fontes de calor, como dutos de ar
antena elétrica, observe que esta será acionda quente. Não deixe os discos no interior de um
quando o rádio for ligado. automóvel estacionado sob o sol, onde poderá
Para esclarecimento de dúvidas ou problemas ocorrer uma elevação considerável de
que não constam neste manual, consulte um temperatura.
Serviço Autorizado Sony.
Condensação de umidade
Em dias chuvosos ou em locais muito úmidos,
pode ocorrer condensação de umidade no interior
das lentes do reprodutor de CDs. Se isto ocorrer,
o aparelho não irá operar corretamente. Neste
caso, remova o disco e espere por aproximada-
mente uma hora com o aparelho ligado, até que a
umidade evapore. • Não cole papel ou fitas adesivas na superfície.
Se utilizar discos que possuam resíduos de fitas
Para manter a alta qualidade de som adesivas ou etiquetas mal coladas, causará a
Se você possuir suportes para bebidas próximos parada do CD, podendo resultar em
ao seu equipamento de áudio, seja cuidadoso funcionamento inadequado ou danificação do
para não deixar que suco ou outras bebidas sejam seu CD.
derrubadas dentro do aparelho e no CD.
Resíduos de açúcar no aparelho ou no CD podem
contaminar as lentes dentro do aparelho,
comprometendo a qualidade de som ou sua
reprodução.

• Discos com formatos especiais (formato de


coração, disco octogonal, etc.) não podem ser
reproduzidos neste aparelho. Se tentar
reproduzi-los, danificará o aparelho. Não
utilize estes tipos de discos.
• Não é possível a reprodução de CDs de 8 cm..
• Antes de reproduzi-los, limpe os discos com
um pano macio, passando-o no sentido do
centro para as bordas. Não use solventes, tais
como benzina, thinner, limpadores ou spray
anti-estáticos, destinados a discos de vinil.

6
Operações iniciais Colocando/destacando
o painel frontal
Você pode destacar o painel frontal deste
Inicializando o aparelho aparelho para evitar que ele seja roubado.

Ao utilizar o aparelho pela primeira vez ou após Colocando o painel frontal


a substituição da bateria do automóvel, inicialize Posicione o furo A do painel frontal no pino B
o aparelho. no aparelho, conforme a ilustração, e empurre o
Remova o painel frontal e pressione a tecla lado esquerdo até que faça um clique e encaixe
RESET (localizada na parte frontal do aparelho, firmemente.
com o painel frontal destacado), utilizando um
objeto pontiagudo, como a ponta de uma caneta.

Tecla RESET
Nota
A
Ao se pressionar a tecla RESET, o relógio e algumas
funções memorizadas serão apagadas. B

Nota
Não coloque nada na superficíe interna do painel
frontal.

Destacando o painel frontal

1 Pressione (OFF)*.
A reprodução do CD pára ou o rádio é
desligado (a iluminação das teclas e o visor
continua acesa).
* Se o seu automóvel não possuir a posição ACC
na chave de ignição, certifique-se de desligar o
aparelho, pressionando a tecla (OFF) por
aproximadamente 2 segundos para evitar que a
bateria se descarregue.
2 Pressione e puxe-o pelo lado
esquerdo em sua direção.
(OFF)

7
Notas
• Não deixe o painel frontal cair durante sua remoção.
• Se o painel frontal for destacado com o aparelho Ajustando o relógio
ligado, a alimentação será desligada
automaticamente para prevenir danos aos alto- O relógio utiliza a indicação digital de 12 horas.
falantes.
• Nunca deixe o painel frontal do aparelho no interior Exemplo: Para ajustar o relógio para 10:08
de um automóvel estacionado ao sol, onde poderá
ocorrer elevação considerável de temperatura.
1 Pressione (DSPL) por
Dica aproximadamente 2 segundos.
Ao transportar o painel frontal, coloque-o no estojo A indicação de hora pisca.
fornecido.

Alarme de precaução
Se desligar a chave de ignição sem remover o
painel frontal, o alarme de precaução soará por
alguns segundos, somente quando o aparelho 1 Pressione a tecla volume +/– para
estiver instalado através da chave de ignição. ajustar a hora.
Se você conectar um amplificador de potência 2 Pressione (SEL).
opcional e não utilizar o interno, o alarme ficará A indicação de minuto pisca.
desativado.
3 Pressione a tecla volume +/– para
ajustar os minutos.
2 Pressione (DSPL).

O relógio começará a funcionar. Quando o


ajuste do relógio estiver completo, o visor
retornará ao modo normal.

8
Reprodutor de CD Visualizando as informações
Os seguintes itens serão visualizados.

Reproduzindo um disco Fonte

Insira o disco (lado impresso para


cima).

Número da faixa Itens mostrados


• Tempo de
reprodução
decorrido
• Relógio

A reprodução inicia-se automaticamente.


Para Pressione
Se já houver um disco inserido, pressione
(SOURCE) repetidamente, até que “CD” Mudar os itens (DSPL)
apareça, para iniciar a reprodução. visualizados

Para Pressione
Parar a reprodução Z ou (OFF)
Ejetar o disco Z
Pular faixas (SEEK) (–/+)
– Automatic (./>)
Music Sensor [uma vez para cada faixa]
(Sensor
Automático de
Músicas - AMS)
Avançar (SEEK) (–/+)
rápidamente/ (m/M)
retroceder [mantenha-a pressionada até
– Procura Manual alcançar o ponto desejado]

Notas
• Se (SEEK) (–) ou (SEEK) (+) for pressionada
durante a reprodução aproximada de 2 segundos da
primeira música do disco, a reprodução retornará
para a última música e vice-versa.
• Ao final da reprodução da última música, o aparelho
reiniciará a partir da primeira música do disco.

9
Reproduzindo as faixas Rádio
repetidamente
— Repeat Play Este aparelho pode memorizar até 6 emissoras
em cada faixa (FM1, FM2, FM3, AM1 e AM2).
A faixa atual será repetida quando chegar ao
final. Precaução
Para sintonizar as emissoras de rádio enquanto
Durante a reprodução, pressione (3) estiver dirigindo, utilize a Memorização
(REP) até que “REP” apareça no visor Automática de Emissoras (BTM) para evitar
de indicação. acidentes.
O indicador “REP” é visualizado.

Memorização automática de
emissoras
A Reprodução Repetida inicia-se.
— BTM (Best Tuning Memory)
Para retornar para o modo de reprodução normal, Esta função seleciona as emissoras com sinais
pressione novamente (3) (REP), até que o fortes e as memoriza na ordem de suas
indicador “REP” desapareça do visor. freqüências.

1 Pressione repetidamente a tecla


(SOURCE) para selecionar o rádio.
Reproduzindo as faixas em
2 Pressione repetidamente (MODE) para
ordem aleatória selecionar a faixa.
— Shuffle Play 3 Pressione (BTM) por
aproximadamente 2 segundos.
Você pode reproduzir as faixas do disco atual em O aparelho memoriza as emissoras na ordem
ordem aleatória. de suas freqüências nas teclas numéricas.
Durante a reprodução, pressione (4) Quando termina a memorização, um bipe
(SHUF) até que “SHUF” apareça no toca.
visor. Notas
• O aparelho não memorizará emissoras com sinal
O indicador “SHUF” é visualizado. fraco. Se poucas emissoras foram recepcionadas,
algumas teclas numéricas continuarão em seu
ajuste anterior.
• Quando um número estiver indicado no visor, o
aparelho iniciará a memorização das emissoras a
partir daquele número visualizado.
A Reprodução Aleatória inicia-se.
• A função BTM deverá ser realizada tanto para FM
quanto para AM.
Para retornar para o modo de reprodução normal,
pressione novamente (4) (SHUF), até que o
indicador “SHUF” desapareça do visor.

10
Quando a recepção em FM estiver ruim
Sintonizando as emissoras — Modo Mono
memorizadas Durante a recepção de rádio,
pressione repetidamente (SENS) até
que o indicador “MONO” apareça.
1 Pressione repetidamente (SOURCE)
para selecionar o rádio. O indicador “MONO” é mostrado.

2 Pressione repetidamente (MODE) para


selecionar a faixa.
3 Pressione a tecla numérica ((1) a (6))
na qual a emissora desejada está O som melhora, porém a recepção é em mono
memorizada. (a indicação “ST” desaparecerá).

Quando a emissora memorizada não Para retornar ao modo estéreo, pressione


puder ser recepcionada novamente (SENS) até que a indicação “ST”
apareça.
— Sintonizando automaticamente/Modo
busca local

Sintonia automática: Memorizando somente as


Pressione (SEEK) (+) ou (SEEK) (–)
para procurar a emissora. emissoras desejadas
A procura pára quando o aparelho sintoniza
uma emissora. Repita a operação até que a a Você pode memorizar as emissoras desejadas
emissora desejada seja recebida. manualmente em qualquer tecla númerica.

Modo busca local (Local Seek Mode): 1 Pressione repetidamente (SOURCE)


para selecionar o rádio.
Se o modo de sintonia automática
pára muito freqüentemente, pressione 2 Pressione repetidamente (MODE) para
repetidamente (SENS) até que o selecionar a faixa.
indicador “LCL” apareça.
3 Pressione (SEEK) (+) ou (SEEK) (–)
O indicador “LCL” é visualizado. para sintonizar a emissora que deseja
memorizar.
4 Pressione a tecla numérida desejada
((1) a (6)) por aproximadamente 2
segundos, até que “MEM” apareça.
Somente as emissoras com sinais A indicação da tecla numérica aparece no
relativamente fortes serão recebidas. visor.
Para cancelar o modo busca local, pressione Nota
novamente (SENS). Se memorizar uma nova emissora em uma tecla
númerica ocupada, a emissora anterior será apagada
Dica e substituída pela atual.
Se souber a freqüência da emissora que deseja ouvir,
mantenha pressionada (SEEK) (+) ou (SEEK) (–)
para localizar a freqüência aproximada, depois,
pressione repetidamente (SEEK) (+) ou (SEEK) (–)
para ajustar a freqüência desejada precisamente
(sintonização manual).

11
Outras Funções Alterando os ajustes do som
e do visor
Os seguintes itens podem ser ajustados:
Ajustando o balanço e fader • DEMO* — para ativar ou desativar o modo de
demonstração.
Você pode ajustar o balanço (esquerdo-direito) e – Selecione “ON” para ativar o modo de
fader (balanço traseiro-dianteiro). demonstração (a demonstração inicia-se,
aproximadamente, 10 segundos após o
1 Pressione repetidamente (SEL) até aparelho ser desligado).
que “BAL” ou “FAD” apareça. – Selecione “OFF” para desativar o modo de
Cada vez que pressionar (SEL), o item demonstração.
mudará conforme a seguir: • BEEP — para ativar ou desativar o som de
LOW* t MID* t HI* t bipe.
BAL (esquerda-direita) t
FAD (frente-traseira) Selecionando o item desejado
* Quando EQ3 está ativado (pág. 13). Pressione (SEL) e a tecla numérica
desejada simultaneamente.
2 Ajuste o item selecionado
(SEL) + (4): DEMO*
pressionando a tecla volume +/–.
Nota (SEL) + (6): BEEP
Realize o ajuste dentro de aproximadamente 3
segundos após selecionar o item. * Quando o aparelho está desligado.

Para cancelar o item, pressione (SEL) e a tecla


numérica simultaneamente, novamente.
Atenuando o som
rapidamente
Pressione (ATT).
“ATT” aparece no visor.

Para retornar para o nível de volume anterior,


pressione (ATT) novamente.

12
Ajustando a curva do equalizador
Ajustando o equalizador Você pode ajustar e memorizar os ajustes do
equalizador para diferentes níveis de tonalidade.
(EQ3)
1 Pressione (SOURCE) para selecionar
Você pode selecionar a curva do equalizador uma fonte (rádio ou CD).
entre 7 tipos de músicas (XPLOD, VOCAL,
CLUB, JAZZ, N-AGE, ROCK, CUST e OFF
2 Pressione repetidamente (EQ3) para
selecionar a curva do equalizador
(equalizador desligado)).
desejada.
Você pode armazenar e estabelecer os ajuste do
equalizador para cada fonte de música. 3 Ajuste a curva do equalizador.
1 Pressione repetidamente (SEL)
Selecionando a curva do equalizador para selecionar o nível de
tonalidade.
1 Pressione (SOURCE) para selecionar Cada vez que pressionar (SEL), o nível de
uma fonte (Radio ou CD). tonalidade muda.
LOW t MID t HI (t BAL t FAD)
2 Pressione repetidamente (EQ3) até
que a curva desejada do equalizador 2 Pressione repetidamente a tecla
apareça. volume +/– para ajustar o nível de
Cada vez que pressionar (EQ3), os itens volume desejado.
mudam. O nível do volume é ajustado em passos de
1 dB entre –10 dB a +10 dB.

Para cancelar o efeito de equalização,


selecione “OFF.” 3 Repita os passos 1 e 2 para
ajustar as demais curvas do
equalizador.
Notas
• Para restaurar a curva do equalizador aos ajustes
de fábrica, pressione (SEL) duas vezes, sendo a
primeira momentaneamente e a segunda por
aproximadamente 2 segundos. Este procedimento
deverá ser executado para cada tipo de
Equalização.
• Quando EQ3 está ajustado em “OFF”, você não
pode ajustar a curva do equalizador.

13
Informações Adicionais

Manutenção
Substituição do fusível
Para substituir o fusível, certifique-se de que
tenha a mesma especificação de corrente que o
original. Se o fusível queimar, verifique a
conexão da alimentação e substitua-o. Se o
fusível queimar novamente após sua substituição,
pode ser que haja um problema interno. Neste
caso, consulte um Serviço Autorizado Sony.

Fusível (10 A)

Atenção!
Nunca utilize um fusível cuja corrente exceda a
corrente do fusível que é fornecido com o
aparelho, pois poderá causar sérios danos ao
aparelho.
Limpeza dos conectores
Quando os conectores entre o aparelho e o painel
frontal estiverem sujos, o funcionamento não
será satisfatório. Para evitar este tipo de
problema, retire o painel frontal (página 8) e
limpe os conectores com uma haste de algodão
embebida em álcool, conforme a figura abaixo.
Não exerça força excessiva. Caso contrário, os
pontos de conexão poderão ser danificados.

Aparelho principal

Parte de trás do painel frontal

Notas
• Nunca toque diretamente nos conectores com os
dedos ou objetos de metálicos.
14
2 Remova o aparelho.
Removendo o aparelho 1 Insira as chaves juntas até ouvir um
clique.
1 Remova o ornamento do painel.
1 Destaque o painel frontal (pág. 8).
Ajuste o
2 Utilize as chaves fornecidas para gancho para
retirar o ornamento do painel dentro.
conforme as figuras abaixo.

2 Puxe as chaves para destravar o


Coloque a chave aparelho.
corretamente
3 Puxe as chaves para remover o
ornamento do painel.

3 Remova o aparelho deslizando-o


para fora do suporte.

15
Especificações técnicas
Reprodutor de CD Geral
Relação sinal/ruído 120 dB Saídas Terminal de saída de áudio
Resposta de freqüência 10 – 20.000 Hz (traseiro)
Wow e flutter Abaixo do limite Terminal de controle de
mensurável antena elétrica
Terminal de controle do
amplificador de potência
Rádio Entrada Terminal de entrada de
FM antena
Faixa de sintonia Intervalo de sintonia FM: Controles de tom Baixo:
87,5 – 107,9 MHz ±10 dB a 60 Hz (XPLOD)
(em intervalos de 200 kHz) Médio:
Terminal de antena Conector de antena externo ±10 dB a 1 kHz (XPLOD)
Freqüência intermediária 10,7 MHz Alto:
Sensibilidade útil 9 dBf ±10 dB a 10 kHz (XPLOD)
Seletividade 75 dB at 400 kHz Alimentação 12 V DC bateria de carro
Relação sinal/ruído 67 dB (estéreo), (terra negativo)
69 dB (mono) Dimensões Aprox. 178 × 50 × 176 mm
Distorção harmônica a 1 kHz Dimensões de instalação Aprox. 182 × 53 × 161 mm
0,5 % (estéreo), (L×A×P)
0,3 % (mono) Peso Aprox. 1,2 kg
Separação 35 dB a 1 kHz Acessórios fornecidos Peças para instalação e
Resposta de freqüência 30 – 15.000 Hz conexões (1 jogo)
Estojo do painel frontal (1)
Controle remoto RM-X115
AM somente para
Faixa de sintonia Intervalo de sintonia AM: CDX-S2007XB
530 – 1.710 kHz Acessórios opcionais Controle remoto RM-115
(em intervalos de 10 kHz) para CDX-S2007X,
Terminal de antena Conector de antena externo CDX-S2007XG e
Freqüência intermediária 450 kHz CDX-S2007XP
Sensibilidade 30 µV
Projeto e especificações técnicas sujeitas a
Amplificador alterações sem prévio aviso.
Saídas Saídas para alto-falante
Impedância do alto-falante 4 – 8 ohms
Saída de potência máxima 52 W × 4 (a 4 ohms)

16
A antena elétrica não é ativada
Guia para solução de automaticamente.
A antena elétrica não possui a caixa relé.
problemas
Reprodução de CD
Este guia o ajudará na resolução da maioria dos
problemas que possam ocorrer com o aparelho. Não é possível carregar um disco.
Antes de verificar a lista abaixo, veja os • Outro disco está carregado.
procedimentos de conexão e operação. • O disco foi inserido forçadamente pelo lado
Se o problema persistir, mesmo após as contrário ou de modo errado.
verificações a seguir, procure um Serviço A reprodução não se inicia.
Autorizado Sony. • CD com defeito ou sujo.
• O CD-R/CD-RW não foi finalizado.
Geral • Você tentou reproduzir um CD-R/CD-RW
que não foi elaborado para uso de áudio.
Nenhum som é emitido. • Alguns CD-Rs/CD-RWs podem não ser
• Pressione a tecla volume + para ajustar o reproduzidos devido ao equipamento de
volume. gravação ou às condições do disco.
• Cancele a função ATT.
• Ajuste o controle de fader (balanço dianteiro O disco é ejetado automaticamente.
e traseiro) na posição central do sistema de 2 A temperatura ambiente ultrapassou 50°C.
alto-falantes. Não é possível ejetar o CD.
O conteúdo da memória foi apagado. As teclas de operação não funcionam.
• A tecla RESET foi pressionada. Pressione a tecla RESET.
t Memorize os dados novamente. O som pula devido à vibração.
• O cabo de alimentação ou a bateria foram • O aparelho não está instalado em uma parte
desconectados. rígida do automóvel.
• O cabo de conexão de alimentação não está • O pino traseiro de fixação não foi instalado.
conectado apropriadamente. O som pula.
O bipe não soa. Disco sujo ou com defeito.
• O som de bipe está desativado (pág. 12).
• Uma amplificador opcional está conectado e continua na próxima página t
você não está utilizando o interno.
Nenhuma indicação aparece no visor.
• A indicação do relógio desaparecerá do visor
se mantiver pressionada a tecla (OFF) por
aproximadamente 2 segundos.
t Mantenha pressionada a tecla (OFF) por
aproximadamente 2 segundos para
visualizar o relógio.
• Remova o painel frontal e limpe os
conectores. Veja “Limpeza dos conectores”
(página 14) para maiores detalhes.
A emissoras memorizadas e a hora correta
foram apagadas.
O fusível está queimado.
Aparecem ruídos quando a chave de
ignição está na posição ON, ACC ou OFF.
Os cabos não estão conectados corretamente
ao cabo de conexão de alimentação do
automóvel.
O aparelho não liga.
• Verifique as conexões. Se tudo estiver em
ordem, verifique o fusível.
• O automóvel não possui a posição ACC.
t Pressione (SOURCE) (ou insira um
disco) para ligar o aparelho.
O painel permanece aceso mesmo após o
automóvel ser desligado.
O automóvel não possui a posição ACC. 17
Recepção de rádio
Não é possível sintonizar as emissoras Mensagens e telas de erro
memorizadas.
• Memorize a freqüência correta. Telas de erros
• O sinal das emissoras de rádio estão muito As indicações abaixo piscarão por
fracos. aproximadamente 5 segundos e o alarme soará
Não é possível sintonizar nenhuma Err04
emissora. O CD está sujo ou foi inserido ao contrário.
Há muito ruído no som. t Limpe o CD ou insira-o corretamente.
• Conecte o cabo de controle de antena elétrica
(azul) ou cabo de alimentação vermelho do Err50
acessório (fornecido) ao cabo de alimentação A conexão dos alto-falantes/amplificadores
do amplificador de antena do automóvel não está correta.
(apenas quando o automóvel possuir uma t Veja o manual de instalação deste modelo e
antena com amplificador). verifique a conexão.
• Verifique a conexão da antena elétrica do Err60
automóvel. Pode haver um mau funcionamento interno.
• A antena elétrica automática não é ativada. t Verifique a conexão. Se a indicação de erro
t Verifique a conexão da alimentação do permanecer no visor, consulte a assistência
controle da antena elétrica. técnica Sony.
• Verifique a freqüência. Err99
A sintonização automática não é possível. O reprodutor de CD não pode ser operado
• O modo de busca local está ajustado em devido algum problema.
“ON.” t Pressione a tecla RESET do aparelho.
t Ajuste o modo busca local para “OFF”
(página 11).
• Os sinais das emissoras de rádio estão muito Mensagem de erro
fracos. “ ” ou “ ”
t Sintonize manualmente. O disco está no início ou no fim e não é
A indicação “ST” pisca. possível realizar nenhuma operação.
• Sintonize a emissora corretamente.
• Os sinais das emissoras de rádio estão muito Se as sugestões anteriores não o ajudarem na
fracos. solução dos problemas, ou se tiver alguma
t Ajuste o modo Mono (página 11). dúvida, procure um Serviço Autorizado Sony.
Um programa de rádio em estéreo é ouvido
em mono.
O aparelho está no modo de recepção mono.
t Cancele o modo de recepção mono
(página 11).

18
TERMO DE GARANTIA Modelo: CDX-S2007X/S2007XG
CDX-S2007XB/CDX-S200XP

I-CONTEÚDO E PRAZO DE GARANTIA D FCPQU´RCTVGGZVGTPCFQRTQFWVQ


ICDKPGVG H QRTQFWVQUQHTGTSWCNSWGTFCPQRQTCEKFGPVG
1. #5QP[$TCUKN.VFCICTCPVGQRTQFWVQCEKOC RCKPGNCECDCOGPVQUDQVÐGUGVE DGOEQOQ
SWGDTC QWCIGPVGFCPCVWTG\C
TCKQ
KFGPVKHKECFQQSWCNHQKTGEGDKFQFGXKFCOGPVG RGÁCUGCEGUUÎTKQUUWLGKVQUCSWGDTCECWUCFCRQT GPEJGPVGOCTGUKCGVE 
NCETCFQRGNQRTC\QFG12 (doze)OGUGU OCWUVTCVQU I QRTQFWVQHQTOCPWUGCFQQWWUCFQGO
KPENWÈFQQFCICTCPVKCNGICN
RTKOGKTQUPQXGPVC E OCPWUGKQKPCFGSWCFQKPFGXKFQCQUHKPUCSWG FGUCEQTFQEQOQ/CPWCNFG+PUVTWÁÐGUSWGQ
FKCU EQPVCFQUCRCTVKTFCCSWKUKÁºQRGNQ UGFGUVKPCGOFGUCEQTFQEQOCU CEQORCPJC
RTKOGKTQEQPUWOKFQTEQPVTCFGHGKVQUFG TGEQOGPFCÁÐGUFQ/CPWCNFG+PUVTWÁÐGU J SWCNSWGTOQFKHKECÁºQHQTKPVTQFW\KFCPQ
RTQLGVQHCDTKECÁºQOQPVCIGOQW CRCTGNJQPºQRTGXKUVCPQ/CPWCNFG
III-INVALIDADE DA GARANTIA
UQNKFCTKCOGPVGGOFGEQTTÄPEKCFGXÈEKQUFG +PUVTWÁÐGU
1. #)CTCPVKCHKECCWVQOCVKECOGPVGKPXCNKFCFCUG
SWCNKFCFGFQOCVGTKCNSWGQVQTPGKORTÎRTKQ
C PºQHQTCRTGUGPVCFCC0QVC(KUECNFGXGPFCPQ IV-FORMA E LOCAL DE UTILIZAÇÃO DA
QWKPCFGSWCFQCQEQPUWOQCSWGUGFGUVKPC
$TCUKNQWFQEWOGPVQHKUECNGSWKXCNGPVG GARANTIA
2. #)CTCPVKCUGHC\OGFKCPVGCGZKDKÁºQFGUVG
EQPLWPVCOGPVGEQOQ6GTOQFG)CTCPVKC 1. 2CTCWUWHTWKTFGUVCICTCPVKCCFKEKQPCN´NGICNQ
VGTOQDGOEQOQFC0QVC(KUECN
D QRTQFWVQHQTNKICFQGOTGFGGNÃVTKECHQTCFQU EQPUWOKFQTFGXGT¶WVKNK\CTUGFGWOFQU
EQTTGURQPFGPVG
RCFTÐGUGURGEKHKECFQUQWUWLGKVCCHNWVWCÁºQ 2QUVQUFG5GTXKÁQ#WVQTK\CFQ5QP[FGPVTG
II-EXCLUDENTES DA GARANTIA GZEGUUKXCFGXQNVCIGO CSWGNGUSWGEQPUVCOPCTGNCÁºQSWG
1. 1RTGUGPVG6GTOQGZENWKFGURGUCUFG E QRTQFWVQVKXGTUGWNCETGXKQNCFQHQTCDGTVQ CEQORCPJCQRTQFWVQ
VTCPURQTVGHTGVGUGIWTQEQPUVKVWÈFQUVCKU RCTCEQPUGTVQOCPWUGCFQQWVKXGTQEKTEWKVQ 2. 'UVC)CTCPVKCÃX¶NKFCCRGPCUGOVGTTKVÎTKQ
KVGPUÏPWUGTGURQPUCDKNKFCFGFQEQPUWOKFQT QTKIKPCNCNVGTCFQRQTVÃEPKEQPºQCWVQTK\CFQQW DTCUKNGKTQ
CNÃOFGPºQEQDTKT PºQETGFGPEKCFQ 3. 1VTCPURQTVGFQRTQFWVQCQ2QUVQFG5GTXKÁQ
C RGÁCUSWGUGFGUICUVCOPCVWTCNOGPVGEQOQ F QPÕOGTQFGUÃTKGFQRTQFWVQHQTTGOQXKFQQW #WVQTK\CFQÃFGTGURQPUCDKNKFCFGFQ
WUQTGIWNCTVCKUEQOQECDGÁCUITCXCFQTC CNVGTCFQ EQPUWOKFQT
TGRTQFWVQTCECDQFGOKETQHQPGECDQUG G QRTQFWVQHQTWVKNK\CFQGOCODKGPVGUUWLGKVQUC
GURWOCUFQUHQPGUFGQWXKFQCIWNJC ICUGUEQTTQUKXQUWOKFCFGGZEGUUKXCQWGO
N¸ORCFCUFGOQUVTCFQTGVE
RCTCNKPJC¶WFKQ NQECKUEQOCNVCUDCKZCUVGORGTCVWTCURQGKTC
XÈFGQG68UEQOXÈFGQKPVGITCFQ  CEKFG\GVE

Unidade comercial: 5QP[$TCUKN.VFC


Rua Inocêncio Tobias, 125, Bloco A, Barra Funda,
São Paulo - SP - CEP 01144-000
ATENÇÃO 5GTXKÁQFG#VGPFKOGPVQCQ%QPUWOKFQT
5#% 
'UVG6GTOQFG)CTCPVKCUÎVGOXCNKFCFGSWCPFQ )TCPFG5ºQ2CWNQ
:: 
CEQORCPJCFQFC0QVC(KUECNEQTTGURQPFGPVG 1WVTCUNQECNKFCFGU
%QPUGTXGQUGOUGWRQFGT
JVVRYYYUQP[EQODT