Você está na página 1de 60

Sumrio

Tecnologia de DNA recombinante Processo de clonagem por recombinao Vectores de clonagem Enzimas de restrio Preparao de clulas para clonagem Seleco de clones recombinantes Produto PCR e sequenciao Southern blotting Criao de uma biblioteca (banco) de genes Varrimento de uma biblioteca de DNA Vectores de expresso

Processo de clonagem por recombinao de DNA

Construo

Transformao

Seleco

Construo
Requisitos:
Enzimas de restrio Vector plasmdico T4 DNA ligase Fosfatase alcalina

Enzimas de restrio (endonucleases do tipo II)


-Definio Enzimas bacterianas que clivam internamente molculas de DNA em sequncias de pares de bases especficas (locais de reconhecimento ou sequncias palindrmicas) No digerem o DNA endgeno que se encontra modificado em algumas sequncias (metilado)

EcoRI extremidades coesivas

HindII extremidades rombas

Exemplos de endonucleases de restrio e respectivas sequncias de reconhecimento

Vectores de clonagem

Vectores plasmdicos de clonagem


Definio:
Plasmdeos so molculas circulares de dupla cadeia de DNA com capacidade de auto-replicao, que so mantidos em bactrias como entidades extracromossmicas.

Caractersticas gerais:
- tamanho compreendido entre 1 e 500 kb - sequncia que funciona como origem do local de replicao na bactria (independente do cromossoma oriB) - representados por 10-100 cpias por clula hospedeira (mltiplas cpias) - representados por 1-4 cpias (baixo n de cpias)

Caractersticas exigidas para clonagem:


- tamanho menor do que15 kb, para facilitar a transferncia para E. coli - nico local de reconhecimento para enzimas de restrio para insero do gene a clonar - um ou mais marcadores genticos selectivos para identificar as clulas - local de origem de replicao no hospedeiro

Vectores de clonagem
pBR322
Local de clonagem mltipla

- Informao para manuteno do DNA recombinado num dado sistema biolgico

Plasmdeos

LacZ

DNA circular extracromossmico


Procariotas Eucariotas (especfico para tecidos ou clulas)

Vectores para clonagem de largos fragmentos de DNA


Bacteriofagos
Possibilidade de clonagem de genes at 25 kb
Ciclo ltico replicaes atravs de infeces sucessivas das bactrias (forma placas) Ciclo lisognico integrao do DNA fgico no genoma bacteriano com replicao paralela ao cromossoma da bactria Fagos de insero mximo de 15 kb ( gt 10) Podem ser plaquados em alta densidade DNA nas placas fgicas mais acessvel do que DNA plasmdico nas placas bacterianas (bilbliotecas genmicas) Fagos de substituio at 20-25 kb

(EMBL4)

Vectores para clonagem de largos fragmentos de DNA


Csmidos
Vectores hbridos (fagos+plasmdeos) Possibilidade de clonagem de genes at 45 kb Fago infeco Plasmdeo replicao Clonagem de genes eucariotas

BACs
Possibilidade de clonagem de genes at 300 kb Transformao de bactrias

YACs
Possibilidade de clonagem de genes at 1 Mb Transformao de leveduras Local de clonagem Marcas de seleco Centrmero 2 Telmeros Dividem-se quando a clula da levedura sofre mitose

Ligao dos 2 fragmentos de DNA


Excesso dos fragmentos de DNA relativamente ao plasmdeo Annealing de extenses complementares aps clivagem por enzimas de restrio

Modo de aco da T4 DNA ligase

+ ATP

Tratamento com a fosfatase alcalina


Remoo do grupo fosfato 5 Reduzir a extenso de formao do plasmdeo original

Reparao posterior pelas bactrias

Mapa gentico do plasmdeo vector de clonagem

pBR322
Combinao de enzimas de restrio

EcoRI HindIII

Clonagem unidireccional

Preparao de clulas competentes de E. coli e respectiva transformao


Preparao das clulas bacterianas hospedeiras para a insero da construo recombinante
- Tratamento das bactrias com CaCl2 (4C) na presena do plasmdio a incorporar - Aquecimento a 42C durante 90 s - Arrefecimento a 4C - Incubao em meio de cultura lquido (meio LB) a 37C durante 1-2 horas
(Processo com baixo rendimento (1/1000))

- Escolha de estirpes bacterianas desprovidas de genes para enzimas de restrio

Alternativas: Electroporao Conjugao

Seleco de clones recombinantes


Identificao das clulas contendo a construo com o gene clonado

- Cultura em placas (meio LB slido enriquecido com antibiticos) a 37C at ao aparecimento de colnias.

1) Meio de cultura enriquecido em ampicilina (seleco dos clones contendo o plasmdeo recombinante e o plasmdeo original)

2) Meio de cultura enriquecido em tetraciclinas (seleco dos clones contendo o plasmdeo original)

Preparao de plasmdeo de DNA em larga escala

- Repicagem para meio de cultura lquido. Crescimento at saturao.

-Digesto das bactrias por lise alcalina (soluo de NaOH/SDS)


(separao do plasmdeo do DNA cromossmico associado a protenas)

- Extraco do DNA por precipitao com isopropanol e etanol (1:2; v:v)

- Purificao em centrifugao por gradiente com CsCl

Caracterizao do plasmdeo
Caracterizao dos clones
Mapas de restrio (enzimas de restrio e electroforese em gel de agarose) Southern blot Northern blot

Amplificao do DNA

Sequenciao do DNA

Amplificao do DNA PCR


Requisitos
DNA molde Par de oligonucleotdeos (18-30 mer) primers DNA polimerase termoestvel (Taq DNA polimerase) Mg2+ e dNTPs

Ciclos PCR
Desnaturao da dupla cadeia de DNA (95C) Ligao dos primers ao DNA molde (55C) (annealing) Sntese de DNA mediada pela DNA polimerase (75 C) Tempo total (aprox. 3-5 min)

Rendimento = 2n (n representa o n de ciclos)

Amplificao do DNA PCR

Mapeamento de genes (mapas de restrio)


Clivagem simples Clivagem dupla

DNA superenrolado DNA circular (relaxado) DNA linear

3.9kb

650pb
400pb p10 - 450pb p14.5 - 550pb

Gel de agarose

Sequenciao do DNA

Aplicaes:
Confirmar a natureza das construes Identificar alteraes no DNA Caracterizar o genoma dos organismos vivos

Importncia da electroforese em gel de acrilamida vertical


(separao de oligonucleotdeos com apenas 1 nucleotdeo de diferena)

Importncia da bioinformtica

Sequenciao do DNA
Mtodo da terminao da cadeia (Mtodo de Sanger)

electroforese

Sequenciadores automticos

Importncia da bioinformtica
Bancos de dados: Genbank e EMBL Sequence Database Anlise de sequncias: experimentao in silico

Aplicaes:
Software - identificao de genes e respectiva estrutura - traduo de sequncias de nucleotdeos em sequncias de aa - previso de estruturas de cidos nucleicos e de protenas - previso sobre a localizao e funo de protenas - procura de homologias entre protenas (ancestral comum) (funes similares sequncia de aa parecida) Similaridade vs homologia

FOS_RAT KCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGF 212 FOS_MOUSE KCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGF 212 FOS_CHICK KCRNRRRELTDTLQAETDQLEEEKSALQAEIANLLKEKEKLEFILAAHRPACKMPEELRF 211 FOSB_MOUSE KCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEG- 229 FOSB_HUMAN KCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEG- 229

*********** ********* :** : *: :***:* ****:***:*.**:*.**:*

Criao de uma biblioteca (banco) de genes


Bibliotecas genmicas (procaritas) vs bibliotecas de cDNA (eucaritas) Como clonar e seleccionar uma sequncia alvo a partir do genoma de um procarita?
Segmentar o genoma do organismo com enzimas de restrio

Inserir o segmento no vector de clonagem

Identificao, isolamento e caracterizao dos clones

Clulas contendo o DNA alvo

Identificao do DNA por radiografia aps hibridao com uma sonda marcada de DNA

Identificao da protena produzida por processos imunolgicos

Identificao da actividade proteica

Clonagem por tecnologia de DNA recombinante

Criao de uma biblioteca (banco) de genes


Bibliotecas genmicas (procaritas) vs bibliotecas de cDNA (eucaritas) Como clonar e seleccionar uma sequncia alvo a partir do genoma de um procarita? (0,02% DNA cromossmico)
Segmentar o genoma do organismo com enzimas de restrio

Inserir o segmento no vector de clonagem

Identificao, isolamento e caracterizao dos clones

Clulas contendo o DNA alvo

Identificao do DNA por radiografia aps hibridao com uma sonda marcada de DNA

Identificao da protena produzida por processos imunolgicos

Identificao da actividade proteica

Varrimento de uma biblioteca de DNA


(biblioteca genmica)
Baseado na hibridao de cadeias de DNA complementar Annealing Desnaturao (arrefecimento suave) (NaOH ou aquecimento)

(Nylon; nitrocelulose)

Autoradiografia (32P)

N de clones (N) N=log(1-P)/log(1-1/n)


P probabilidade de encontrar um fragmento nico (>95%)
n Tamanho genoma/tamanho insero
(NaOH)

(100 a 1000 pb)

Ex: Insero de 20 Kb gene humano


1X106 clones

Lavagem

Varrimento de uma biblioteca de DNA (pesquisa da protena)


Ensaio imuno-enzimtico

Marcao de sondas

Converso enzimtica de substractos


Cromognicos Quimioluminescentes (validade de 1 ano RT) (pouca sensibilidade)

Istopos radioactivos (32P)

Autoradiografia
(curto tempo de meia vida (perigo radioactividade) (muita sensibilidade)

Clonagem de sequncias de DNA que codificam para protenas eucaritas (bibliotecas de cDNA)

DNA polimerase (extremidades coesivas)

Phage display library

Vectores de expresso

Vectores de expresso in vivo


Tipo de produtos
- RNA Sondas antisense para RNA (riboprobes) Oligonucleotdeos (silenciamento de genes)

- Protenas

Uso teraputico Cristalizao (estudos estruturais e funcionais) Produo de mAb

Tipo de sistemas
- Vectores de expresso procariticos (bactrias)

- Vectores de expresso eucariticos

Leveduras (Saccharomyces cerevisiae) Baculovrus em cl. de insecto Clulas de mamfero em cultura

Sistema de expresso procariticos


E. coli
sistema muito bem caracterizado manipulao fcil crescimento rpido e econmico fcil transposio de escala elevados nveis de expresso estirpes mutantes (degradao das protenas heterlogas minimizada)

Requisitos/caractersticas clonagem de cDNA (bactria no faz splicing de intres) sequncia de ligao aos ribossomas (ShineDalgarno) junto ao codo de iniciao promotores regulveis (ex: reconhecido pela RNA polimerase do fago T7) estirpes mutantes (T7 RNA polimerase indutvel no cromossoma bacteriano)

pouco adequado expresso de protenas de grandes dimenses incapacidade de processamento ps-traduo

Vectores de expresso
Gene da resistncia ampicilina (seleco) Promotor tac (potente e regulvel) Local de ligao ao ribossoma Codo ATG separado por 8 nucletidos do local de ligao do ribossoma Locais de clonagem Terminadores de transcrio

Sistema de expresso procariticos Sobreexpresso de protenas


Alterao da temperatura Diminuio da expresso proteica Secreo de protenas Aumento da solubilizao Aumento de estabilidade

Formao de corpos de agregados insolveis de protena (corpos de incluso)

Fcil purificao Resistncia s proteases Produo de antignios

Desnaturao proteica Perda de funo

Criao de vectores especializados que permitam o control


Natureza do promotor transcricional Sequncias terminadoras Transcrio

A potncia do local de ligao dos ribossomas


Nmero de cpias do gene clonado Integrao cromossmica ou localizao epissomal do gene clonado Localizao celular final da protena sintetizada

Traduo
Estabilidade da protena Limitao oxignio

Secreo do hospedeiro

Eficincia de traduo no hospedeiro


Estabilidade intrnseca da protena recombinante no hospedeiro

Promotores potentes e regulveis


Localizao upstream do gene a expressar Elevada afinidade para a RNA polimerase (elevada frequncia de transcrio)
Limitaes... Dfice energtico na clula hospedeira Bloqueio de funes vitais s clulas Perda do plasmdeo durante os processos de proliferao celular

Controlo da transcrio

Gene clonado expresso apenas num estdio especfico do ciclo de crescimento celular Durao de expresso limitada

Promotores regulveis
E. coli Lac (lactose) Trp (triptofano) pL (repressor CI)
Interagem com indutores ou repressores especficos Reconhecimento pela RNA polimerase da E. coli

Regulao negativa

CAP Catabolite activator protein - (requer cAMP) cuja actividade


(aumenta a afinidade da RNA polimerase para o promotor)

Glucose

Lactose

Ex: Opero da lactose

Sistema de expresso procariticos


Sequncia Shine-Dalgarno (sequncia consenso) AAACAGGAGG Codo de iniciao AUG

IPTG
(isopropyl-thio-b-D-galactopyranoside)

Activao do promotor lac na bactria

Sntese da T7 RNA polimerase

Elevada taxa de proliferao bacteriana Atenuar os efeitos txicos da sobreexpresso da protena heterloga

Potenciao da expresso por aco da temperatura

Repressor cI funciona a 28C mas inactivado a 42C

Expresso

Crescimento bacteriano

Escala piloto (20 a 200 litros) ou industrial (> 200 l)


Indutores qumicos Aumento de temperatura 2 plasmdeos Custos elevados

Potenciao da traduo ?? Potenciar a transcrio > Eficcia de traduo


Sinal de iniciao da traduo (local de ligao do ribossoma) Ex. UAAGGAGG ou GGGGG

Maior afinidade de ligao

Maior eficcia da traduo

Aspectos crticos:
Local de ligao do ribossoma distante do codo de iniciao (AUG) Estrutura 2ria do RNAm no mascare o local de ligao ribossmico

Aumento da estabilidade proteica


Adio de amino cidos ao terminal amnico (NH2) das protenas
b-galactosidase

aa
Met, Ser, Ala Thr, Val, Gly Ile, Glu Tyr, Gln Pro Phe, Leu, Asp, Lys Arg

T1/2
> 20 h > 20 h > 30 min 10 min 7 min 3 min 2 min

Oxigenao das culturas: modos de optimizao


Necessrio viabilidade e proliferao celular Solubilidade limitada em meio aquoso Dissoluo lenta

O2

Proliferao celular

Consumo de Oxignio

Fase estacionria de crescimento

Alterao de metabolismo Degradao das protenas recombinantes

Produo de proteases

Oxigenao das culturas: modos de optimizao (cont...)

Utilizao de estirpes deficitrias em proteases obtidas por Mutagnese induzida

Insero do gene da hemoglobina bacteriana (Vitreoscilla bacterium)

Exemplos de aplicao industrial:

- E. coli - Streptomyces lividans - Corynebacterium glutamicum - Xanthomonas maltophilia

Integrao do DNA no cromossoma do hospedeiro


Obviar os processos de seleco das clulas transformadas Reduo de custos escala industrial (perda de plasmdeos por elevada carga metablica) Segurana para o meio ambiente

Integrao cromossmica

Similaridade de sequncias (50 nucletidos)

Recombinao homloga

Protenas de fuso
Objectivos:
Proteger o produto de expresso das proteases das clulas hospedeiras Permitir a purificao eficaz das protenas recombinantes a partir da biomassa Informao qualitativa e quantitativa sobre a expresso de protenas

Estratgia:
Promover a ligao covalente entre o produto do gene alvo e uma outra protena (ex. protena da clula hospedeira)

Construo ao nvel do DNA, atravs da ligao das regies codificantes dos dois genes (alvo e hospedeiro), mantendo inalterada a sequncia do gene alvo

Sistema de expresso procariticos Protenas de fuso Purificao de protenas

Glutationa-S- transferase Polihistidina (His)6

Aplicaes:
Purificao por cromatografia de imunoafinidade

Glutationa-S- transferase (Ligando: glutationa; eluente: agente redutor) Polihistidina (His)6 (ligando Ni2+ eluente: Imidazole)

Clivagem mediada pela Enterocinase intestinal bovina

Clivagem das protenas de fuso:


Manuteno das propriedades biolgicas da protena recombinante (clonada) Facilitar aprovao por parte das autoridades regulamentares

Estratgia:
Insero de pequenas cadeias de amino cidos que so reconhecidos como locais de corte por proteases no bacterianas

Factor de coagulao