Você está na página 1de 153

UNIVERSIDADE FEDERAL DE GOIS

ESCOLA DE VETERINRIA
PROGRAMA DE PS-GRADUAO EM CINCIA ANIMAL

INFECES POR Ranavirus E COCOS GRAM-POSITIVOS EM


GIRINOS E RS DE CRIAO (Rana catesbeiana Shaw, 1802) DO
ESTADO DE GOIS.
.

Rolando Alfredo Mazzoni Romero


Orientador: Prof. Dr. Albenones Jos de Mesquita

GOINIA
2006

ii

ROLANDO ALFREDO MAZZONI ROMERO

INFECES POR Ranavirus E COCOS GRAM-POSITIVOS EM


GIRINOS E RS DE CRIAO (Rana catesbeiana Shaw, 1802) DO
ESTADO DE GOIS.

Tese apresentada para


obteno do grau de Doutor em
Cincia Animal junto Escola de Veterinria
da Universidade Federal de Gois

rea de Concentrao:
Sanidade Animal
Orientador:
Prof. Dr. Albenones Jos de Mesquita CPA, UFG
Comit de Orientao:
Prof. Dra. Iolanda Aparecida Nunes CPA, UFG
Prof. Dra. Wilia M. E. D. de Brito IPTSP, UFG

GOINIA
2006

iii

AGRADECIMENTOS

Para quem veio de outro pas e ficou quatro anos desenvolvendo este
trabalho praticamente impossvel fazer uma lista de todas as pessoas e
instituies que contriburam para realizao do mesmo. A Energia Universal
manifestou-se brindando apoio em todas as formas possveis, desde o trabalho
da Taq DNA polimerase at na forma de inmeras pessoas e Instituies.
Assim sendo, quero expressar meu reconhecimento especial para:
CAPES, que na celebrao do Convnio com a Universidade de la
Repblica do Uruguai fez possvel a realizao deste doutorado.
Universidade Federal de Gois, que abriu as portas para a realizao
deste trabalho.
Universidade de la Repblica do Uruguai, e especialmente Facultad de
Veterinria, e Instituto de Investigaciones Pesqueras.
Escola de Veterinria da UFG, e especialmente ao Programa de Psgraduao em Cincia Animal.
Ao Centro de Pesquisa em Alimentos da Escola de Veterinria que foi
minha casa durante este perodo.
Aos Professores e funcionrios, especialmente meu orientador Prof. Dr.
Albenones Jos de Mesquita pelo apoio constante e principalmente pela amizade
e sua qualidade humana.
Aos colegas da ps-graduao pelo bom companheirismo, apoio e estimulo
recebido.
minha famlia pela difcil tarefa de convivncia com um ps-graduando.

iv

SUMRIO
CAPITULO 1 1 CONSIDERAES GERAIS ..........................................
2 REVISO DA LITERATURA .........................................................................
3 OBJETIVOS ..................................................................................................
REFERNCIAS.................................................................................................
CAPITULO 2 CARACTERIZAO DE RANAVIRUS
ISOLADOS DE
GIRINOS DE R TOURO (Rana catesbeiana Shaw, 1802)
EM RANRIOS COMERCIAIS .......................................
RESUMO .........................................................................................................
ABSTRACT ......................................................................................................
1 INTRODUO...............................................................................................
2 MATERIAL E MTODOS ..............................................................................
2.1 Amostras de Vrus .....................................................................................
2.2 Isolamento de vrus ...................................................................................
2.3 Reao em cadeia da polimerase (PCR) ..................................................
2.4 Seqenciamento ........................................................................................
3 RESULTADOS ..............................................................................................
3.1 Isolamento em cultura de clulas .............................................................
3.2 Reao em cadeia da polimerase (PCR) ..................................................
3.3 Seqenciamento ........................................................................................
4 DISCUSSO E CONCLUSES ..................................................................
REFERNCIAS ................................................................................................
CAPITULO 3 RANAVRUS ASSOCIADOS A MORTANDADE DE GIRINOS
(Rana catesbeiana Shaw, 1802) DE CRIAO INTENSIVA
NO BRASIL. ...................................................................
RESUMO .........................................................................................................
ABSTRACT ......................................................................................................
1 INTRODUO ..............................................................................................
2 MATERIAL E MTODOS ..............................................................................
2.1 Amostragem de girinos ..............................................................................
2.2 Anlise Microbiolgica ...............................................................................
2.3 Histopatologia ............................................................................................
2.4 Reao em cadeia da polimerase (PCR) ..................................................
2.5 Microscopia eletrnica de transmisso ......................................................
2.6 Parasitologia ..............................................................................................
3 RESULTADOS ..............................................................................................
3.1 Epizootiologia ............................................................................................
3.2 Evidncias clnicas ....................................................................................
3.3 Necrpsia ...................................................................................................
3.4 Histopatologia ............................................................................................
3.5 Microbiologia .............................................................................................
3.6 Reao em cadeia da polimerase (PCR) ..................................................
3.7 Parasitologia ..............................................................................................
3.8 Microscopia eletrnica de transmisso.......................................................
4 DISCUSSO E CONCLUSES ..................................................................
4.1 Infeco em girinos jovens
4.2 Infeco em girinos na pr-metamorfose
REFERNCIAS ....
CAPITULO 4 QUADROS INFECCIOSOS EM RS DE CRIAO (Rana
catesbeiana Shaw, 1802) NA FASE PS-METAMRFICA
EM RANRIOS COMERCIAIS. .................................................
RESUMO .........................................................................................................
ABSTRACT ......................................................................................................

1
4
9
10
20
20
21
22
26
26
26
27
29
31
31
31
33
45
48
53
53
54
55
57
57
57
58
59
60
61
62
62
62
63
64
67
67
68
68
69
69
70
73
79
79
80

1 INTRODUO ..............................................................................................
2 MATERIAL E MTODOS ..............................................................................
2.1 Amostragem das rs ..................................................................................
2.2 Microbiologia ..............................................................................................
2.3 Histopatologia ............................................................................................
2.4 Reao em cadeia da polimerase (PCR) ..................................................
2.5 Microscopia eletrnica de transmisso .....................................................
2.6 Protenas sricas totais .............................................................................
2.7 Pesquisa do fungo Batrachochytrium dendrobatidis .................................
2.8 Reproduo da Doena ............................................................................
3 RESULTADOS ............................................................................................
3.1 Epizootiologa ...........................................................................................
3.2 Sinais Clnicos ..........................................................................................
3.3 Achados de necropsia .............................................................................
3.4 Histopatologia .........................................................................................
3.5 Microbiologia ..............................................................................................
3.6 Reao em cadeia da polimerase (PCR) ..................................................
3.7 Microscopia eletrnica de transmisso ......................................................
3.8 SDS page das protenas sericas totais ......................................................
3.9 Pesquisa do fungo Batrachochytrium dendrobatidis ..................................
3.10 Reproduo da doena ............................................................................
4 DISCUSSO E CONCLUSES ...................................................................
REFERNCIAS ..............................................................................................
CAPITULO 5 PROCESSO INFECCIOSO SUPER AGUDO SEMELHANTE
AO CHOQUE ENDOTXICO EM RS DE CRIAO (Rana
catesbeiana Shaw, 1802)
RESUMO .........................................................................................................
ABSTRACT ......................................................................................................
1 INTRODUO ..............................................................................................
2 MATERIAL E MTODOS ..............................................................................
2.1 Amostragem das rs ..................................................................................
2.2 Anlise Histopatologica ..............................................................................
2.3 Reao em cadeia da polimerase (PCR) ..................................................
2.4 Anlise Microbiolgica ...............................................................................
2.5 Microscopia eletrnica de transmisso ......................................................
2.6 Pesquisa do fungo Batrachochytrium dendrobatidis ..................................
3 RESULTADOS ..............................................................................................
3.1 Necrpsia ...................................................................................................
3.2 Histopatologia ............................................................................................
3.3 Microbiologia ..............................................................................................
3.4 Reao em cadeia da polimerase (PCR) ..................................................
3.5 Microscopia eletrnica de transmisso ......................................................
3.6 Pesquisa do fungo Batrachochytrium dendrobatidis .................................
4 DISCUSSO E CONCLUSES ...................................................................
REFERNCIAS ...............................................................................................
CAPITULO 6 CONSIDERAES FINAIS .............................................

81
85
85
86
87
87
89
89
89
90
91
91
91
94
95
99
99
99
99
100
100
101
110
121
121
122
123
125
125
125
126
127
128
128
130
131
131
134
134
134
134
135
139
144

vi

RESUMO
A presena de enfermidades tem inviabilizado a produo nos ranrios
constituindo um dos principais fatores limitantes para o crescimento da atividade.
Objetivou-se com o presente estudo determinar o papel dos vrus da Famlia
Iridoviridae gnero Ranavirus nas doenas de importncia econmica nos
ranrios comerciais, visando relacionar sua eventual presena com os quadros
clnicos observados. Para tanto, foram realizados estudos envolvendo as fases de
girino e de r, pesquisando os agentes etiolgicos, a epizootiologa das doenas,
a sintomatologia clnica, a anatomia patolgica macroscpica, a histopatologia, a
bacteriologia convencional, e a virologia, sendo esta por meio do emprego de
tcnicas moleculares, cultura de clulas e a microscopia eletrnica de
transmisso. Foi diagnosticada pela primeira vez em rs de criao do Brasil, uma
doena especfica que acomete girinos de at 30 dias de idade, determinada por
um vrus da Famlia Iridoviridae, gnero Ranavirus. O quadro, de tipo super
agudo, caracterizou-se por surtos de morbidade e mortalidade acima de 90% da
populao do ranrio. Clinicamente foram observados girinos com edemas e
ascite, assim como girinos finos ou emaciados. As leses localizaram-se
principalmente no fgado e nos rins, com destruio quase completa do
parnquima. Nenhum agente bacteriano pde ser incriminado na etiologia da
enfermidade. Observou-se uma homologia de quase 100% nas regies
seqenciadas do genoma entre o vrus isolado no Brasil com aquelas do Frog
Virus 3, indicando que o agente pode ter sido introduzido no pas pelas rs
importadas de Amrica do Norte. Formas clnicas diferentes foram observadas
nos girinos no perodo pr-metamorfose e nas rs, as que podem ser considerada
como Septicemia estreptoccica secundria devido abundante presena de
cocos Gram-positivos associados s leses. A morte foi conseqncia da
septicemia associada ao comprometimento funcional de rgos vitais como fgado
e rins. Foi identificado um quadro super agudo nas rs, sugerindo, a presena de
uma sndrome semelhante ao choque sptico. A sndrome denominada de perna
vermelha no foi observada em nenhuma das rs estudadas.
Palavras-chave: Aqicultura, estreptococos, ranicultura, septicemias, ranavrus.

vii

ABSTRACT
Diseases are an important limiting factor for frog farming development. This study
was developed to determine the role of virus of the Iridoviridae Family, genus
Ranavirus in economically important diseases affecting farmed frogs, aiming to
find relationships among these viruses and the clinical syndromes observed.
Studies had been carried out with frogs and tadpoles searching for etiological
agents, the epizootiology of the diseases, clinical symptoms, macroscopic
anatomo-pathology, histopathology, conventional bacteriology and virology by
molecular techniques, cell culture and transmission electron microscopy. A
specific illness affecting tadpoles up to 30 days old was characterized for the first
time in farmed frogs of Brazil. The etiological agent is a virus of the Iridoviridae
Family, genus Ranavirus. The syndrome is characterized by sudden outbreaks of
morbidity and mortality above of 90% of the farm population. Clinically, swollen
tadpoles with edemas and ascites were observed, as well as thin or emaciated
ones. Lesions were located mainly in liver and kidneys, with almost complete
tissue destruction. No bacterial agents could be incriminated in the etiology of the
disease. An homology of almost 100% was detected into the genomic areas
studied of the Brazilian virus, when compared with those of Frog Virus 3, indicating
that the agent may have been carried by the frogs from North America. Another
disease was found affecting tadpoles reaching the pre-metamorphic period and
frogs. The disease should be considered as a "secondary streptococci septicemia"
due to the abundance of Gram-positive cocci associated with the observed
lesions. Death was consequence of the septicemia, associated with the functional
damage of the liver and kidneys. A super acute syndrome was identified in frogs
suggesting the presence of septic shock like syndrome. The so-called "red leg
syndrome" was not observed in any of the frogs.
Keywords: Aquaculture, frog farming, septicemia, streptococci, ranavirus.

CAPITULO 1
1 CONSIDERAES GERAIS
A

aqicultura

na

Amrica

do

Sul

tem

experimentado

um

desenvolvimento muito acelerado, principalmente no Brasil, sendo uma das novas


atividades produtivas com fins de obteno de alimentos. Sua importncia fez
com que o atual governo criasse a Secretaria Especial de Aqicultura e Pesca
subordinada diretamente Presidncia da Repblica.
A ranicultura, apesar de constituir uma das atividades mais recentes
dentro da aqicultura mundial, uma das criaes de organismos aquticos que
tem se estabelecido firmemente. Em decorrncia do clima favorvel, da excelente
adaptao da r touro (Rana catesbeiana Shaw, 1802) e da tecnologia
desenvolvida pelos produtores e pesquisadores brasileiros, a ranicultura tornou-se
uma importante atividade no Brasil, particularmente no Estado de Gois. Dados
referentes produo obtida nos anos 2000-2004 colocam Gois como o primeiro
produtor do pas com 150 toneladas anuais, o que representa 90% da exportao
brasileira (SILVA, 2005). Esta produo encontra-se distribuda entre pequenos e
mdios produtores agropecurios, sendo um setor inovador e produtor de
alimentos de alta qualidade para consumo humano. Seus principais mercados
consumidores encontram-se em pases desenvolvidos como Estados Unidos e
Frana, constituindo importante fonte de divisas para os paises exportadores.
Com a gerao de conhecimentos sobre manejo e alimentao, a
ranicultura transformou-se numa atividade super intensiva, com altas densidades
de populao e dependendo estritamente dos alimentos artificiais balanceados.
Entretanto, a esses fatores se associa maior suscetibilidade s doenas de
diversas etiologias o que ameaa viabilidade tcnica e econmica dos criatrios
de organismos aquticos, fato que tambm ocorre em outras atividades
produtivas (AUSTIN, 1984).
A experincia compartilhada e o alto grau de desenvolvimento
alcanado pela ranicultura no Brasil indicam que a presena de enfermidades tm
inviabilizado a produo nos ranrios constituindo-se em um dos principais fatores
limitantes para o crescimento da atividade (MAZZONI, 2000; HIPLITO, 2002;
SILVA, 2005). O fechamento no ano 2000 do maior ranrio existente no Uruguai

no ano 2000, e o fim das atividades no ano 2005 do maior ranrio do Brasil
situado no Municpio de Hidrolndia, so exemplos relevantes.
Sendo a ranicultura uma atividade relativamente nova, a experincia no
estudo cientfico das doenas em rs de criao ainda pode ser considerada
muito escassa, pois os produtores no tem conhecimento dos agentes etiolgicos
envolvidos e conseqentemente das medidas profilticas e teraputicas
apropriadas.
As descries relativas a mortalidades generalizadas em ranrios,
citam quadros de ascite e edemas em girinos e rs. Estes quadros podem estar
ou no acompanhados de sintomatologia nervosa e, s vezes, as mortes ocorrem
de forma sbita. fato comum que num mesmo surto ocorram os diversos
quadros clnicos que compem a sndrome.
Apesar da importncia econmica, diversos fatores tm dificultado o
estudo cientfico destas doenas, principalmente a inespecificidade dos sinais
clnicos em anfbios, bem como as condies particulares de manejo e
alimentao

artificial

que,

muito

provavelmente,

constituem

causas

predisponentes para transformao de um eventual agente comensal num


patgeno. Assim, numerosas pesquisas tm sido desenvolvidas mas sem
concluses claras quanto aos agentes etiolgicos e, conseqentemente, sem
recomendaes de medidas de controle e/ou preveno (HIPLITO, 2002).
Por outro lado, existem informaes abundantes sobre doenas que
afetam anfbios em populaes selvagens, assim como aqueles utilizados para
estudos em laboratrios. Estas informaes podem ser utilizadas para melhor
compreenso das doenas nas rs de criao. Neste sentido, tm sido
identificadas doenas emergentes produzidas por fungos e vrus, sendo que, em
rs de criao, esses agentes tm recebido pouca ateno. O fungo da espcie
Batrachochytrium dendrobatidis foi detectado em rs touro de criao no Uruguai
(MAZZONI et al., 2003) e os vrus do gnero Ranavirus foram detectados em
girinos de criao do citado pas e tambm do Brasil (MAZZONI, 2003; GALLI et
al., 2006). Estes diagnsticos, bem como a importncia adquirida pelos vrus do
gnero Ranavirus como causadores de doenas em anfbios, peixes e rpteis,
so justificativas mais que suficientes para o aprofundamento do conhecimento
sobre o papel desses microrganismos nas rs de criao.

Diante do exposto e da relevncia do tema, objetivou-se com o


presente estudo determinar o papel dos vrus da Famlia Iridoviridae gnero
Ranavirus nas doenas de importncia econmica nos ranrios comerciais, assim
como estabelecer um diagnstico diferencial visando relacionar sua eventual
presena com os quadros clnicos observados. Para tanto, foram realizados
estudos envolvendo os agentes etiolgicos, a epizootiologa da doena, a
sintomatologia clnica, a anatomia patolgica macroscpica, a histopatologia, a
bacteriologia convencional, e a virologia atravs de tcnicas moleculares, cultura
de clulas e microscopia eletrnica de transmisso.

2 REVISO DA LITERATURA
Surtos de doenas com alta mortalidade, caracterizados clinicamente
por edemas e ascite, com ou sem sintomatologia nervosa, tm sido observados
reiteradamente em girinos e rs de criao.
No que pese essas doenas terem sido objeto de diversos estudos nas
ltimas dcadas, estes foram direcionados principalmente identificao dos
agentes envolvidos em surtos ou episdios de mortalidade maior que a esperada,
seja na fase de girino ou na adulta (AMBROSKY et al., 1983; HIPLITO et al.,
1987, 1988a, b; BARROS et al., 1988; CARNEVIA & MAZZONI, 1988;
GUIMARAES et al., 1988; MOREIRA et al., 1988; SOUZA, 1988; PINHEIRO,
1989; MAGALHAES, 1991a, b, c, 1992; MAGALHAES et al., 1992; SILVA et al.,
1993, 1997; HIPLITO, 1995; MARTINS et al., 1995; FIORIO et al., 1997;
HIPLITO, 1997; LIMA & VALLES, 1997; LIMA et al., 1997; MORAES et al.,
1997; FERREIRA et al., 1998; HIPLITO, 1999; HIPLITO et al., 2000a; MAUEL
et al., 2002; PASTERIS et al. 2006). Somente em uma oportunidade foi realizada
pesquisa de vrus pela microscopia eletrnica (HIPOLITO et al., 2000). Em todos
os outros trabalhos, os diagnsticos concentraram-se exclusivamente no achado
de agentes parasitrios ou bacterianos, no sendo realizado um estudo dos
surtos no intuito de estabelecer o papel etiolgico dos agentes detectados e
outros aspectos das doenas que permitam a elaborao de medidas de
preveno e/ou controle. Em reviso, HIPLITO (2002) constatou que a maioria
dos trabalhos tratava de comunicados efmeros, no tendo continuidade no
estudo do caso.
As septicemias tm sido reportadas como a causa mais importante de
mortalidade em anfbios, sendo freqente o achado de animais mortos sem
sintomas premonitrios (CRAWSHAW, 1994). Porm existe ainda grande
incerteza em relao s caractersticas destas patologias. Nos estudos e
publicaes realizados desde o final do sculo XIX at o ano 1995, a maioria dos
trabalhos de diagnstico identificou bactrias como responsveis pelos surtos.
Estes estudos incluram a denominao de uma patologia chamada de perna
vermelha ou red leg. A patologia considerada como um complexo
microbiolgico ou sndrome, e foi apontada como a doena de maior importncia

em anfbios, sendo o agente predominante a Aeromonas hydrophila (RUSSEL,


1898; EMERSON & NORRIS, 1905; KULP & BORDEN, 1942; MILES, 1950;
REICHENBACH-KLINKE & ELKAN, 1965; GIBBS et al., 1966; GLORIOSO et al.,
1974; VAN DER WAAIJ et al., 1974; COSGROVE, 1980; HIRD et al., 1981;
NYMAN S., 1986. VIZOTTO, 1988). Pesquisas enfocando a importncia da
sndrome da perna vermelha ainda continuam na literatura mais recente
(SOMSIRI, 1994; MAUEL et al., 2002; HADFIELD et al., 2005; PASTERIS et al.,
2006). Porm, esta enfermidade tm sido questionada como doena especfica,
sendo considerada apenas como manifestao clnica de septicemia e morte
devida a agentes da microbiota normal que invadem o organismo debilitado por
outras causas (CUNNINGHAM et al., 1996; MAZZONI, 2000a; GREEN et al.,
2002).
Diversos estudos realizados em rs de criao tm relatado a presena
de estreptococos. GLORIOSO et al. (1974) descreveram os achados em R.
catesbeiana septicmicas dos Estados Unidos, assinalando a presena de
estreptococos que, naquele momento, no foram considerados patognicos.
AMBROSKY et al. (1983) identificaram uma doena altamente letal, produzida por
Streptococcus spp. no hemoltico afetando rs de cativeiro em Belm-PA, Brasil.
Os sinais clnicos e a epizootiologa da doena descrita so totalmente
coincidentes com os das estreptococoses que ainda hoje continuam sendo
diagnosticadas. Este trabalho comprova que a doena encontra-se presente nas
rs de criao h mais de 20 anos.
GUIMRAES et al. (1988) descreveram infeces produzidas em R.
catesbeiana dos Estados de Gois e Par, incluindo a identificao de diversos
estreptococos. HIPLITO et al. (1988b, 1997) indicaram a presena de
Streptococcus spp no sistema nervoso central da mesma espcie e descreveram
leses neurolgicas. HIPLITO (1995, 1997, 1999) tambm incluiu os
estreptococos entre os agentes produtores de mortalidade em rs de cativeiro. As
referncias confirmam a importncia dessas bactrias no processo mrbido, mas
at o momento no foi proposto nenhum mecanismo de controle apropriado.
CUNNINGHAM et al. (1996) incriminaram Streptococcus sp. e
estreptococos do grupo D em incidentes de mortalidade em Rana temporaria na
Europa. FIORIO et al. (1997) descreveram bactrias do gnero Streptococcus em

episdios de mortalidade de r touro associada a solues de continuidade na


pele. MAUEL et al (2002) realizaram a primeira citao de Streptococcus iniae em
R. catesbeiana de criao nos Estados Unidos. O microrganismo foi isolado em
surtos de doenas septicmicas conjuntamente com outras espcies bacterianas,
a partir de diversos rgos estudados. Os sinais e as leses descritos so
semelhantes aos encontrados nos ranrios da Amrica do Sul. MAZZONI (2000a,
2000b) indicou a presena de Streptococcus spp em R. catesbeiana em ranrios
comercias de Uruguai exibindo sinais nervosos e edemas.
A estreptococose tem sido identificada tambm em peixes, como uma
sndrome produzida por cocos Gram-positivos de diversas espcies. Estas
bactrias tm sido implicadas como produtoras de doenas em organismos
aquticos em vrias partes do mundo. BERCOVIER et al. (1997) e ELDAR et al.
(1997) descreveram a infeco estreptoccica como uma entidade produzida por
bactrias dos gneros Streptococcus, Lactococcus, Enterococcus e Vagococcus.
Estabeleceram que a estreptococose nos peixes deve ser considerada como um
complexo de doenas semelhantes produzidas por diferentes gneros e espcies
de cocos Gram-positivos, originando uma sndrome particular.
Streptococcus iniae tem sido incriminado reiteradamente como
produtor primrio de doenas em diversas espcies de peixes. A bactria tem
sido reportada como produtora de infeces em humanos, sendo considerada
uma doena emergente (CDC, 1996; WEINSTEIN et al.. 1997; GREENLEES et al.
1998; DURBOROW, 1999; LEHANE et al., 2000; FULLER et al., 2001; LAU et al.,
2003)
Apesar da freqente presena de bactrias, seja Gram-negativas como
as Aeromonas ou Gram-positivas como os estreptococos, existem dvidas em
relao ao papel primrio das mesmas no processo mrbido, pois em geral, tratase de habitantes normais do ambiente. Foi assim que a partir de pesquisas
realizadas na Inglaterra (CUNNINGHAM et al., 1996) e na Austrlia (BERGER et
al., 1998) que a responsabilidade das bactrias em surtos de mortalidade em
anfbios acabou adquirindo um papel secundrio.
Vrus pertencentes famlia Iridoviridae, gnero Ranavirus e um fungo
chytridiomyceto (Batrachochytrium dendrobatidis) tm sido identificados como os
verdadeiros agentes etiolgicos nas enfermidades das rs, mas at o final do

sculo passado no eram realizadas pesquisas nos ranrios com o intuito de


identificar esses agentes.
Os iridovrus que infectam animais aquticos possuem distribuio
mundial sendo associados a doenas severas em anfbios (CUNNINGHAM et al.,
1996; AHNE et al.,1997; ZUPANOVIC et al., 1998; DASZAK et al., 1999;
CHINCHAR & MAO, 2000; DASZAK et al., , 2000; HYATT et al., 2000; SPEARE,
2001; ZHANG et al., 2001; CHINCHAR, 2002; CULLEN & OWENS, 2002; HE et
al., 2002; KIM et al., 2002; MARSH et al., 2002; WENG et al., 2002; DASZAK et
al., 2003; GANTRESS et al., 2003; JANCOVICH et al., 2003; GREER et al. 2005.
ROBERT et al., 2005; ZHANG et al., 2006). Os girinos apresentam a maior
suscetibilidade e podem sofrer mortalidade de at 100% da populao. Estes
vrus podem infectar outras espcies diferentes dentro da mesma classe
taxonmica, bem como animais de classes diferentes (MAO et al., 1999).
As primeiras suspeitas do envolvimento de vrus pertencentes
Famlia Iridoviridae, gnero Ranavirus foram levantadas a partir de observaes
em ranrios do Uruguai (MAZZONI, 2000a, b; MAZZONI & CARNEVIA, 2000) e
confirmadas em trabalhos que empregaram a tcnica de deteco por reao em
cadeia da polimerase (MAZZONI, 2003; GALLI et al., 2006). HIPLITO et al.
(2000) empregaram a microscopia eletrnica de transmisso em amostras de rs
adultas criadas comercialmente no Brasil e detectaram partculas virais
semelhantes aos grupos Herpesvrus, Togavrus e Paramixovrus, sem que
fossem vinculadas doena algumas. Nesse estudo no foram detectados
agentes da Famlia Iridoviridae.
No entanto, existem dvidas em relao ao poder patognico destes
agentes. Na r touro, os mesmos foram detectados tanto em anfbios sadios
como doentes (WOLF et al., 1968). Em outras espcies, tambm os vrus foram
encontrados em anfbios sadios (ZUPANOVIC et al., 1998; ZHANG et al., 2001;
GANTRESS et al., 2003, GREER et al. 2006).
Fato semelhante est ocorrendo com uma doena emergente
produzida pelo fungo Batrachochytrium dendrobatidis que tem sido implicada com
muita freqncia como responsvel por surtos de mortalidade e diminuio de
populaes ao redor do mundo (BERGER et al., 1998,1999; DASZAK et al., 1999;
LONGCORE et al., 1999; SPEARE & BERGER, 2000; MAZZONI, 2000a, 2000b;

BERGER et al., 2002; GUAYASAMIN et al., 2002; MAZZONI et al., 2003;


SPEARE, 2003; HANSELMANN et al., 2004; BLAUSTEIN & DOBSON, 2006). O
fungo tem sido identificado em paises da Amrica do Sul como Equador
(BERGER et al., 1999; RON & MERINO, 2000), Venezuela (GUAYASAMIN et al.,
2002; BONACCORSO et al., 2003; HANSELMAN et al., 2004), Uruguai
(MAZZONI, 2000a, b; MAZZONI et al., 2003), Argentina (HERRERA et al., 2005)
e Brasil (CARNAVAL et al., 2006). Apenas no Uruguai, o diagnstico foi realizado
em rs de criao da mesma espcie cultivada no Brasil. Esse fato reveste-se de
grande interesse pois existe a possibilidade do aparecimento da doena nas rs
brasileiras.
Outros fungos pertencentes ao clado Mesomycetozoa tm sido
tambm implicados como causadores de doenas de anfbios na natureza
(GREEN et al., 2002).

3 OBJETIVOS
3.1 Objetivo geral
Objetivou-se com o presente trabalho determinar o papel dos vrus da
Famlia Iridoviridae, gnero Ranavirus, nas doenas de importncia econmica
em ranrios comerciais do Estado de Gois, bem como caracterizar as formas
clnicas das mesmas.

3.2. Objetivos especficos


3.2.1 Identificar e caracterizar o ranavrus detectado em girinos.
3.2.2 Estabelecer diagnstico diferencial entre o ranavirus e outros agentes
relacionados s doenas de importncia econmica em ranrios comerciais.
3.2.3 Estabelecer a epizootiologia, sintomatologia e alteraes anatomo
histopatolgicas das doenas infecciosas que acometem girinos e rs de criao
(Rana catesbeiana Shaw 1802).
3.2.4 Caracterizar as formas clnicas das doenas infecciosas que acometem
girinos e rs de criao (Rana catesbeiana Shaw 1802).

10

REFERNCIAS

1. AHNE, W.; BEARZOTTI, M.; BREMONT, M.; ESSBAUER, S. Comparison of


European systemic piscine and amphibian iridoviruses with epizootic
haematopoietic necrosis virus and frog virus 3. Zentralbl Veterinarmed [B];v. 45,
n. 6, p. 373-383, 1998.
2. AMBORSKI, R. L.; SNIDER, T. G.; THUNE, R. L.; CULLEY, D. D. A nonhemolytic, group B Streptococcus infection of cultured bullfrogs, Rana catesbiana,
in Brazil. Journal of Wildlife Diseases. Ames-IO, v.19, n. 3, p. 180-184, 1983.
3. AUSTIN, B. The future of bacterial fish vaccines. Vaccine. London, v.2, n. 4, p.
249-254, 1984.
4. BARROS, G.C.; LANGENEGGER, C.H.; PEIXOTO, P.V. Surto de
micobacteriose em criao de rs (Rana catesbeiana) causado por
Mycobacterium marinum. Pesquisa Veterinria Brasileira, Rio de Janeiro, v.8, n.
3-4, p. 75-80, 1988.
5. BERCOVIER, H.; GHITTINO, C.; ELDAR, A Immunization with bacterial
antigens: infections with streptococci and related organisms. Developments in
Biological Standardization. Basel-NY, v. 90, p. 153-160, 1997.
6. BERGER, L.; SPEARE, R.; DASZAK, P.; GREEN, D.E,; CUNNINGHAM, A.;
GOGGIN, C.; SLOCOMBE, R.; RAGAN, M.; HYATT, A.; MCDONALD, K.; HINES,
H.; LIPS, K.; MARANTELLI, G.; PARKES, H. Chytridiomycosis causes amphibian
mortality associated with population declines in the rain forests of Australia and
Central America. Proceedings of the National Academy of Science,
Washington- DC, v. 95, n. 15, p. 9031-9036, 1998.
7. BLAUSTEIN, A.; DOBSON, A. Extinctions: A message from the frogs. Nature.
London, v. 439, n. 7973, p. 143-144, 2006.
8. BONACCORSO, E., J. M. GUAYASAMIN, D. MENDEZ, AND R. SPEARE.
Chytridiomycosis in a Venezuelan anuran (Bufonidae: Atelopus cruciger).
Herpetological Review. Ohio, v 34, n. 4, p.331334, 2003.
9. CARNAVAL, A.; PUSCHENDORF, R.; PEIXOTO, O.; VERDADE, V.;
RODRIGUES, M. Amphibian chytrid fungus broadly distributed in the Brazilian
Atlantic Rain Forest. Ecohealth, v. 3, n. 1, p. 41-48, 2006.
10. CARNEVIA, D.; MAZZONI, R. Estudio de un brote de Sindrome de Edema
Generalizado (SEG) en Rana catesbeiana. In: VI ENCONTRO NACIONAL DE
RANICULTURA, 1988, Rio de Janeiro. Anais VI Encontro Nacional de
Ranicultura. ARERJ, 1988, p; 329-333.

11

11. CDC. Invasive infection with Streptococcus iniae Ontario, 1995-1996.


Morbitity and Mortality Weekly Report. Atlanta-GA, v. 45, n. 30, p. 650-653,
1996.
12. CHINCHAR, V. Ranaviruses (family Iridoviridae): emerging cold-blooded
killers. Archives of Virology, New York-NY, v. 147, n. 3, p. 447-470, 2002.
13. CHINCHAR, V.; MAO, J. Molecular diagnosis of iridovirus infections in coldblooded animals. Seminars in avian and exotic pet medicine. v. 9, n.1, p. 2735, 2000.
14. COSGROVE, G. Amphibian carea and diseases. In: Current Veterinary
Therapy VII, Kirk, R. W. Ed. W. Saunders and Co. Phyladelphia, p. 616-618, 1980.
15. CRAWSHAW, G. Medicina de anfibios. In: Teraputica veterinaria de
pequeos animles. KIRK, R. W. & BONAGURA, J.D. Eds. Interamericana-Mc
Graw Hill. Mxico, 1994, p. 1355-1369.
16. CULLEN, B.; OWENS, L. Experimental challenge and clinical cases of Bohle
iridovirus (BIV) in native Australian anurans. Diseases of Aquatic Organisms,
Amelinghausen, v. 49, n. 2, p.83-92, 2002.
17. CUNNINGHAM, A.; LANGTON, T.; BENNETT, P.; LEWIN, J.; DRURY, S.;
GOUGH, R.; MACGREGOR, S. Pathological and microbiological findings from
incidents of unusual mortality of the common frog (Rana temporaria).
Philosophical Transactions of the Royal Society of London. Series B,
Biological Sciences, London, v. 351, n. 1347, p. 1539-1557, 1996.
18. DASZAK, P.; BERGER, L.; CUNNINGHAM, A.; HYATT, A.; GREEN, D.;
SPEARE, R. Emerging infectious diseases and amphibian population declines.
Emerging Infectious Diseases, Atlanta, v. 5, n. 6, p. 735-748, 1999
19. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Emerging Infectious Diseases of
Wildlife - Threats to biodiversity and human health. Science. Washington-DC v.
287, n. 5452, p. 443-449, 2000
20. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Infectious Diseases and
amphibian population declines. Diversity and Distributions. Oxford, v. 9, n. 2, p.
141-150, 2003.
21. DURBOROW, R. M. Health and safety concerns in fisheries and aquaculture.
Occupational medicine. Philadelphia-PA, v. 14, n. 2, p. 373-406, 1999.
22. ELDAR, A.; HOROVITCZ, A.; BERCOVIER, H. Development and efficacy of a
vaccine against Streptococcus iniae infection in farmed rainbow trout. Veterinay
Immunology and Immunopathology. Amsterdam, v. 56, n. 1-2, p. 175-183,
1997.

12

23. EMERSON, H.; NORRIS, C. Red-Leg, an infectious disease of frogs.


Journal of Experimental Medicine, New York, v. 7, N. 1, p. 32-58, 1905.
24. FERREIRA, C.M. & ARAJO, M.V.F. Isolamento de Penicillium sp. e Candida
sp. em girinos de r-touro. In: ENCONTRO BRASILEIRO DE PATOLOGISTAS
DE ORGANISMOS AQUTICOS, 5. & ENCONTRO LATINOAMERICANO DE
PATOLOGISTAS DE ORGANISMOS AQUTICOS, 1., 1998, Maring. Resumos.
Maring: ABRAPOA, 1998. p. 136.
25. FIORIO, W.A.B.; MAIORINO,F.C.; HOGE,A.Y.A. & RAMOS,M.C.C.
Mortalidade em rs touro gigante (Rana catesbeiana Shaw, 1802) associada a
solues de continuidade na pele: Estudo antomo-patolgico e microbiolgico.
In: 2nd. Technofrog- International Meeting on Frog Research and Technology & IX
ENAR, 1997, Santos. Anais 2nd. Technofrog- International Meeting on Frog
Research and Technology & IX ENAR. Santos, SP, ABETRA/ABCR, p. 214,
1997. [resumos].
26. FULLER, J. D.; BAST, D. J.; NIZET, V.; LOW, D. E. ; DE AZAVEDO, J. C.
Streptococcus iniae virulence is associated with a distinct genetic profile. Infection
and immunity. Bethesda-MD, v. 69, n. 4, p. 1994-2000, 2001.
27. GALLI, L.; PEREIRA. A. ; MARQUEZ, A.; MAZZONI, R. Ranavirus detection
by PCR in cultured tadpoles (Rana catesbeiana Shaw 1802) from South America.
Aquaculture, Amsterdam, v., 257, n. 1-4, p. 78-82, 2006.
28.
GANTRESS, J.; MANIERO, G.; COHEN, N.; ROBERT, J. Development
and characterization of a model system to study amphibian immune responses to
iridoviruses. Virology, New York-NY, v. 311, n. 2, p. 254-262, 2003.
29.
GIBBS, E.; GIBBS, T.; VAN DICK, P. Rana pipiens: Health and disease.
Laboratory Animal Care, Baltimore, v. 16, n. 2, p. 142-157. 1966.
30. GLORIOSO, J. C.; AMBORSKI, R. L.; AMBORSKI, G. F.; CULLEY, D. D.
Microbiological studies on septicaemic bullfrogs (Rana catesbiana). American
Journal of Veterinary Research. Chicago-IL, v. 35, n. 9, p. 1241-1245, 1974.
31. GREEN. D.; CONVERSE, K.; SCHRADER, A. Epizootiology of sixty-four
amphibian morbidity and mortality events in the USA, 1996-2001. Annals of the
New York Accademy of Science, New York, v. 969, p. 323-339, 2002.
32.
GREENLEES, K. J.; MACHADO, J.; BELL, T.; SUNDLOF, S. F. Food
borne microbial pathogens of cultured aquatic species. The Veterinary clinics of
North America. Food animal practice. Philadelphia-PA, v. 14, n. 1, p. 101-112,
1998.
33.
GREER, A.; BERRILL, M.; WILSON, P. Five amphibian mortality events
associated with ranavirus infection in south central Ontario, Canada. Diseases of
Aquatic Organisms, Amelinghausen, v. 67, p. 9-14, 2005.

13

34.
GUAYASAMIN, J.M.; BONACCORSO, E.; SPEARE, R.; MENDEZ, D. The
roles of climatic variation and pathogenic fungus in declining populations of
Aletopus cruciger (Anura: Bufonidae) in Venezuela. In:. Abstracts of the Joint
Meeting of the American Society of Ichthyologists and Herpetologists, 2002
[on line] Herpetologists' League, and Society for the Study of Amphibians and
Reptiles,
Kansas
City,
USA.
Disponvel
em:
http://www.asih.org/meetings/2002/Abstracts.pdf. Acesso em: 21 jan. 2003.
35.
GUIMARAES,N.; SILVEIRA,W.; RODRIGUES, M. Isolamentos de
bactrias patgenas nos ranrios de Gois e Par. In: VI ENCONTRO NACIONAL
DE RANICULTURA, 1988, Rio de Janeiro. Anais VI Encontro Nacional de
Ranicultura. Rio de Janeiro: ARERJ, 1988, p. 287-291.
36.
HADFIELD, C.; WHITAKER, B. Amphibian Emergency Medicine and Care.
Seminars in Avian and Exotic Pet Medicine, v. 14, n. 2 , p. 79-89, 2005.
37. HANSELMANN, R.; RODRIGUEZ, A.; LAMPO, M,; FAJARDO-RAMOS
L.;ALONSO AGUIRRE, A.;. MARM KILPATRICK, A.; RODRIGUEZ J.P., DASZAK,
P. Presence of an emerging pathogen of amphibians in introduced bullfrogs Rana
catesbiana in Venezuela. Biological Conservation, Barking-Essex, v. 120, n. 1,
p. 115-119, 2004.
38. HE, J.; LU, L.; DENG, M.; HE, H.; WENG, S.; WANG, X.; ZHOU, S.; LONG,
Q.; WANG, X.; CHAN, S. Sequence analysis of the genoma completo of an
iridovirus isolated from the tiger frog. Virology, New York-NY, v. 292, n. 2, p.185197, 2002.
39. HERRERA, R.; STECIOW, M.; NATALE, G. Chytrid fungus parasitizing the
wild amphibian Leptodactylus ocellatus (Anura: Leptodactylidae) in Argentina.
Diseases of Aquatic Organisms, Amelinghausen, v. 64, n. 3, p. 247252, 2005.
40. HIPLITO, M. Causas de mortalidade na Ranicultura. In: 1st. Technofrog- I
International Meeting on Frog Research and Technology & VIII ENAR, 1995,
Viosa. Anais 1st. Technofrog - I International Meeting on Frog Research and
Technology & VIII ENAR. Viosa, MG. ABETRA/ABCR, v. 2, p. 199-207, 1995.
41. HIPLITO, M. Causas de mortalidade e Sanidade. In: 2nd. TechnofrogInternational Meeting on Frog Research and Technology & IX ENAR, 1997,
Santos. 2nd. Technofrog- International Meeting on Frog Research and
Technology & IX ENAR. Santos, SP. ABETRA/ABCR, p. 5-9, 1997.
42. HIPLITO, M. Doenas na Ranicultura. In: X ENCONTRO NACIONAL DE
RANICULTURA 1999, So Miguel do Iguau. Anais X ENAR. So Miguel de
Iguau, PR, ABETRA/ABCR, p. 3-15, 1999.
43. HIPLITO, M. Patologias em r touro (Rana catesbeiana Shaw 1802).
Primeira reviso da bibliografia brasileira. Arquivos do Instituto Biolgico de
So Paulo. So Paulo, v. 69, n. 2, p. 113-120, 2002.

14

44. HIPLITO, M.; BALDASSI, L.; MOULIN, A.; CALIL, M.; BARBOSA, M;
CUNHA, R. Presena de agentes patognicos bacterianos em rs-touro gigante
(Rana catesbeiana). In: Encontro de Pesquisa Veterinria, 1987, Jaboticabal,SP.
Encontro de Pesquisa Veterinria, Jaboticabal, SP, p. 12. 1987.
45. HIPLITO, M. ; MOULIN, A.; CALIL, M. L.; PIRES, C. C.; SOUZA, C.;
SOUZA, J. Estudo da microbiota de anfbios capturados em ranrio comercial. In:
VI ENCONTRO NACIONAL DE RANICULTURA, 1988, Rio de Janeiro. Anais VI
Encontro Nacional de Ranicultura. Rio de Janeiro: ARERJ, 1988, , p. 149-154.
46. HIPLITO, M. ; SOUZA, C.; SOUZA, J. R. Presena de Streptococcus sp. ao
nvel de sistema nervoso central em Rana catesbeiana com sintomatologia
nervosa. In: VI Simposio Latinoamericano de Acuicultura & V SIMBRAQ, 1988,
Florianpolis. VI Simposio Latinoamericano de Acuicultura & V SIMBRAQ,
Florianpolis, Brasil, p. 46, 1988. [resumos].
47. HIPLITO, M. ; MOULIN, A.; MARACRUZ, R. Afeces neurolgicas em ra
touro (Rana catesbeiana Shaw 1802). In: X Reunio Anual do Instituto
biolgico. So Paulo, v. 64, p. 49, 1997.
48. HIPOLITO, M.; FERREIRA, C.M.; MACRUZ, R.; MARTINS, A.C.R.P.F.;BACH,
E.E. Petquias hemorrgicas em musculatura de r-touro (Rana catesbeiana
Shaw, 1802). In: ENCONTRO BRASILEIRO DE PATOLOGISTAS DE
ORGANISMOS AQUTICOS, 6. & ENCONTRO LATINOAMERICANO DE
PATOLOGISTAS DE ORGANISMOS AQUTICOS, 2., 2000, Florianpolis.
Resumos. Florianpolis:
ABRAPOA, 2000, p. 224.
49. HIPLITO, M.; CATROXO, M.; CURI, N.; BACH, E. Deteco ao microscpio
eletrnico de transmisso de partculas virais semelhantes aos grupos Herpes,
Toga e Paramixovrus em r-touro (Rana catesbeiana Shaw, 1802) criadas
comercialmente. Primeiras observaes no Brasil. Arquivos do Instituto
Biolgico de So Paulo. So Paulo, v. 70, n. 1, p. 107-111, 2003.
50. HIRD, D.; DIESCH, S.; MCKINNEL, R.; GORHAM, E.; MARTIN, F.; KURTZ,
S.; DUBROVOLNY, C. Aeromonas hydrophila in wild-caught frogs and tadpoles
Rana pipiens in Minnesota. Laboratory Animal Science, Memphis-TN, v. 31, n.
2, p. 166-169, 1981.
51. HYATT, A.; GOULD, A.; ZUPANOVIC, Z.; CUNNINGHAM, A.;
HENGSTBERGER, S.; WHITTINGTON, R.; KATTENBELT, J.; COUPAR, B.
Comparative studies of piscine and amphibian iridoviruses. Archives of Virology,
New York-NY, v. 145, n. 2, p.301-331, 2000.
52. JANCOVICH, J.; MAO, J.; CHINCAR, V.; WYATT, C.; CASE, S.; KUMAR, S.;
VALENTE, G.; SUBRAMANIAN, S.; DAVIDSON, E.; COLLINS, J.; JACOBS, B.
Genomic sequence of a ranavirus (family Iridoviridae) associated with salamander

15

mortalities in North America. Virology, New York-NY, n. 316, n. 1, p. 90-103,


2003.
53. KIM, Y.; JUNG, S.; CHOI, T.; KIM, H.; RAJENDRAN, K.; OH, M. PCR
amplification and sequence analysis of irido-like virus infecting fish in Korea.
Journal of Fish Diseases, Oxford, v. 25, n. 2, p. 121-124, 2002.
54. LAU, S. K.; WOO, P. C.; TSE, H.; LEUNG, K. W.; WONG, S. S.; YUEN, K. Y.
Invasive Streptococcus iniae infections outside North America. Journal of Clinical
Microbiology. Washington-DC, v. 41, n. 3, p. 1004-1009, 2003.
55. LEHANE, L.; RAWLIN, G. T. Topically acquired bacterial zoonoses from fish: a
review. The Medical journal of Australia. Sydney, v. 173, n. 5, p. 256-259, 2000.
56. LIMA, S.L. & VALLES, G.A. Ocorrncia de mortandade de girinos de r-touro,
Rana catesbeiana Shaw, 1802. In: ENCONTRO NACIONAL DE RANICULTURA,
9. & INTERNATIONAL MEETING ON FROG RESEARCH AND TECHNOLOGY,
2., 1997, Santos. Anais. Santos: ABETRA/ABCR, 1997. p. 216.
57. LIMA, S.L.; VALLES, G.A.; BRAGA, L.G.T.; LANZA, A.A.L.; BENATTI, M.S.
Ocorrncia de mortandade de r-touro, Rana catesbeiana Shaw, 1802. In:
ENCONTRO NACIONAL DE RANICULTURA, 9. & INTERNATIONAL MEETING
ON FROG RESEARCH AND TECHNOLOGY, 2., 1997, Santos. Anais. Santos:
ABETRA/ABCR, 1997. p. 217.
58. LONGCORE, J.; PESSIER, A.; NICHOLS, D. Batrachochytrium dendrobatidis
gen. et sp. nov., a chytrid pathogenic to amphibians. Mycologia, New York-NY. v.
91, n. 2, p. 219-227, 1999.
59. MAGALHES, H. Anlise bacteriolgica da r-touro (Rana catesbeiana Shaw,
1802) no Estado do Rio de Janeiro. Revista de Microbiologia, Rio de Janeiro, v.
22, n. 3, p. 204, 1991. (Suplemento, 1).
60. MAGALHES, H. Micobacteriose em r-touro (Rana catesbeiana Shaw, 1802.
Revista de Microbiologia, Rio de Janeiro, v. 22, n. 3, p. 204, 1991.(Suplemento,
1).
61. MAGALHES, H. Epizootia por M. chelonae entre rs-touro (Rana
catesbeiana Shaw, 1802). In: SIMPSIO BRASILEIRO EM MICOBACTRIAS, 4.,
1991, Bauru. Resumos. Bauru: Universidade do Sagrado Corao, 1991.
62. MAGALHES, H. Exames bacteriolgicos de rs doentes do Estado do Rio
de Janeiro. In : ENCONTRO NACIONAL DE RANICULTURA, 7., 1992, Rio de
Janeiro. Anais. Rio de Janeiro: ARERJ, 1992. p. 14-22.
63. MAGALHES, H.; CARNEIRO, G.M.; PIRES, A.R.; MADEIROS, M.I.M.;
GONALVES, W.M.; SANTIAGO, S.S.F.; SILVA, L.S.; MELLO, S.C.R.P.
Micobacterioses em rs-touro (Rana catesbeiana Shaw, 1802). In: ENCONTRO

16

NACIONAL DE RANICULTURA, 7, 1992, Rio de Janeiro. Anais. Rio de Janeiro:


ARERJ, 1992. p.278.
64. MAO, J.; GREEN, D.; FELLERS, G.; CHINCHAR, V. Molecular
characterization of iridoviruses isolated from sympatric amphibians and fish. Virus
Research, Amsterdam, v. 63, n. 1-2, p.45-52, 1999.
65. MARSH, I.; WHITTINGTON, B.; OROURKE, B.; HYATT, A.; CHISHOLM, O.
Rapid differentiation of australian, european, and american ranaviruses based on
variation in major capsid protein gene sequence. Molecular and Cellular Probes.
New York-NY, v. 16, n. 2, p. 137-151, 2002.
66. MARTINS, M.L. & SOUZA JNIOR, F.L. Controle de crustceos parasitos de
girinos de Rana catesbeiana Shaw, 1802. In: ENCONTRO NACIONAL DE
RANICULTURA, 8 & INTERNATIONAL MEETING ON FROG RESEARCH AND
TECHNOLOGY, 1., 1995, Viosa. Anais. Viosa: ABETRA, 1995 . v.1, p.11.
67. MAUEL, M.; MILLER, K; FRAZIER, K; HINES, M. Bacterial pathogens isolated
from cultured bullfrogs (Rana catesbeiana). Journal of Veterinary Diagnostic
and Investigations. Columbia-MO, v. 14, n. 5, p. 431-433, 2002.
68. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000a, Cairns, Austrlia. Conference and Workshop Compendium. Cairns,
Rainforest CRC, p. 37-38, 2000.
69. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000b,
Cairns,
Austrlia.
Power
Point
presentation.
http://www.jcu.edu.au/school/phtm/PHTM/frogs/mazzoni.ppt, 2000. Acesso em: 20
maio 2004.
70. MAZZONi, R. Doenas em ranicultura. Preveno e uso de vacinas. In: I
Simposio Braileiro de Ranicultura e II Ciclo de Palestras sobre Ranicultura do
Instituto de Pesca, Boletim Tcnico do Instituto de Pesca, n. 34, p. 41-47, 2003
71. MAZZONI, R.; CARNEVIA, D. Enfermedades de ranas en criadero: Una limitante
real para el desarrollo de la ranicultura. Resumos do Encontro Latino Americano
de Patologistas em Organismos Aquticos. Florianpolis, SC, v.2, p. 228, 2000,
[resumos].
72. MILES, E. Red-leg in tree frogs caused by Bacterium alcaligenes. Journal of
General Microbiology, Reading UK, v. 4, n. 3, p. 434-436, 1950.
73. MORAES, J.R.E.; MARTINS, M.L.; MORAES, E.R.; SOUZA JNIOR,F.L.;
SOUZA, V.N. Micobacteriose em Rana catesbeiana SHAW, 1802 oriundas de
ranrios comerciais. In: ENCONTRO NACIONAL DE RANICULTURA, 9. &
INTERNATIONAL MEETING ON FROG RESEARCH AND TECHNOLOGY, 2.,
1997, Santos. Anais. Santos: ABETRA/ABCR, 1997. p. 211.

17

74. MOREIRA, Y.K.; REIS, J.H.; ROCHA, O.A. Surto de cromomicose


generalizada em rs (Rana catesbeiana) causado pelo Cladosporium sp., MG,
Brasil. In: ENCONTRO NACIONAL DE RANICULTURA, 6, 1988, Rio de Janeiro
Anais. Rio de Janeiro: ARERJ, 1988. p. 271-279
75. NYMAN, S. Mass mortality in larval Rana sylvatica attributable to the
bacterium, Aeromonas hydrophila. Journal of Herpetology, Athens-OH, v. 20, n.
2, p. 196-201, 1986.
76. PASTERIS, S.; BUHLER, M.; NADER-MACIAS, M. Microbiological and
histological studies of farmed-bullfrog (Rana catesbeiana) tissues displaying redleg syndrome. Aquaculture. Amsterd, v. 251, n. 1, p. 11-18, 2006.
77. PINHEIRO, M.F.S. Staphylococcus aureus em 2 (duas) rs touro (Rana
catesbeiana) de um ranrio em Belm, Par. Acta Amazonica, Manaus, v. 19, p.
343-348, 1989.
78. REICHENBACH-KLINKE, H.; ELKAN, E. The principal diseases of lower
vertebrates, New York, Academic Press, 600 pp., 1965.
79. ROBERT, J.; MORALES, H.; BUCK, W.; COHEN, N.; MARR, S.; GANTRESS,
J. Adaptive immunity and histopathology in frog virus 3-infected Xenopus.
Virology, New York-NY, v. 332, n. 2, p. 667-675, 2005.
80. RON, S. R.; MERINO, A.. Amphibian declines in Ecuador: overview and first
report of chytridiomycosis from South America. Froglog 42:23. 2000. Disponvel
em: http://www.open.ac.uk/daptf/froglog/FROGLOG-42-3.html . Acesso em: 20
maio 2004.
81. RUSSEL, F. An epidemic septicemic disease among frogs due to the Bacillus
hydrophilus fuscus. Journal of the American Medial Association, Chicago, v.
30, p. 1442-1449, 1898.
82. SILVA, N.R.; SANTOS, A.L.Q.; LCIO, N.F. Descoordenao motora em
Rana catesbeiana Shaw (Amphibia, Anura). Revista do Centro de Cincias
Biomdicas da Universidade Federal Uberlndia, Uberlndia, v. 9, n. 1, p. 7172, 1993.
83. SILVA, N.R.; SANTOS, A.L.Q.; LCIO, N.F. Estudo da incoordenao motora
na r-touro (Rana catesbeiana Shaw, 1802), criada em confinamento. In:
ENCONTRO NACIONAL DE RANICULTURA, 9. & INTERNATIONAL MEETING
ON FROG RESEARCH AND TECHNOLOGY, 2., 1997, Santos. Anais. Santos:
ABETRA/ABCR, 1997. p.219.
84. SILVA, D. (dinis@ranajax.com.br) Exportao de rs. Informao geral.
Mensagem recebida por MAZZONI, R. (rolo@pes.fvet.edu.uy). Acesso em: 20
dec. 2005.

18

85. SOUZA JNIOR, F.L. Doenas parasitrias de anfbios. In: ENCONTRO


NACIONAL DE RANICUL-TURA, 6., 1988, Rio de Janeiro. Anais. Rio de Janeiro:
ARERJ, 1988. p. 334-340.
86. SOMSIRI, T. Diseases of cultured frogs in Thailand. AAHRI Newsletter,
Bangkok,
v.3,
n.
2,
1994.
Disponvel
em:
http://www.agriaqua.ait.ac.th/aahri/Article17.htm . Acesso em: 15 ago. 2004
87. SPEARE, R. Summary of formidable infectious diseases of amphibians.
In: AMPHIBIAN DISEASE HOME PAGE. Webmaster SPEARE, R. School of
Public Health and Tropical Medicine, James Cook University, 2003
Disponvel em: http://www.jcu.edu.au/school/phtm/PHTM/frogs/formidable.htm.
Acesso em: 11 jan.2003.
88. SPEARE, R.; BERGER L. Global distribution of chytridiomycosis in
amphibians.
Disponvel
em
:
http://www.jcu.edu.au/school/phtm/PHTM/frogs/chyglob.htm , 2000. Acesso em:
20 mai. 2005.
89. VAN DER WAAIJ, D.; COHEN, B.; NACE, G. Colonization patterns in the
cloaca of Rana pipiens. Laboratory Animal Science, Memphis, v. 24, n. 2, p.
307-317, 1974.
90. VIZOTTO, L. Rs: Doenas e profilaxia. In: VI Encontro Nacional de
Ranicultura, 1988, Rio de Janeiro. Anais VI Encontro Nacional de Ranicultura.
Rio de Janeiro: ARERJ, 1988, p. 310-328.
91. WEINSTEIN, M. R.; LITT, M.; KERTESZ, D. A.; WYPER, P.; ROSE, D.;
COULTER, M.; MCGEER, A.; FACKLAM, R.; OSTACH, C.; WILLEY, B. M.;
BORCZYK, A.; LOW, D. E. Invasive infections due to a fish pathogen,
Streptococcus iniae. S. iniae Study Group. The New England Journal of
Medicine. Boston-MS, v. 337, n. 9, p. 589-594, 1997.
92. WENG, S.; WANG, Y.; HE, J.; DENG, M.; LU, L.; GUAN, H.; LIU, Y.; CHAN, S.
Outbreaks of an iridovirus in red drum, Scianenops ocellata (L.), cultured in
southern China. Journal of Fish Diseases. Oxford, v. 25, n. 11, p. 681-685,
2002.
93. WOLF, K.; BULLOCK, G.; DUNBAR, C.; QUIMBY, M. Tadpole edema virus: a
viscerotropic pathogen for anuran amphibians. Journal of Infectious Diseases,
Chicago-IL , v. 118, n. 3, p.253-262,1968.
94. ZHANG, Q.; XIAO, F.; LI, Z.; GUI, J.; MAO, J.; CHINCHAR, V. Characterization
of an iridovirus from the cultured pig frog Rana grylio with lethal syndrome.
Diseases of Aquatic Organisms, Amelinghausen, v. 48, n. 1, p. 27-36, 2001.
95. ZHANG, Q.; ZHE, Z.; XIAO, F.; LI, Z.; GUI, J. Molecular characterization of
three Rana grylio virus (RGV) isolates and Paralichthys olivaceus lymphocystis

19

disease virus (LCDV-C) in iridoviruses. Aquaculture, Amsterdam, n. 251, n. 1, p.


1-10, 2006.
96. ZUPANOVIC, Z.; MUSSO, C.; LOPEZ, G.; LOURIERO, C.; HYATT, A.;
HENGSTBERGER, S.; ROBINSON, A. Isolation and characterization of
iridoviruses from the giant toad Bufo marinus in Venezuela. Diseases of Aquatic
Organisms, Amelinghausen, v. 33, n. 1, p. 1-9, 1998.

20

CAPITULO 2
CARACTERIZAO DE RANAVIRUS ISOLADOS DE GIRINOS DE R TOURO
(Rana catesbeiana Shaw, 1802) EM RANRIOS COMERCIAIS.
RESUMO
Vrus pertencentes famlia Iridoviridae, gnero Ranavirus, tm sido
diagnosticados como agentes etiolgicos de doenas de anfbios, peixes e rpteis
em diversas partes do mundo. Trabalhos recentes tm reportado a presena de
agentes do gnero Ranavirus em girinos de r touro do Brasil e Uruguai, por meio
do emprego da tcnica de PCR, revelando alta homologia nas regies
seqenciadas do genoma com a espcie prottipo da famlia Iridoviridae, Frog
Virus 3-FV3, alm de outros vrus geneticamente muito prximos. Objetivou-se
com o presente estudo caracterizar o vrus presente nas rs de criao visando
ampliar o conhecimento do agente, bem como estabelecer seu grau de homologia
com outros vrus do gnero. Aplicaram-se tcnicas de cultivo e isolamento em
clulas A6, microscopia eletrnica de transmisso, e reao em cadeia da
polimerase (PCR) visando amplificar e seqenciar o gene completo que codifica a
protena principal da cpside (MCP) dos iridovrus, bem como outras regies do
genoma. Foram obtidos resultados positivos para iniciadores direcionados a MCP
e para a RNA polimerase DNA dependente (Pol II), sendo o produto de PCR
correspondente a MCP de aproximadamente 1480 pares de bases, e o
correspondente Pol II de aproximadamente 377 pares de bases. O
seqenciamento revelou homologia com FV3, superior a 99% para MCP e 100%
para Pol II, indicando que, provavelmente, o vrus presente no Brasil pode ter sido
introduzido por as rs touro de criao importadas da Amrica do Norte. A
seqncia obtida para a MCP foi registrada no GenBank com o nmero
DQ897669.
Palavras chave: FV3, Iridoviridae, MCP, ranicultura, vrus.

21

ABSTRACT
Viruses from the family Iridoviridae, genus Ranavirus, have been identified as
etiological agents in amphibian, fish and reptile diseases all around the world.
Ranavirus with high sequence homology with Frog Virus 3, type species of the
Iridoviridae family, have been recently detected in farmed tadpoles from Brazil and
Uruguay by polymerase chain reaction-PCR technique. The goal of this study was
to amplify and sequence the complete major capsid protein gene (MCP) along with
other genomic regions to increase the knowledge about homology degree of
Brazilian virus related to other ranaviruses. Viral cell culture and isolation, as well
as transmission electron microscopy studies were also performed. Positive results
were obtained with primers directed to amplify MCP and RNA polymerase DNA
dependent-Pol II genes. Amplified PCR products for complete MCP were about
1480 bp and 377 bp for Pol II. Multiple alignments for obtained sequences
revealed homologies over 99% for MCP products and 100% for Pol II products
with FV3, suggesting the imported American bullfrogs probably introduced the
virus. Obtained sequence was deposited in GenBank with number DQ897669.
Key words: Frog farming, FV3, Iridoviridae, MCP, virus.

22

1 INTRODUO
Os ranavrus pertencem ao gnero Ranavirus da Famlia Iridoviridae,
que inclui ainda os gneros Lymphocystisvirus, Chloriridovirus, Iridovirus, e o
recentemente identificado Megalocytivirus. So vrus grandes, que medem de 120
a 300 nm de dimetro e apresentam simetria icosahdrica. O genoma composto
por uma nica molcula linear de DNA de fita dupla com tamanho varivel de 102
a 212 kbp, dependendo da espcie. O virin constitudo por trs estruturas
concntricas: uma cpside protica externa, uma membrana polipeptido-lipdica
intermediria e um ncleo central contendo um complexo DNA-protenas. Como
caracterstica nica entre os vrus que infectam animais, apresentam DNA
ciclicamente permutado e com terminaes redundantes, resultante da formao
de concatmeros no genoma durante a replicao. Todos os representantes da
famlia expressam a protena principal da cpside (MCP) de aproximadamente 50
kDa, cujas propriedades moleculares so utilizadas para caracterizao e
identificao de espcies (WEBBY et al., 1998; CHINCHAR et al, 2005;
WILLIAMS et al., 2005). A espcie prottipo da Famlia, frog virus-3 (FV3) foi
recentemente analisado e seu genoma completo seqenciado (TAN et al., 2004).
Os ranavrus so agentes infecciosos capazes de acometer trs
classes diferentes de animais pecilotrmicos vertebrados: peixes telesteos,
anfbios e rpteis (MAO et al., 1997; CAREY et al., 1999). Nos ltimos 20 anos, as
doenas produzidas por vrus desse gnero foram identificadas de forma
crescente em peixes, anfbios e rpteis ocasionando enfermidades de importncia
econmica em criaes comercias, e levando reduo das populaes de
anfbios na natureza. Nos ltimos anos, os ranavirus tm sido considerados como
patgenos emergentes (HEDRICK et al., 1992; HENGSTBERGER et al., 1993;
CUNNINGHAM et al., 1996; MAO et al., 1996; AHNE et al., 1998; ZUPANOVIC et
al., 1998; DASZAK et al., 1999; CHINCHAR & MAO, 2000; HYATT et al., 2000;
ZHANG et al., 2001; CULLEN & OWENS, 2002; HE et al., 2002; KIM et al., 2002;
MARSH et al., 2002; WENG et al., 2002; GANTRESS et al., 2003; JANCOVICH et
al., 2003; QIN et al., 2003; SPEARE, 2003; DO et al, 2005; WILLIAMS, 2005;
ZHANG et al., 2006) e recentemente as doenas produzidas por esse vrus foram

23

colocadas pela Organizao Internacional de Epizootias na lista das enfermidades


dos animais selvagens (OIE, 2002).
Em relao presena destes agentes em rs de criao, MAZZONI
(2000a, 2000b), levantou a suspeita da doena ocorrer em girinos com base nas
caractersticas epizootiolgicas e clnicas dos animais afetados. Posteriormente,
MAZZONI (2003) e GALLI et al. (2006) detectaram ranavrus em girinos do Brasil
e Uruguai atravs da reao em cadeia da polimerase (PCR). Os autores
observaram uma elevada homologia nas duas regies seqenciadas do genoma
com o FV3 e com outros vrus geneticamente muito prximos. Em decorrncia
desse achado surgiu a indagao: o agente detectado pertencia a uma nova
espcie ou foi introduzido com as rs importadas da Amrica do Norte? Esta
ltima hiptese encontra respaldo nas afirmaes de WOLF et al. (1968) segundo
as quais o FV3 endmico na r-touro americana (Rana catesbeiana Shaw,
1802) importadas da Amrica do Norte em 1970 (MATHIAS & SCOTT 2004).
A caracterizao de uma espcie de ranavrus depende de um
conjunto de resultados obtidos por meio de seqenciamento, restriction fragment
length polymorphism (RFLP), perfil de protenas, tipo de hospedeiro e
caractersticas estruturais (HYATT et al., 2000; WILLIAMS et al., 2005). Utilizando
os citados recursos, foram determinadas seis espcies dentro do gnero
Ranavirus FV3, enzootic hematopoyetic necrotic virus (EHNV), Bohle iridovirus
(BIV), Amblystoma tigrinum virus (ATV), European catfish virus (ECV) e SanteeCooper ranavirus (SCRV) (MAO et al., 1997; HYATT et al., 2000)..
Quando a determinao das espcies realizada atravs de tcnicas
que incluem a construo de dendrogramas filogenticos, os mtodos
recomendados so aqueles realizados a partir do seqenciamento total do
genoma viral (HERNIOU et al., 2001) ou pelo menos os que incluem um grupo
concatenado de genes (ROKAS et al., 2003).
MAO et al. (1997) demonstraram que os iridovrus isolados da mesma
regio geogrfica so idnticos ou similares, mas o mesmo no acontece com
aqueles provenientes de reas diferentes. Os autores obtiveram esses dados
aps seqenciamento da MCP, mas recomendando incluir outras regies do
genoma para melhor identificao das relaes entre os vrus desta famlia.

24

Em estudo comparativo de 30 iridovrus isolados de peixes e anfbios


originrios da Austrlia, Amrica do Norte, sia, Europa e Venezuela, HYATT et
al. (2000) concluram que existem diferenas filogenticas entre vrus de
diferentes regies geogrficas. Os autores estabeleceram que devido ao alto grau
de conservao do gene que codifica a MCP no decorrer do tempo e dentro da
mesma espcie, que pequenas diferenas na seqncia so significativas.
Porm, os autores tambm recomendaram a associao de diferentes tcnicas
para a identificao apropriada dos ranavrus.
MARSH et al. (2002) diferenciaram iridovrus da Austrlia, Europa e
Amrica do Norte pelo seqnciamento da MCP e relataram que o gene
encontrava-se conservado nos vrus da famlia, mas possua variaes que
permitiam diferenciar entre espcies prximas. Recomendaram ainda o
seqnciamento total da protena para a obteno de resultados confiveis na
diferenciao das espcies isoladas e na determinao do grau de conservao
ao longo do tempo, em diferentes regies geogrficas e nas diversas espcies de
hospedeiro.
GOLDBERG et al. (2003) exploraram as variaes intraespecficas
entre cepas de iridovrus (large mouth bass virus-LMBV) isoladas de peixes na
Amrica do Norte. Os autores observaram diferenas nos resultados do amplified
fragment length polymorphism-AFLP, mas no nas seqncias do DNA
analisadas e ressaltaram que no caso dos iridovrus, tcnicas de genome
screening como AFLP podem ser de maior utilidade que os seqnciamento
parciais para resolver diferenciao entre cepas muito prximas geneticamente.
JANCOVICH et al. (2004) realizaram estudo filogeogrfico dos
ranavrus que acometem salamandras nos Estados Unidos, comparando 514
nucleotdeos da extremidade 5 do gene da protena MCP e identificaram-nos
como pertencentes a um nico grupo monofilogentico, diferente do FV3 e de
outros ranavrus.
DO et al. (2005) analisaram atravs do seqnciamento total da MCP,
13 diferentes iridovrus isolados de peixes na Coria do Sul tendo demonstrando
que pertenciam a uma mesma espcie e que as semelhanas encontradas
deveram-se introduo de um nico agente.

25

Considerando o exposto e as homologias com FV3 detectadas no vrus


presente no Brasil (GALLI et al., 2006), objetivou-se com o presente trabalho
realizar o isolamento e cultivo do vrus, e seqnciamento completo do gene que
codifica a MCP, alm de complement-lo com anlises de outras regies do
genoma que permitem ampliar o conhecimento sobre o grau de homologia com
outros vrus do gnero. Estes dados possibilitaro verificar o grau de conservao
do vrus no decorrer de 35 anos desde a sua introduo no pas.

26

2 MATERIAL E MTODOS
2.1 Amostras de Vrus
O vrus foi obtido de girinos doentes de at 30 dias de idade com sinais
de edema e ascite, provenientes de trs ranrios localizados no Estado de Gois,
dois localizados no Municpio de Gameleira, 150 km ao sudoeste de Braslia e um
no Municpio de Hidrolndia, 250 km ao sudoeste de Braslia. Os girinos foram
preservados em etanol a 95% no local de colheita ou congelados a -20C no
laboratrio. Como controle positivo foi utilizada uma cepa cedida pelo Dr. V. G.
Chinchar da Universidade do Mississippi, Estados Unidos.

2.2 Isolamento de vrus


O isolamento do vrus foi realizado no Departamento de Microbiologia e
Imunologia da Universidade de Rochester, Nova Iorque, no laboratrio de Biologia
Molecular do Centro de Pesquisa em Alimentos da Escola de Veterinria e no
setor de Virologa Animal do Instituto de Patologia Tropical e Sade Pblica da
Universidade Federal de Gois. Para isolamento e cultivo do vrus, girinos
congelados foram macerados com grau e pistilo esterilizados adicionando-se
gua destilada esterilizada para facilitar a suspenso do material. Com auxlio de
seringa esterilizada de 5 mL, o material foi colhido e distribudo em tubos tipo
eppendorf

esterilizados

de

mL.

Procedeu-se

congelamento

descongelamento do macerado por trs vezes -80C, seguido de centrifugao


a 10.000 rpm por 10 minutos. O sobrenadante contendo o vrus foi filtrado em
filtro Millipore de 0,45, aliquotado e armazenado a -80C at o momento do
uso.
A suspenso de girinos macerada e filtrada foi inoculada em clulas A6
obtidas a partir de fibroblastos de r (RAFFERTY, 1969) cedidas pelo Prof. Dr.
Jacques Robert da Universidade de Rochester. Inicialmente procedeu-se a cultura
de clulas em garrafas de 25 cm2 com o meio de cultura Dulbeccos Modified
Eagle Medium (dMEM-GIBCO) com adio de antibiticos e antifngicos e
incubadas temperatura ambiente em cmara escura. Assim que as clulas
alcanaram 80% de confluncia, desprezou-se o meio de cultura e inoculou-se
1.0 mL da suspenso viral, imediatamente aps o descongelamento, ou 1.0 mL

27

de PBS na garrafa controle. Na fase experimental realizada nos Estados Unidos,


utilizou-se uma cepa de comprovado efeito citoptico (ECP) como controle
positivo. Aps um perodo de 45 minutos para permitir a aderncia dos vrus s
clulas, foram adicionados 5 mL do meio de cultura. Os cultivos foram observados
duas vezes por dia, durante sete dias, para verificao de ECP. Com o intuito de
aumentar a concentrao viral e permitir a mxima expresso da virulncia foram
realizadas trs passagens cegas do vrus. Cada passagem consistiu em congelar
a 80C e descongelar, por trs vezes, as garrafas nas quais foram observados
ECP. A seguir, procedeu a centrifugao a 5000 RPM durante 10 minutos, sendo
o sobrenadante obtido novamente aliquotado em tubos tipo eppendorf de 2 mL e
reutilizado imediatamente ou congelado a 80C at sua reutilizao.

2.3 Reao em cadeia da polimerase (PCR)


Para identificao do vrus, diretamente de suspenso de girinos e dos
cultivos celulares inoculados, utilizou-se tcnica de PCR.
A extrao do DNA viral foi realizada a partir de pores de 50 mg de
girinos inteiros aps macerao utilizando o mtodo do fenol/clorofrmio
(SAMBROOK et al., 1989). Foram utilizados iniciadores direcionados a regies
conservadas no genoma dos iridovrus (Quadro 1), principalmente para o gene
que codifica a protena imediata precoce (IE) ICP-18, a protena MCP, a RNA
polimerase DNA dependente (Pol II) e a subunidade do fator de iniciao
eucaritico (eIF2-).
Os iniciadores direcionados para amplificao do gene que codifica a
protena IE (GALLI et al., 2006) foram utilizados como screening primrio das
amostras, por ter sido comprovadamente eficaz nas condies de nosso
laboratrio. Sendo que na amostra positiva, realizava-se o PCR com os demais
iniciadores.
Com o intuito de obter o gene completo responsvel pela codificao da
MCP, foram utilizados iniciadores localizados nas extremidades 5e 3 do gene
correspondente na seqncia de FV3 (TAN et al., 2004) sendo que o iniciador
forward original do presente trabalho e o reverse j utilizado por HYATT et al.
(2000) segundo apresentado no Quadro 1. Para a determinao da temperatura

28

tima de anelamento de este par de iniciadores realizou-se uma PCR de


gradiente trmico, sendo avaliadas as temperaturas desde 50C at 65C.

QUADRO 1 Iniciadores utilizados para amplificao parcial do genoma de


ranavirus, bp indica o comprimento do amplicon.
Nome

Forward

Reverse

Produto
(bp)

MCP

ATGTCTTCTGTAACTGGTTCA

AAAGACCCGTTTTGCAGCAAAC (1)

1483

Pol II
TCACCGCCGCAGACATCTTTAG

GTAACCGTTCTTTTCGCAGTGG

377

IE
ATGATCCAAGCCTACCTGTGC (2)

AAATGTCCTAATCTATACACC (2)

479

eIF2
CAACAACAGGGACATCAGAAAGAG

TCTCGTTCCAGACATCAGGGAG

289

(1) HYATT et al. (2000); (2) GALLI et al. (2006). Os restantes iniciadores so
originais do presente trabalho.

O mix utilizado para a amplificao com os diferentes iniciadores


constitua-se de 2,5 L 10x tampo de PCR [Tris-HCl 20 mM (pH 8.4), KCl 50
mM], dNTP 200 M, 2,5 mM MgCl2, 2.5 M de cada iniciador, 1 U de Taq DNA
Polymerase, 5 L de DNA template e gua MilliQ at completar 50 L para cada
reao. Os ciclos de amplificao para cada par de iniciadores utilizados so
apresentados no Quadro 2.
Os produtos de amplificao foram submetidos a corrida em gel de
agarose a 1%, corados com brometo de etdeo 0.5 g/mL e visualizados em
transiluminador de luz UV.

29

QUADRO 2 Protocolos de PCR utilizados para cada par de iniciadores.


1er.
ciclo

Desnaturao Anelamento Extenso

Final

t
(min)

t (min)

t
(seg)

t
(min)

t
(min)

MCP

N de
ciclos
40

90

94

60

60

72

1,5

72

Pol II

40

90

94

60

60

72

72

IE

30

90

94

45

40

72

72

eIF2

40

90

94

60

60

72

72

2.4 Seqenciamento
Os produtos amplificados e confirmados na leitura como correspondendo
ao peso molecular esperado, foram sequenciados no Laboratrio de Genoma de
Plantas, Instituto de Cincias Biolgicas da Universidade Federal de Gois. Todos
os produtos foram seqenciados pelo menos seis vezes em ambas as cadeias. A
reao de seqenciamento dos fragmentos ocorreu com cada oligonucleotdeo
iniciador separado. O protocolo utilizado foi o seguinte: 1L do produto de PCR,
2,5 pmol de oligonucleotdeo iniciador, 2 L de tampo SaveMoney (2 mL de TrisHCl 1M pH 9.0, 1 mL de MgCl2 50 mM, gua MiliQ-q.s.p. 10 mL), 1 L do kit
DYEnamicTM ET Terminator Cycle Sequencing (Pharmacia Biotech, EUA). A
reao foi realizada no termociclador GeneAmp PCR Systems 9700 (Applied
Biosystems), cujos ciclos foram de 95C durante 20 segundos e 60C por 1
minuto e 15 segundos.
A etapa de precipitao do DNA ocorreu da segunte manerira: 40 L
de isopropanol 65% foram adicionados aos 10 L de reao. A mistura foi
homogeneizada no vortex (TECNAL TE162) por 30 segundos. Deixou-se que a
precipitao ocorresse temperatura ambiente por 20 minutos. As amostras
foram, entanto, centrifugadas a 2000 rcf (fora de centrifugao relativa) por 45
minutos e o sobrenadante descartado. Ao precipitado, foram adicionados 250 L
de etanol 60% para lavagem do material, e centrifugado a 2000 rcf por 10
minutos. O processo de lavagem com lcool foi repetido utilizando 100 L do
mesmo e, o sobrenadante descartado. A placa contendo as amostras foi

30

centrifugada de maneira invertida a 500 rpm por um minuto para garantir que todo
o lcool fosse retirado da mesma. Uma secagem complementar foi realizada
deixando-se a placa por aproximadamente 10 minutos na capela de fluxo laminar.
Este material foi ressuspenso em 10 L de formamida, vortexado por 1 minuto,
deixado temperatura ambiente por 5 minutos e levado em triplicatas ao
analisador automtico de seqncias 3100 DNA Sequencer (Applied Biosystems
ABI Prism).
Alinhamentos mltiplos foram realizados utilizando Clustal W (THOMPSON
et

al.,

1994)

ferramentas

disponibilizadas

(http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi).

no

GenBank

programa

PHYLIP

(http://evolution.gs.washington.edu/phylip.html) foi aplicado para a construo das


matrizes de distncias e elaborao de rvores filogenticas baseados no mtodo
do neighbour joining e os valores de bootstrap foram obtidos pela realizao de
100 repeties mediante as ferramentas disponibilizadas pelo

Instituto

A.N.

Belozersky Institute of Physico-Chemical Biology-Universidade Estadual de


Moscou. (http://www.genebee.msu.su/services/phtree_reduced.html).

31

3 RESULTADOS
3.1 Isolamento em cultura de clulas
Aps 48 horas da inoculao, as clulas comearam a evidenciar
sinais de leso viral. A uniformidade do tapete comeou a desaparecer, as clulas
perderam seu contorno regular e desprenderam-se do tapete, alm de apresentar
lise celular. Muitas clulas mostraram-se alongadas ou com forma de estrela
(Figura 1).

FIGURA 1 Cultura de clulas A6 mostrando o efeito citoptico aps 48 horas


de inoculao da suspenso de girinos suspeitos de infeco por
ranavirus.

3.2 PCR
Foram obtidos resultados positivos com os iniciadores utilizados na
amplificao do DNA genmico das amostras de girinos de at 30 dias de idade,
salvo com aqueles iniciadores direcionados ao gen eIF2-.
A temperatura de anelamento tima para amplificao completa da
MCP foi de aproximadamente 60C (Figura 2). O produto de amplificao
apresenta aproximadamente 1480 pares de bases.

32

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
1500
bp

FIGURA 2

Gel de PCR de gradiente trmico realizado para


determinao
da temperatura tima de anelamento dos
iniciadores direcionados amplificao do gene completo
que codifica a protena MCP. Canaletas 1 e 15 marcador
de peso molecular. Canaletas 2 a 14 com os produtos de
PCR desde 50 at 62C. Canaleta nmero 12 representa a
amostra de 60C.

A Figura 3 mostra os resultados da amplificao do DNA genmico


obtidos a partir de girinos de at 30 dias de idade utilizando os iniciadores para
Pol II. Observa-se a obteno de um produto de aproximadamente 377 pares de
bases.

400 bp

FIGURA 3

Gel de PCR mostrando o produto de amplificao


obtido
com
iniciadores
direcionados

amplificao do gen que codifica a protena Pol II.


Canaletas 1 e 6 marcador de peso molecular 100
bp ladder. Canaletas 2 e 3 amostras positivas
com peso molecular de aproximadamente 377 bp.
Canaleta 4 controle positivo, e 5 controle
negativo.

33

3.3 Seqenciamento
A anlise das seqncias obtidas pela amplificao completa do gene
que codifica a MCP permitiu identificar uma srie de 1465 pares de bases, sendo
registrada no GenBank com o nmero de acesso DQ897669. Verificou-se
homologia de 99,7% com as seqncias AY548484 e U36913 correspondentes
FV3, com 1461 bp idnticas, entre o total de 1465. Os altos percentuais revelam a
grande homologia com outros vrus pertencentes ao gnero Ranavirus, sendo
apresentados no alinhamento mltiplo da Figura 4. A partir destes dados foi
realizado o alinhamento mltiplo das seqncias nucleotdicas completas,
elaborada uma matriz de distncias genticas entre os vrus (Tabela 1) e o
dendrograma correspondente (Figura 5).
Os percentuais na homologia do gene que codifica a protena MCP
continuaram elevados quando comparadas s seqncias de aminocidos
deduzidas.

Foi encontrada uma identidade de 99% com FV3 -U36913 e

AY548484; 98% com Bohle iridovirus - AY187046 e Rana

tigrina ranavirus

- AY033630, AY033630 e AF389451; 96% com Epizootic haematopoietic necrosis


virus - AY187045; e 95% com Ambystoma tigrinum virus - AY150217.
A comparao com tradues da MCP no constantes no GenBank
correspondentes a Rana grylio virus, mas publicadas por ZHANG et al. (2006)
revelou 99% de homologia com RGV 9506 e RGV 9507 e 97% com RGV 9508. A
Figura 6 apresenta o alinhamento mltiplo da traduo dos aminocidos
correspondente seqncia completa da MCP para o vrus isolado no Brasil e a
comparao com outros vrus do gnero.
Quando analisadas as seqncias do gene que codifica a protena Pol
II, foram identificadas 356 pares de bases, com 100% de homologia com a
seqncia do FV3 AY548484, 98% com Tiger frog virus - AF389451, 96% com
Regina ranavirus - AF368230 e Ambystoma tigrinum stebbensi virus - AY150217.
O vrus detectado no Brasil localizou-se geneticamente junto com FV3
nos dendrogramas elaborados para ambas seqncias. Esta proximidade est
corroborada com os altos valores de bootstrap obtidos (Figuras 5 e 7).

34

DQ897669 1
ATGTCTTCTGTAACTGGTTCAGGTATCACAAGTGGTTTAATCGACTTGGCCACTTATGAC 60
AY548484 97345 ......................................C..................... 97404
U36913
92
......................................C..................... 151
AF389451 95938 ......................................C..................... 95997
AY033630 1
......................................C..................... 60
AY187046 1
...................T..................C..T.................. 60
AY187045 17
..............C.......................C..................... 76
AY150217 17651 ..............C.......................C..................... 17592
DQ897669
AY548484
U36913F
AF389451
AY033630
AY187046
AY187045
AY150217

61
97405
152
95998
61
61
77
17591

AATCTTGAGAGAGCAATGTACGGGGGTTCGGACGCCACCACGTACTTTGTCAAGGAGCAC
............................................................
............................................................
............................................................
............................................................
.............................A..............................
.....C....................C.................................
.....C...........A........C...........T....................T

120
97464
211
96057
120
120
136
17532

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

121
97465
212
96058
121
121
137
17531

TACCCCGTGGGGTGGTTCACCAAGCTGCCGTCTCTGGCTGCCAAGATGTCGGGTAACCCG
............................................................
............................................................
..................................................T.........
..................................................T.........
............................................................
......................................C..............C......
........A........T....................C..............C......

180
97524
271
96117
180
180
196
17472

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

181
97525
272
96118
181
181
197
17471

GCTTTCGGGCAGCAGTTTTCGGTCGGCGTTCCCAGGTCGGGGGATTACATCCTCAACGCC
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
...................................................A........

240
97584
331
96177
240
240
256
17412

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

241
97585
332
96178
241
241
257
17411

TGGTTGGTGCTCAAGACCCCCGAGGTCGAGCTCCTGGCTGCAAACCAGCTGAGAGAAAAT
...................................................G....C...
...................................................G....C...
........A...........T.................C............G........
........A...........T.................C............G........
...................................................G....C...
...........................A..........C............G....C..C
...........................A..........C............G.......C

300
97644
391
96237
300
300
316
17352

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

301
97645
392
96238
301
301
317
17351

GGCACCATCAGGTGGACAAAGAACCCCATGCACAACATTGTGGAGAGCGTCACCCTCTCA
............................................................
............................................................
............................................................
............................................................
.....A......................................................
.....A........................................A.....A.......
....................A.........................A.....A.......

360
97704
451
96297
360
360
376
17292

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

361
97705
452
96298
361
361
377
17291

TTCAACGACATCAGCGCCCAGTCCTTTAACACGGCATACCTGGACGCCTGGAGCGAGTAC
............................................................
............................................................
.....................................................T......
.....................................................T......
............................................................
............................................................
............................................................

420
97764
511
96357
420
420
436
17232

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

421
97765
512
96358
421
421
437
17231

ACCATGCCAGAGGCCAAGCGCACAGGCTACTATAACATGATAGGCAACACCAGCGATCTC
............................................................
............................................................
......................T.....................................
......................T.....................................
...........A..........T.....................................
......................T.....................................
...........A..........T.....................................

480
97824
571
96417
480
480
496
17172

35

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

481
97825
572
96418
481
481
497
17171

ATCAACCCCGCCCCGGCCACAGGCCAGGACGGAGCCAGGGTCCTCCCGGCCAAGAACCTG
............................................................
............................................................
............................................................
............................................................
............................................................
...........................A................................
...........................A...A.........T..................

540
97884
631
96477
540
540
556
17112

DQ897669 541
GTTCTTCCCCTCCCATTCTTCTTCTCCAGAGACAGCGGCCTGGCCCTGCCAGTCGTCTCC
AY548484 97885 ............................................................
U36913
632
............................................................
AF389451 96478 ......................................A.....................
AY033630 541
......................................A.....................
AY187046 541
............................................................
AY187045 557
............................................................
AY150217 17111 ............................................ .........T......

600
97944
691
96537
600
600
616
17052

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

601
97945
692
96538
601
601
617
17051

CTCCCCTACAACGAGATCAGGATAACAGTCAAGCTGAGGGCCATCCAGGACCTCCTGATC
...............................................C............
...............................................C............
............................................................
............................................................
...........T..A............................................T
............................................................
............................................................

660
98004
751
96597
660
660
676
16992

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

661
98005
752
96598
661
661
677
16991

CTCCAGCACAACACCACAGGGGCAATCAGCCCCATCGTGGCCTCCGACCTTGCGGGAGGT
............................................................
............................................................
..................................................C.........
..................................................C.........
..................................................C.........
..........................................G.......C.A.......
......................T...................G.......C.A.......

720
98064
811
96657
720
720
736
16932

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

721
98065
812
96658
721
721
737
16931

CTCCCCGACACCGTCGAGGCCAACGTCTACATGACCGTCGCCCTCATCACCGGGGACGAG
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
...........T..............T...........T.....................

780
98124
871
96717
780
780
796
16872

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217

781
98125
872
96718
781
781
797
16871

AGACAGGCCATGAGCAGCACAGTCAGGGACATGGTTGTGGAGCAGGTGCAGGCCGCCCCA
............................................................
............................................................
..G.................................................T.......
..G.................................................T.......
............................................................
..G................................C........................
..G................................C........................

840
98184
931
96777
840
840
856
16812

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673

841
98185
932
96778
841
841
857
16811
1
1
1
1
1
1
1
1
1
1
1
1
1

GTCCACATGGTCAACCCCAGGAACGCGACCACCTTCCACACCGACATGCGGTTCTCACAC
............................................................
............................................................
...........................G................................
...........................G................................
...........................G....................A...........
...........................G................................
...........................G................................
.
.
.
.
.
.
.
.
.
.
.
.
.

900
98244
991
96837
900
900
916
16752
1
1
1
1
1
1
1
1
1
1
1
1
1

36

AF157671
AF157651
AF157679
AF157659
AF157667
AF157665

1
1
1
1
1
1

.
.
.
.
.
.

1
1
1
1
1
1

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665

901
98245
992
96838
901
901
917
16751
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2

GCAGTCAAGGCCTTGATGTTTATGGTGCAGAACGTCACACACCCTTCCGTCGGCTCCAAT
............................................................
............................................................
............................................................
............................................................
............................................................
............C...............................................
............C.....................................T.........
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................

960
98304
1051
96897
960
960
976
16692
61
61
61
61
61
61
61
61
61
61
61
61
61
61
61
61
61
61
61

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665

961
98305
1052
96898
961
961
977
16691
62
62
62
62
62
62
62
62
62
62
62
62
62
62
62
62
62
62
62

TACACCTGCGTCACTCCCGTCGTGGGAGTCGGCAACACGGTCCTGGAGCCAGCCCTTGCG
............................................................
............................................................
............................C...........................G...
............................C...........................G...
........................................................G...
..........C....................A........................G...
..........C............T................................G...
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
........................................................G...
........................................................G...
..........C.............................................G...
..........C.............................................G...
..........C....................A........................G...
..........C.............................................G...

1020
98364
1111
96957
1020
1020
1036
16632
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645

1021
98365
1112
96958
1021
1021
1037
16631
122
122
122
122

GTAGATCCCGTCAAGAGCGCCAGCCTGGTGTACGAAAACACCACAAGGCTCCCCGACATG
............................................................
............................................................
..G.........................................................
..G.........................................................
..G.........................................................
..G......................................................C..
..G......A...............................................C..
......................CG....................................
......................CG....................................
......................CG.........A..........................
......................CG.........A..........................

1080
98424
1171
97017
1080
1080
1096
16572
181
181
181
181

37

AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048

122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
431
431

......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
......................CG....................................
.................T..........................................
..G...................CG....................................
..G..............T.......................................C..
..G..............T.......................................C..
..G...................CG.................................C..
A.G..............T.......................................C..
....................................
....................................

181
181
181
181
181
181
181
181
181
181
181
181
181
181
181
396
396

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048

1081
98425
1172
97018
1081
1081
1097
16571
182
182
182
182
182
182
182
182
182
182
182
182
182
182
182
182
182
182
182
395
395

GGAGTCGAGTACTACTCGCTGGTGGAGCCCTGGTACTATGCCACCTCCATCCCAGTCAGC
............................................................
............................................................
............................................................
............................................................
............................................................
........................C...................................
........................C...................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
........................C...................................
............................................................
........................C...................................
........................C...................................
........................C...................................
........................C...................................
............................................................
............................................................

1140
98484
1231
97077
1140
1140
1156
16512
241
241
241
241
241
241
241
241
241
241
241
241
241
241
241
241
241
241
241
336
336

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665

1141
98485
1232
97078
1141
1141
1157
16511
242
242
242
242
242
242
242
242
242
242
242
242
242
242
242
242
242
242
242

ACCGGGCACCACCTCTACTCTTATGCCCTCAGCCTGCAGGACCCCCACCCATCCGGATCC
............................................................
............................................................
.................................A.........................A
.................................A.........................A
............................................................
............................................................
.............................T..............................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
......................................................A.....
......................................................A.....
......................................................A.....
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................

1200
98544
1291
97137
1200
1200
1216
16452
301
301
301
301
301
301
301
301
301
301
301
301
301
301
301
301
301
301
301

38

DQ906049
DQ906048
M19872
AF367980

335
335
1
8141

............................................................
............................................................
...........................
...........................

276
276
27
8115

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048
M19872
AF367980
AY833650

1201
98545
1292
97138
1201
1201
1217
16451
302
302
302
302
302
302
302
302
302
302
302
302
302
302
302
302
302
302
302
275
275
28
8114
1

ACCAATTACGGTAGACTGACCAACGCCAGCCTTAACGTCACCCTGTCCGCTGAGGCCACC
............................................................
............................................................
...........C................................................
...........C................................................
...........C................................................
...........C................................................
...........C........T.......................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
.................A..........................................
.................A..........................................
.................A..........................................
............................................................
...........................................................A
..............................A..........................G..
...........C................................................
...........C..................A.C........................G..
...........C..................A.C........................G..
...........C................................................
...........C..................A.C........................G..
............................................................
............................................................
............................................................
...........C........T.......................................
........C................................................

1260
98604
1351
97197
1260
1260
1276
16392
361
361
361
361
361
361
361
361
361
361
361
361
361
361
361
361
361
361
361
216
216
87
8055
57

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048
M19872
AF367980
AY833650

1261
98605
1352
97198
1261
1261
1277
16391
362
362
362
362
362
362
362
362
362
362
362
362
362
362
362
362
362
362
362
215
215
88
8054
58

ACGGCCGCCGCAGGAGGTGGAGGTAACAACTCTGGGTACACCACCGCCCAAAAGTACGCC
............................................................
............................................................
.................C......G...................................
.................C......G...................................
.................C......G...................................
......T..........C.....CG...................................
G....G...........C.....CG...................................
............................................................
............................................................
............................................................
............................................................
.................C......G...................................
.................C......G...................................
.................C......G...................................
.................C......G...................................
............................................................
............................................................
............................................................
.................C......G...................................
.......T.........C......G...................................
.................C..........................................
.................C......G...................................
............................................................
............................................................
.....T...........C.....CG...................................
.................C.....C....................................
............................................................
............................................................
............................................................
.................C.....CG...................................
.................C......G...................................

1320
98664
1411
97257
1320
1320
1336
16332
421
421
421
421
421
421
421
421
421
421
421
421
421
421
421
421
421
421
421
156
156
147
7995
117

DQ897669
AY548484
U36913
AF389451

1321
98665
1412
97258

CTCATCGTTCTGGCCATCAACCACAACATTATCCGCATCATGAACGGCTCGATGGGATTC
............................................................
............................................................
............................................................

1380
98724
1471
97317

39

AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048
M19872
AF367980
AY833650

1321
1321
1337
16331
422
422
422
422
422
422
422
422
422
422
422
422
422
422
422
422
422
422
422
155
155
148
7994
118

............................................................
...........................................................T
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
...........................................................T
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
...........................................................T

1380
1380
1396
16272
481
481
481
481
481
481
481
481
481
481
481
481
481
481
481
481
481
481
481
96
96
207
7935
177

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677
AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048
M19872
AF367980
AY833650

1381
98725
1472
97318
1381
1381
1397
16271
482
482
482
482
482
482
482
482
482
482
482
482
482
482
482
482
482
482
482
95
95
208
7934
178

CCAATCTTGTAAAGAGTA-TTTTTCAGCGCAAAGTCTTTTCCGTCATGGGTCCTCCATGA
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-........T................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
......C...........T.........................................
..................-........T................................
..................T.........................................
..................T.........................................
..................-.........................................
......C...........T.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-.........................................
..................-........T................................

1439
98783
1530
97376
1439
1439
1455
16213
540
540
540
540
540
540
540
540
540
540
540
540
540
541
540
541
541
540
541
37
37
266
7876
236

DQ897669
AY548484
U36913
AF389451
AY033630
AY187046
AY187045
AY150217
AF157681
AF157669
AF157647
AF157645
AF157677

1440
98784
1531
97377
1440
1440
1456
16212
541
541
541
541
541

TGGAAATAAAACATGAAGTGTCCGTT
..........................
..........................
..........................
.......................
.................
.................
..A.......................
..........................
..........................
..........................
..........................
..........................

1465
98809
1556
97402
1462
1456
1472
16187
566
566
566
566
566

40

AF157675
AF157663
AF157661
AF157657
AF157655
AF157653
AF157649
AF157673
AF157671
AF157651
AF157679
AF157659
AF157667
AF157665
DQ906049
DQ906048
M19872
AF367980
AY833650

541
541
541
541
541
541
541
541
542
541
542
542
541
542
36
36
267
7875
237

..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..A.......................
..........................

566
566
566
566
566
566
566
566
567
566
567
567
566
567
11
11
292
7850
262

FIGURA 4 Alinhamento mltiplo para a seqncia de MCP obtida no Brasil


(DQ897669) com aquelas disponveis no GenBank. DQ897669
Brazilian vrus MCP; AY548484 Frog Virus 3 genoma completo;
U36913 Frog virus 3 MCP gene; AF389451 Tiger frog virus,
genoma completo; AY033630 Rana tigrina ranavrus MCP gene;
AY187046 Bohle iridovirus MCP gene; AY187045 Epizootic
haematopoietic necrosis virus MCP gene; AY150217 Ambystoma
tigrinum stebbensi vrus, genoma completo; AF157681 Tadpole
edema virus MCP gene; AF157669 Frog virus 3 MCP gene;
AF157647 Rana temporaria United Kingdom iridovirus 2 MCP
gene; AF157645 Rana temporaria United Kingdom iridovirus 1
capsid MCP; AF157675 Bufo marinus Venezuelan iridovirus 3
MCP gene; AF157663 Bufo marinus Venezuelan iridovirus 4 MCP
gene; AF157661 Bufo marinus Venezuelan iridovirus 6 MCP gene;
AF157657 Bufo bufo United Kingdom iridovirus 3 MCP gene;
AF157655 Bufo bufo United Kingdom iridovirus 2 MCP gene;
AF157653 Bufo bufo United Kingdom iridovirus 1 MCP gene;
AF157649 Bufo marinus Venezuelan iridovirus 1 MCP gene;
AF157673 Leptodactylus Venezuelan iridovirus 1 MCP gene;
AF157671 Guppyfish iridovirus MCP gene; AF157651 Bohle
iridovirus MCP gene; AF157679 Sheetfish iridovirus MCP gene;
AF157659 Catfish iridovirus MCP gene; AF157667 EHNV MCP
gene; AF157665 Doctor fish virus MCP gene; DQ906049 FV 3
MCP gene; DQ906048 FV3 MCP gene; M19872 FV3 ICR489
gene; AF367980 Regina ranavirus clone PstI 8.141 P8.141A,
P8.141B, P8.141C e P8.141D genes, e MCP gene; AY833650
Bohle iridovirus ICP 46 (ICP 46) gene. Os pontos indicam igual
base na posio indicada. Os nmeros ao lado das seqncias
indicam a posio das bases.

41

TABELA 1 Anlise comparativa das seqncias completas de nucleotdeos da


protena maior da cpside (MCP) de ranavirus. Os valores
representam o grau de diferena na seqncia de 1463 bp.

Matriz de Distncias

1
2
3
4
5
6
7
*.

Ranavirus*

DQ897669
FV3
TFV
RTV
BIV
EHNV
ATV

0.000
0.005
0.020
0.023
0.031
0.042
0.049

0.000
0.019
0.022
0.028
0.039
0.048

0.000
0.003
0.031
0.038
0.046

0.000
0.027 0.000
0.035 0.029 0.000
0.049 0.058 0.034 0.000

1 Ranavrus isolado no Brasil (DQ987669)


2 FV3 genoma completo (AY548484)
3 - Tiger Frog Virus genoma completo (AF389451)
4 Rana tigrina ranavrus MCP (AY033630)
5 Bohle iridovirus MCP (AY187046)
6 - Epizootic haematopoietic necrosis virus MCP (AY187045)
7 - Ambystoma tigrinum stebbensi virus, genoma completo (AY150217)

42

FIGURA 5

Dendrograma com valores de bootstrap construdo com o


alinhamento das seqncias completas da protena MCP de
ranavrus isolado no Brasil e outros vrus do gnero Ranavirus.

BRASIL 1
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

MSSVTGSGITSGLIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGLGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP
MSSVTGSGITSGFIDLATYDNLERAMYGGSDATTYFVKEHYPVGWFTKLPSLAAKMSGNP

BRASIL 61
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLRENGTIRWTKNPMHNIVESVTLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLGDNGTIRWTKNPMHNIVESVTLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLGDNDTIRWTKNPMHNIVESVTLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLGDNGTIRWTKNPMHNIVESVTLS
AFGQPFSVGVPRSGDYILNAWLVLKTPEVKLLAANQLGDNGTIRWTKNPMHNIVENVNLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLGDNGTIRWTKNPMHNIVESVTLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVELLAANQLGENGTIRWTKNPMHNIVESVTLS
AFGQQFSVGVPRSGDYILNAWLVLKTPEVKLLAANQLGDNGTIRWTKNPMHNIVENVNLS

BRASIL 121
FV3

FNDISAQSFNTAYLDAWSEYTMPEAKRTGYYNMIGNTSDLINPAPATGQDGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRTGYYNMIGNTSDLINPAPATGQDGARVLPAKNL

43

RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

FNDISAQSFNTAYLDAWSEYTMPEAKRIGYYNMIGNTSDLINPAPATGQDGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRIGYYNMIGNTSDLINPAPATGQDGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRIGYYNMIGNTSDLINPAPATGQNGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRTGYYNMIGNTSDLINPAPATGQDGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRTGYYNMIGNTSDLINPAPATGQDGARVLPAKNL
FNDISAQSFNTAYLDAWSEYTMPEAKRTGYYNMIGNTSDLINPAPATGQNGARVLPAKNL

BRASIL 181
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TIV
EHNV

VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIQDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIHDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIQDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIQDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPAVSLPYNEIRITVKLRAIQDLLILQHNTTGAISPIVAADLEGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIHDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIHDLLILQHNTTGAISPIVASDLAGG
VLPLPFFFSRDSGLALPVVSLPYNEIRITVKLRAIHDLLILQHNTTGAISPIVAADLEGG

BRASIL 241
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNATTFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNATTFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNAATFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNAATFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNATTFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNATTFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQVAPVHMVNPRNATTFHTDMRFSH
LPDTVEANVYMTVALITGDERQAMSSTVRDMVVEQVQAAPVHMVNPRNATTFHTDMRFSH

BRASIL 301
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGVGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCVTPVVGAGNTVLEPALAVDPVKSASLVYENTTRLPDM
AVKALMFMVQNVTHPSVGSNYTCATPVVGVDNTVLEPALAVDPVKSASLVYENTTRLPDI

BRASIL 361
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTSASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVEPWYYATSIPVSTGHHLYSYALSMQDPHPSGSTNYGRLTNASLNVTLSAEAT
GVEYYSLVQPWYYATSIPVSTGHHLYSYALSLQDPHPSGSTNYGRLTNASLNVTLSAEAT

BRASIL 421
FV3
RGV 9506
RGV 9507
RGV 9508
BIV
TFV
EHNV

TAAAGGGGNNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL 463
TAAAGGGGNNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TAAAGGGGNNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TAAAGGGGNNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TAAAGGGGDNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TAAAGGGGDNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TAAAGGGGDNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL
TASAGGGGDNSGYTTAQKYALIVLAINHNIIRIMNGSMGFPIL

FIGURA 6

Alinhamento mltiplo realizado com Clustal W dos aminocidos da


protena MCP para a seqncia do vrus isolado no Brasil; FV3 AY548484; trs cepas de Rana grylio virus (RGV) seqenciadas por
ZHANG et al. (2006); Bohle iridovirus (BIV) AY187046; Tiger frog virus
(TFV) AY033630; e Epizootic hematopoietic necrotic virus (EHNV)
AY187045. Os aminocidos que diferem de FV3 encontram-se
sombreados.

44

TABELA 2 Anlise comparativa das seqncias de nucleotdeos da protena


RNA polimerase DNA dependente (Pol II) de ranavirus. Os valores
representam o grau de diferena na seqncia de 356 bp.

Matriz de Distncias
Ranavirus*

1
2
3
4
5
*.

BR
0.000
FV3
0.000 0.000
TFV
0.036 0.036 0.000
ATV
0.065 0.065 0.030 0.000
RRV
0.262 0.266 0.254 0.261 0.000
1 Ranavrus isolado no Brasil (DQ987669)
2 FV3 (AY548484)
3 - Tiger Frog Virus (AF389451)
4 - Ambystoma tigrinum stebbensi virus (AY150217)
5 - "Regina ranavirus (AF368230)

FIGURA 7

Dendrograma com valores de bootstrap construdo com o


alinhamento das seqncias de nucleotideos da protena Pol II de
ranavrus isolado no Brasil e outros vrus do gnero Ranavirus.

45

4 DISCUSSO E CONCLUSES
Os resultados obtidos no presente trabalho confirmam a presena de
um vrus pertencente ao gnero Ranavirus em rs touro criadas no Brasil.
Ressalta-se que a elevada homologia verificada entre as regies seqenciadas do
vrus em estudo e aquelas do FV3, corroboram as observaes de GALLI et al.
(2006) e indicam que o vrus detectado no Brasil foi, provavelmente, introduzido
no pas junto com as rs importadas da Amrica do Norte.
Segundo ESSANI & GRANOFF (1989), o vrus do edema do girinoTEV pode ser considerado uma cepa do FV3. Esse agente, isolado de rs touro
na Amrica do Norte, foi considerado endmico nesta espcie (WOLF et al.,
1968). Estas observaes concordam com as do presente estudo, no sentido de
que o vrus isolado nas rs touro do Brasil, pode ser o mesmo FV3 dos Estados
Unidos e no uma outra espcie autctone da Amrica do Sul.
HYATT et al. (2000) realizando comparaes entre 30 iridovirus
isolados de peixes e anfbios verificaram que as seqncias obtidas da protena
MCP indicavam que os vrus de diferentes regies agrupavam-se em clados
separados. Assim, os vrus da Venezuela formaram um clado individual, diferente
daqueles da Amrica do Norte. Os dados obtidos no presente trabalho situam o
vrus estudado no mesmo clado do FV3, portanto, geneticamente mais prximo a
este do que dos vrus geograficamente vizinhos, reforando a hiptese de que a
introduo do vrus no Brasil ocorreu atravs da importao de rs da Amrica do
Norte.
ZHANG et al. (2001) ao caracterizarem os ranavrus isolados de rs de
criao (R. grylio) na China, por meio de estudos da extremidade 5 da MCP
concluram que os trs vrus isolados eram semelhantes entre si e com o FV3,
diferenciando-se deste ltimo apenas por um nucleotdeo. Seus resultados
levaram os autores a considerarem que a entrada do vrus no pas deu-se a
travs das rs de criao importadas dos Estados Unidos. Provavelmente, o
mesmo aconteceu na Amrica do Sul com a introduo da r touro.
ZHANG et al. (2006) amplificaram e seqnciaram o gene que codifica
a MCP, tendo verificado maiores diferenas na extremidade 3, e homologia com
FV3 superior a 99% para RGV9506 e 9507, e de 97,4% para RGV9508. Estes
resultados so semelhantes aos obtidos no presente trabalho e indicam elevada

46

conservao gentica do FV3 ao longo do tempo em diferentes reas


geogrficas.
Quando comparados os aminocidos da protena MCP dos trs vrus da
China com as obtidas no presente trabalho, observaram-se homologias de 99%
com RGV 9506 e RGV 9507, e 97% com RGV 9508. Estes resultados eram
esperados, considerando a alta homologia verificada entre os vrus da China e os
do presente estudo com o FV3.
Mas,

segundo

GOLDBERG

et

al.

(2003)

outras

tcnicas

de

caracterizao molecular como amplified fragment length polymorphism (AFLP)


devem ser utilizadas para determinar com maior preciso a similaridade com o
FV3.
Estudos recentes de GALLI et al. (2006) revelam semelhanas entre os
vrus isolados de rs touro de criao do Brasil e do Uruguai, bem como sua
similaridade com FV3. Os resultados do presente trabalho despertam interesse na
realizao de estudos do genoma com o vrus detectado no Uruguai, uma vez que
a introduo de rs nesse pas foi realizada a partir de rs de criao do Brasil,
em 1998.
No que pese a alta homologia verificada com FV3 nos fragmentos do
genoma do vrus isolado no Brasil, nota-se algumas diferenas no gene que
codifica a protena eIF2. Este gene, relacionado com fatores de virulncia
(ESSAUBER et al., 2001), no foi detectado com os iniciadores aqui utilizados,
sendo que o controle positivo, constitudo por uma cepa de FV3, sempre
amplificou. No entanto, o seqnciamento total do genoma do mutante de FV3
aza-Cr no identificou um gene completo correspondente protena eIF2 (TAN
et al., 2004). Nesse sentido, torna-se interessante a avaliao de fatores de
virulncia, uma vez que o vrus presente no Brasil, apesar de associado a surtos
de mortalidade generalizada em girinos, parece no representar grande perigo
para as rs (dados no apresentados). Esses vrus podem se tornar patognicos
devido a causas estressantes ou debilidade dos animais, como reiteradamente
enfatizado por CHINCHAR, (2000); ZHANG et al. (2001); GOLDBERG et al.
(2003); WILLIAMS et al. (2005).
Aparentemente o FV3 e espcies semelhantes no representam um
patgeno que possa ameaar as populaes de r touro, ficando reservado a este

47

anfbio o papel de um potencial disseminador do vrus devido a sua grande


utilizao em ranicultura e, conseqentemente, uma ameaa potencial para as
populaes de anfbios na natureza. Considerando os ranavirus, encontra-se bem
estabelecido que uma cepa pouco patognica para uma espcie animal pode ser
muito agressiva para outra. Adicionalmente verifica-se o perigo de disseminao a
outras classes de organismos aquticos (HENGSTBERGER et al., 1993;
ZUPANOVIC et al., 1998; MAO et al., 1999; CHINCHAR, 2002; WILLIAMS et al.,
2005).
Embora no presente trabalho tenha sido observada elevada homologia
entre o vrus isolado no Brasil e o FV3, so necessrios estudos mais
aprofundados

que

incluam

perfil

de

protenas,

padro

AFLP

e,

preferencialmente, o seqnciamento completo do seu genoma visando a


classificao exata da espcie detectada.

48

REFERNCIAS
1. AHNE, W.; BEARZOTTI, M.; BREMONT, M.; ESSBAUER, S. Comparison of
European systemic piscine and amphibian iridoviruses with epizootic
haematopoietic necrosis virus and frog virus 3. Zentralbl Veterinarmed Berlin, v.
45, n. 6, p. 373-383, 1998.
2. BRENNER, S.; HORNE, R. A negative staining method for high resolution
electron microscopy of viruses. Biochimica et biophysica Acta. Amsterdam, n.
34, p. 103-110, 1959.
3. CHINCHAR, V. Ranaviruses (family Iridoviridae): emerging cold-blooded
killers. Archives of Virology, New York-NY, v. 147, n. 3, p. 447-470, 2002
4. CHINCHAR, V.; MAO, J. Molecular diagnosis of iridovirus infections in coldblooded animals. Seminars in avian and exotic pet medicine. v. 9, n.1, p. 27-35,
2000.
5. CHINCHAR, V.; BRYAN, L.; WANG, J.; LONG, S.; CHINCHAR, G. Induction
of apoptosis in frog virus 3-infected cells. Virology, New York-NY, v. 306, n. 2, p.
303-312, 2003.
6. CHINCHAR, V.; ESSBAUER, S.; HE, J.; HYATT, A; MIYAZAKI, T.; SELIGY,
V.;WILLIAMS, T. Iridoviridae. In: Virus Taxonomy: 8th. Report of the International
Committee on the Taxonomy of Viruses. FAUQUET, C.; MAYO, C.; MANILOFF,
J.; DESSELBERGER, U.; BALL, L. (Eds.) Elsevier, London, p. 163-175, 2005.
7. CULLEN, B.; OWENS, L. Experimental challenge and clinical cases of Bohle
iridovirus (BIV) in native Australian anurans. Diseases of Aquatic Organisms,
Amelinghausen, v. 49, n. 2, p.83-92, 2002.
8. CUNNINGHAM, A.; LANGTON, T.; BENNETT, P.; LEWIN, J.; DRURY, S.;
GOUGH, R.; MACGREGOR, S. Pathological and microbiological findings from
incidents of unusual mortality of the common frog (Rana temporaria).
Philosophical Transactions of the Royal Society of London. Series B,
Biological Sciences. London, v. 351, n. 1347, p. 1539-1557, 1996
9. DASZAK, P.; BERGER, L.; CUNNINGHAM, A.; HYATT, A.; GREEN, D.;
SPEARE, R. Emerging infectious diseases and amphibian population declines.
Emerging Infectious Diseases, Atlanta, v. 5, n. 6, p. 735-748, 1999.
10. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Emerging Infectious Diseases of
Wildlife - Threats to biodiversity and human health. Science. Washington-DC v.
287, n. 5452, p. 443-449, 2000
11. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Infectious Diseases and
amphibian population declines. Diversity and Distributions. Oxford-UK, v. 9, n.
2, p. 141-150, 2003.

49

12. DO, J.; CHA, S.; KIM, J.; AN, E.; LEE, N.; CHOI, H.; LEE, C.; PARK, M.; KIM,
J.; KIM, Y.; PARK, J. Phylogenetic analysis of the major capsid protein gene of
iridovirus isolates from cultured flounders Paralichthys olivaceus in Korea.
Diseases of Aquatic Organisms, Amelinghausen, v. 64, p.193-200, 2005.
13. GALLI, L.; PEREIRA. A. ; MARQUEZ, A.; MAZZONI, R. Ranavirus detection
by PCR in cultured tadpoles (Rana catesbeiana Shaw 1802) from South America.
Aquaculture, Amsterdam, v., 257, n. 1-4, p. 78-82, 2006.
14. GANTRESS, J.; MANIERO, G.; COHEN, N.; ROBERT, J. Development and
characterization of a model system to study amphibian immune responses to
iridoviruses. Virology, New York-NY, v. 311, n. 2, p. 254-262, 2003.
15. GOLDBERG, T.; COLEMAN, D.; GRANT, E.; INENDINO, K.; PHILIPP, D.
Strain variations in an emerging iridovirus of warm-water fishes. Journal of
Virology, Washington-DC, v. 77, n. 16, p. 8812-8818, 2003.
16. GRANOFF, A. Viruses of Amphibia. Current topics in Microbiology and
Immunology. New York-NY. n. 50, p. 107-137, 1969.
17. HE, J.; LU, L.; DENG, M.; HE, H.; WENG, S.; WANG, X.; ZHOU, S.; LONG, Q.;
WANG, X.; CHAN, S. Sequence analysis of the genoma completo of an iridovirus
isolated from the tiger frog. Virology, New York-NY, v. 292, n. 2, p.185-197, 2002.
18. HEDRICK , R.; McDOWELL, T.; AHNE, W.; TORHY, C.; KINKELIN, P.
Properties of three iridovirus-like agents associated with systemic infections of
fish. Diseases of Aquatic Organisms, Amelinghausen, v. 13, p. 203-209, 1992.
19. HENGSTBERGER, S.; HYATT, A.; SPEARE, R.; COUPAR, B. Comparison of
epizootic haematopoietic necrosis and Bohle iridoviruses, recentrly isolated
Australian iridoviruses. . Diseases of Aquatic Organisms, Amelinghausen, v. 15,
p. 93-107, 1993
20. HERNIOU, E.; LUQUE, T.; CHEN, X.; VLAK, J.; WINSTALNLEY, D.; CORY,
J.; OREILY, D. Use of whole genome sequence data to infer baculovirus
phylogeny. Journal of Virology, Washington-DC, v. 75, p. 8117-8126, 2001.
21. HYATT, A.; GOULD, A.; ZUPANOVIC, Z.; CUNNINGHAM, A.;
HENGSTBERGER, S.; WHITTINGTON, R.; KATTENBELT, J.; COUPAR, B.
Comparative studies of piscine and amphibian iridoviruses. Archives of Virology,
New York-NY, v. 145, n. 2, p.301-331, 2000.
22. JANCOVICH, J.; DAVIDSON, E.; MORADO, J.; JACOBS, B.; COLLINS, J.
Isolation of a lethal virus from the endangered tiger salamander, Ambystoma
tigrinum stebbinsi Lowe. Diseases of Aquatic Organisms, Amelinghausen v. 31,
p. 161167, 1997.
23. JANCOVICH, J.; DAVIDSON, E.; PARAMESWARAN, N.; MAO, J.;
CHINCHAR, V.; COLLINS, J.; JACOBS, B. Evidence for emergence of an

50

amphibian iridoviral disease because of human-enhanced spread. Molecular


Ecology, Oxford, n. 14, p. 213-224, 2005.
24. KIM, Y.; JUNG, S.; CHOI, T.; KIM, H.; RAJENDRAN, K.; OH, M. PCR
amplification and sequence analysis of irido-like virus infecting fish in Korea.
Journal of Fish Diseases, Oxford, v. 25, n. 2, p. 121-124, 2002.
25. MAO, J.; GREEN, D.; FELLERS, G.; CHINCHAR, V. Molecular
characterization of iridoviruses isolated from sympatric amphibians and fish. Virus
Research, Amsterdam, v. 63, n. 1-2, p.45-52, 1999.
26. MARSH, I.; WHITTINGTON, B.; OROURKE, B.; HYATT, A.; CHISHOLM, O.
Rapid differentiation of australian, european, and american ranaviruses based on
variation in major capsid protein gene sequence. Molecular and Celular Probes.
New York-NY, v. 16, n. 2, p. 137-151, 2002.
27. MATHIAS, M.; SCOTT, P. Potencial produtivo de criao de rs no Estado do
Rio de Janeiro. Srie Agronegcios, SEBRAE/RJ, 100p., 2004.
28. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000, Cairns, Austrlia. Conference and Workshop Compendium. Cairns,
Rainforest CRC, 2000, p. 37-38.
29. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000,
Cairns,
Austrlia.
Power
Point
presentation.
http://www.jcu.edu.au/school/phtm/PHTM/frogs/mazzoni.ppt, 2000. Acesso em: 25
oct. 2003..
30. MAZZONI, R.; CARNEVIA, D. Enfermedades de ranas en criadero: Una limitante
real para el desarrollo de la ranicultura. In: ENCONTRO LATINO AMERICANO DE
PATOLOGISTAS EM ORGANISMOS AQUTICOS. Resumos.... Florianpolis:
ABRAPOA, v.2, p. 228, 2000.
31. OIE. WORLD ORGANIZATION FOR ANIMAL HEALTH. Necrosis
Hematopoytica Epizotica In: Cdigo Sanitario para los Animales Acuticos
2002. Disponvel em: http://www.oie.int/esp/normes/fcode/E_00029.htm Acesso
em: 15 mar. 2004.
32. QIN, Q.; CHANG, S.; NGOH-LIM, G.; GIBSON-KUCH, S.; CHI, C.; LAM, T.
Characterization of a novel ranarivus isolated from grouper Epinephelus tauvina. .
Diseases of Aquatic Organisms. Oldendorf/Luhe, v. 53, n. 1, p. 125-131, 2003.
33. RAFFERTY, K. Mass culture of amphibian cells: methods and observations
concerning stability of cell type. In: Mizell, M. (Ed.), Biology of Amphibian
Tumors. Springer Verlag, New York, pp. 52 81. 1969

51

34. ROKAS, A.; WILLIAMS, B.; KING, N.; CARROL, S. Genome-scale


approaches to resolving incongruence in molecular phylogenies. Nature, London,
v. 425, p. 798-804, 2003.
35. SAMBROOK, J.; FRITCSH, E.; MANIATIS, T. Molecular cloning: A
laboratory manual. 2. ed. New York : Cold Spring Harbor Laboratory, 1989. 3v.
3104p.
36. SPEARE, R. Summary of formidable infectious diseases of amphibians.
In: AMPHIBIAN DISEASE HOME PAGE. Webmaster SPEARE, R. School of
Public Health and Tropical Medicine, James Cook University, 2001
Disponvel em: http://www.jcu.edu.au/school/phtm/PHTM/frogs/formidable.htm.
Acesso em: 11 jan.2003.
37. TAN, W., BARKMAN, T., CHINCHAR, V., ESSANI, K. Comparative genomic
analyses of frog virus 3, type species of the genus Ranavirus (family Iridoviridae).
Virology, New York-NY, v. 323, p. 70-84, 2004.
38. THOMPSON, J.; HIGGINS, D.; GIBSON, T. Clustal W: improving the
sensitivity of progressive multiple sequence alignment through sequence
weighting, positions-specific gag penalties and weight matrix choice. Nucleic
Acids Research, Oxford, v. 22, p. 4673-4680, 1994.
39. WEBBY, R.; WATSON, J.; KALMAKOFF, J.. Course on Iridovirus. In: Course
on Iridovirus. Webmaster WEBBY, R. University of Otago, Dunedin, New Zealand,
1998. Disponvel em: http:// osms.otago.ac.nz/. Acesso em: 20 set. 2003.
40. WENG, S.; WANG, Y.; HE, J.; DENG, M.; LU, L.; GUAN, H.; LIU, Y.; CHAN, S.
Outbreaks of an iridovirus in red drum, Scianenops ocellata (L.), cultured in
southern China. Journal of Fish Diseases. Oxford, v. 25, n. 11, p. 681-685,
2002.
41. WILLIAMS, T.; BARBOSA-SOLOMIEU, V.; CHINCHAR, V. A decade of
advances in iridovirus research. Advances in Virus Research, New York, v. 65,
p. 173-248, 2005.
42. WOLF, K.; BULLOCK, G.; DUNBAR, C.; QUIMBY, M. Tadpole edema virus: a
viscerotropic pathogen for anuran amphibians. Journal of Infectious Diseases,
Chicago-IL , v. 118, n. 3, p.253-262,1968.
43. ZHANG, Q.; XIAO, F.; LI, Z.; GUI, J.; MAO, J.; CHINCHAR, V.
Characterization of an iridovirus from the cultured pig frog Rana grylio with lethal
syndrome. Diseases of Aquatic Organisms, Amelinghausen, v. 48, n. 1, p. 2736, 2001.
44. ZHANG, Q.; ZHE, Z.; XIAO, F.; LI, Z.; GUI, J. Molecular characterization of
three Rana grylio virus (RGV) isolates and Paralichthys olivaceus lymphocystis
disease virus (LCDV-C) in iridoviruses. Aquaculture, Amsterdam, v. 251, n. 1, p.
1-10, 2006.

52

45. ZUPANOVIC, Z.; MUSSO, C.; LOPEZ, G.; LOURIERO, C.; HYATT, A.;
HENGSTBERGER, S.; ROBINSON, A. Isolation and characterization of
iridoviruses from the giant toad Bufo marinus in Venezuela. Diseases of Aquatic
Organisms, Amelinghausen, v. 33, n. 1, p. 1-9, 1998c.

53

CAPITULO 3
RANAVRUS ASSOCIADOS A MORTANDADE DE GIRINOS (Rana
catesbeiana Shaw, 1802) DE CRIAO INTENSIVA NO BRASIL.
RESUMO
Doenas que cursam com alta mortalidade, caracterizadas clinicamente por
edemas e ascite, tm sido observadas reiteradamente em girinos de criao. O
conhecimento destas doenas escasso, tornando necessrio determinar os
agentes etiolgicos envolvidos, visando sugerir as correspondentes medidas
profilticas e teraputicas. Agentes virais pertencentes Famlia Iridoviridae,
gnero Ranavirus, tm sido confirmados recentemente em girinos de criao por
meio da tcnica de reao em cadeia da polimerase. Assim, objetivou-se com o
presente trabalho a caracterizao das doenas nos girinos, visando
principalmente determinar a participao etiolgica dos vrus. Foram realizados
estudos em trs ranrios comerciais do Estado de Gois, incluindo necropsias,
anlises histopatolgicas, microbiolgicas, parasitolgicas, moleculares e de
microscopia eletrnica de transmisso. Foram identificados dois quadros clnicos
diferentes, sendo um deles em girinos jovens de at quatro semanas de vida, com
mortalidade acima de 90% da populao, cuja etiologia foi atribuda a um vrus do
gnero Ranavirus, Famlia Iridoviridae. O outro em girinos na pr-metamorfose,
cuja presena de cocos Gram-positivos constitui a causa principal das leses
encontradas e dos sinais clnicos evidenciados. Pela primeira vez foi identificada
uma doena produzida por iridovirus no Brasil, tornando um achado de
importncia para a ranicultura, e tambm para a aqicultura em geral, tendo em
vista que estes agentes podem acometer outros grupos de organismos aquticos.
Palavras chave: Aqicultura, estreptococos, ranicultura, septicemia, vrus.

54

ABSTRACT

Diseases with high mortality, clinically characterized by oedema and ascites, have
been frequently observed in farmed tadpoles. Since there is scarce information
about these diseases, it is necessary to determine etiological agents involved, for
recommending appropriate prophylactic and therapeutic measures. Viruses
belonging to the Family Iridoviridae, genus Ranavirus, have been recently
detected in farmed tadpoles by polymerase chain reaction. So, the objective of this
study was the characterization of the diseases affecting farmed tadpoles, aiming to
determine the etiological role of viruses. There were performed studies in three
commercial farms located at Gois State, including necropsy, histopathological
analysis, microbiology, parasitology, and molecular studies. There were
determined two different clinical patterns, one of them in young tadpoles till four
weeks old, with mortality above 90% of population, etiologically related to a virus
(Ranavirus, Family Iridoviridae). The second one in tadpoles reaching the premetamorphic period, where the presence of Gram-positive cocci was the main
cause for observed lesions and clinical signs. For the first time a disease produced
by iridoviruses was identified in Brazil, being an important fact for frog farming, as
well as for aquaculture, considering that these infectious agents can infect other
aquatic organisms from different groups.
Key words: Aquaculture, frog farming, streptococci, septicemia, virus.

55

1 INTRODUO
A ranicultura uma atividade em expanso na Amrica do Sul sendo a
espcie cultivada a r-touro Americana (Rana catesbeiana Shaw, 1802)
introduzida no Brasil em 1935, mas as populaes atualmente criadas foram
originadas de 300 casais importados da Amrica do Norte em 1970 ao Brasil
(MATHIAS & SCOTT, 2004). Em decorrncia do clima favorvel, da excelente
adaptao da r touro, e da tecnologia desenvolvida pelos produtores e
pesquisadores brasileiros, a ranicultura constitui uma atividade importante no
Brasil, particularmente no Estado de Gois. Com o melhoramento nos
conhecimentos sobre manejo e alimentao, a ranicultura transformou-se numa
atividade super intensiva, com altas densidades de populao e com estrita
dependncia dos alimentos balanceados. Entretanto, os mtodos intensivos de
cultivo favoreceram o aparecimento de doenas que constituem uma ameaa
para a viabilidade tcnica e econmica dos criatrios de organismos aquticos
(AUSTIN, 1984).
As doenas infecciosas septicmicas em anfbios tm caractersticas
etiolgicas pouco claras, devido principalmente aos sinais inespecficos e aos
achados de diversos agentes que atuam em forma conjunta, sendo na maioria
das vezes, oportunistas. As bactrias incriminadas nas doenas em larvas de
vrias espcies de anfbios so todas elas habitantes do ambiente e convivem de
forma permanente com os animais afetados. Este fato sugere que os girinos
adoecem quando causas estressantes ou debilitantes colaboram para produzir
uma queda na imunidade e conseqentemente a invaso pelos microrganismos
presentes (GLORIOSO et al., 1974; AMBROSKY et al., 1983; GREEN et al.,
2002; MAUEL et al., 2002; PASTERIS et al., 2006).
Os iridovirus que infectam animais aquticos possuem uma distribuio
mundial e esto associados a doenas severas (CUNNINGHAM et al., 1996;
AHNE et al.,1998; DASZAK et al., 1999; HYATT et al., 2000; SPEARE, 2001;
ZHANG et al., 2001; CHINCHAR, 2002; HE et al., 2002; MARSH et al., 2002;
WENG et al., 2002; GREER et al. 2005; ROBERT et al., 2005; ZHANG et al.,
2006). Os girinos tm maior suscetibilidade podendo sofrer mortalidade de at
100% da populao. Por outro lado, os iridovrus podem infectar outras espcies

56

diferentes dentro da mesma classe taxonmica, bem como de classes diferentes


(MAO et al., 1999).
Em ranrios da China, ZHANG et al. (2001) isolaram agentes do gnero
Ranavirus de girinos, rs jovens e rs adultas da espcie Rana grylio, as quais
apresentavam sinais de doena e mortalidade de at 90%.
WENG et al. (2002) relataram a doena da distenso abdominal em
girinos de criao da espcie Rana tigrina rugulosa, tambm na China.
Observaram quadros clnicos com mortalidade de 95% dos girinos, os quais
apresentavam abdome aumentado de tamanho, ataxia e reduo da atividade.
necropsia identificaram rins, fgado e bao aumentados de tamanho e com
petquias na superfcie.
GREEN et al. (2002), estudando 44 surtos de doenas em anfbios dos
Estados Unidos, incriminaram os iridovrus em 25 casos, sendo 20 deles em
girinos, e cinco na espcie r touro.
Doenas com alta mortalidade, caracterizadas clinicamente por
edemas e ascite, tm sido observadas reiteradamente em girinos. MAZZONI
(2000a, 2000b); MAZZONI & CARNEVIA (2000) suspeitaram da participao de
um agente viral pertencente Famlia Iridoviridae, gnero Ranavirus, baseados
em quadro clnico semelhante ao descrito por WOLF et al. (1968) para o vrus do
edema do girino (TEV). A presena do agente foi confirmada recentemente em
girinos de criao pela tcnica de reao em cadeia da polimerase (PCR) (GALLI
et al., 2006). Estes resultados, corroboram a hiptese da etiologia viral para a
doena estudada.
Objetivou-se com o presente trabalho caracterizar as doenas
infecciosas em girinos de criao e verificar a participao de ranavirus como
agente etiolgico. Para tanto, foram realizadas pesquisas dos agentes etiolgicos,
a epizootiologa das doenas, a sintomatologia clnica, a anatomia patolgica
macroscpica, a histopatologia, a bacteriologia convencional, e a virologia, sendo
esta por meio do emprego de tcnicas moleculares, cultura de clulas e a
microscopia eletrnica de transmisso.

57

2 MATERIAL E MTODOS
Foram estudados girinos criados em trs ranrios localizados no Estado
de Gois, dois localizados no Municpio de Gameleira, 150 km ao sudoeste de
Braslia e um no Municpio de Hidrolndia, 250 km ao sudoeste de Braslia. , no
perodo de 2003 a 2005. Um dos ranrios realizava exclusivamente a fase de
reproduo, ecloso e cria de girinos at 30 dias de vida quando eles ainda esto
no estgio 25 segundo GOSNER (1960). O outro ranrio recebia girinos do
anterior, dedicando-se metamorfose e engorda de rs. O terceiro criatrio
realizava todas as fases do ciclo na mesma estrutura. Todos os ranrios
utilizavam fontes de gua superficial.
Os girinos foram alimentados com raes fareladas contendo 45% de
protena bruta, principalmente de origem animal.
A gua dos tanques foi constantemente renovada e a densidade
mantida na faixa de um girino por litro de gua. Toda vez que um tanque de
criao era esvaziado, drenava-se a gua e realizava-se limpeza e desinfeco
final com cloro.

2.1 Amostragem de girinos


Utilizaram-se 500 girinos de r touro (R. catesbeiana) com sinais
aparentes da doena e 100 girinos aparentemente sadios. Para fins de estudo, os
girinos foram separados em dois grupos, o primeiro at os 30 dias de idade e o
segundo at a metamorfose. Todos os espcimes foram transportados em sacos
plsticos contendo gua, e analisados imediatamente no laboratrio do Centro de
Pesquisa em Alimentos da Escola de Veterinria da Universidade Federal de
Gois.
Selecionaram-se preferencialmente girinos nos estgios iniciais da
sndrome, no tendo sido utilizados animais mortos para evitar erros induzidos
pelas alteraes ps-mortem (NACE, 1974).

2.2 Anlise Microbiolgica


Uma vez sacrificados por concusso craniana e corte da medula
cervical (AVMA, 1993), os exemplares foram submersos em soluo de cido

58

peractico a 0,2%. Aps a abertura da pele e cavidade celmica, fgado, rins,


bao e lquido asctico foram retirados utilizando-se utenslios esterilizados para
cada corte. As amostras foram processadas imediatamente pelos mtodos de
rotina (BRASIL, 2003) sendo inoculadas em caldos BHI (Brain Heart Infussion
Broth), Casoy, (Tripticase Soy Broth), Glicose Azida e Selenito-Cistina. Todas as
amostras foram incubadas a 30C por 24-72 h. O perodo de incubao de 72 h
deveu-se ao crescimento lento de alguns estreptococos, procurando-se, desta
forma, dar tempo suficiente para seu desenvolvimento, tentando-se evitar a
ocorrncia de falsos negativos. Assim que foi observado crescimento bacteriano
foram semeadas alquotas em placas de gar sangue contendo 5% de sangue
desfibrinado de carneiro, e incubadas a 30C por um perodo mximo de 72 hs,
determinando-se as caractersticas hemolticas e morfologia das unidades
formadoras de colnias (UFC). As UFC isoladas e com diferente morfologia foram
selecionadas para colorao de Gram e observao em microscpio de contraste
de fase.
Os
bioqumicas

cocos

Gram-positivos

complementares.

As

foram

UFC

estudados

identificadas

mediante

provas

primariamente

pela

bioqumica como estreptococos, foram enviadas para determinao da espcie ao


Aquatic Animal Health Research Laboratory em Auburn - Alabama, nos Estados
Unidos. As culturas foram processadas pelo mtodo de Identificao de cidos
graxos da membrana, FAME (Fatty Acid Methyl Ester).
Os bastonetes Gram-negativos foram incubados em placas de gar
McConkey e as UFC selecionadas inoculadas em tubos de TSI (Triple Sugar Iron
Agar) e submetidas bateria de testes bioqumicos para identificao da espcie.
Amostras de gua e da rao foram analisadas periodicamente por
tcnicas microbiolgicas convencionais para determinao de contaminao fecal
e presena de cocos Gram-positivos (BRASIL, 2003).

2.3 Histopatologia
Girinos inteiros de at 30 dias de idade, ou fgado, rins e bao de
girinos com mais de 30 dias, foram extrados e preservados em formol tamponado
a 10% (vol-vol) e processados segundo a rotina no laboratrio de Histopatologia
do Hospital das Clnicas da Universidade Federal de Gois pelos mtodos de

59

LUNA (1968). Os blocos parafinados foram secionados em cortes de 4-5 e


corados com hematoxilina-eosina (H&E) para as avaliaes primrias das leses.
Adicionalmente, os cortes selecionados foram tambm corados pelo mtodo de
Gram para visualizao de bactrias em geral, pelo mtodo de Fite para deteco
de mycobactrias e colorao de PAS para visualizao de fungos.

2.4 Reao em cadeia da polimerase (PCR)


Foram processados 60 girinos inteiros com at 30 dias de idade, alm
do fgado, rim, bao e msculo de 50 girinos na pr-metamorfose. As amostras
foram preservadas em etanol a 95% ou congelados a -20C at processamento
no Laboratrio de Biologia Molecular do Centro de Pesquisa em Alimentos da
Escola de Veterinria da Universidade Federal de Gois. A extrao do DNA foi
realizada a partir de pores de 50 mg utilizando o mtodo do fenol/clorofrmio
(SAMBROOK et al., 1989).
Foram utilizados iniciadores direcionados a regies conservadas no
genoma dos iridovrus (Quadro 1). Para o gene que codifica a protena imediata
precoce (IE) ICP-18 utilizaram-se iniciadores propostos por GALLI et al. (2006), e
para o gene que codifica a protena MCP foram utilizados iniciadores localizados
nas extremidades 5e 3 da seqncia de FV3 (TAN et al., 2004) sendo que o
iniciador forward original do presente trabalho e o reverse j utilizado por
HYATT et al. (2000) segundo apresentado no Quadro 1.

QUADRO 1 Iniciadores utilizados para amplificao parcial do genoma de


ranavirus, bp indica o comprimento do amplicon.
Nome

Forward

Reverse

Produto
(bp)

MCP

ATGTCTTCTGTAACTGGTTCA

AAAGACCCGTTTTGCAGCAAAC (1)

ATGATCCAAGCCTACCTGTGC (2)

AAATGTCCTAATCTATACACC (2)

1483

IE

(1) HYATT et al. (2000); (2) GALLI et al. (2006).

479

60

O mix utilizado para a amplificao com os diferentes iniciadores


constitua-se de 2,5 L 10x tampo de PCR [Tris-HCl 20 mM (pH 8.4), KCl 50
mM], dNTP 200 M, 2,5 mM MgCl2, 2.5 M de cada iniciador, 1 U de Taq DNA
Polymerase, 5 L de DNA template e gua MilliQ at completar 50 L para cada
reao. Os produtos de amplificao foram submetidos a corrida em gel de
agarose a 1%, corados com brometo de etdeo 0.5 g/mL e visualizados em
transiluminador de luz UV.
Foram tambm utilizados iniciadores direcionados identificao da
bactria Streptococcus iniae aplicando a metodologia de PCR proposta por
BERRIDGE et al. (1998). Os cocos Gram-positivos, independentemente do
gnero foram purificados, sendo o DNA extrado pela metodologia do
fenol/clorofrmio (SAMBROOK et al., 1989).

2.5 Microscopia eletrnica de transmisso


As amostras foram processadas no laboratrio de Microscopia
Eletrnica do Instituto Biolgico de So Paulo. O material analisado foi
selecionado a partir de leses identificadas nas lminas da histopatologia. Uma
vez delimitada a regio suspeita, a mesma foi localizada no bloco parafinado e
realizado corte de aproximadamente 1 mm de dimetro. O fragmento extrado foi
desparafinado, re- hidratado e finalmente processado pela tcnica de incluso em
resina, seguida de contrastao positiva de cortes ultrafinos de acordo com os
procedimentos usuais de incluso em resina, baseando-se nos mtodos de LUFT,
(1961) e GONZALES-SANTANDER, (1969). Os fragmentos de rgos foram
fixados em glutaraldedo a 2,5% em tampo fosfato 0,1M e pH 7,0, ps-fixados
em tetrxido de smio a 2% em tampo fosfato 0,2M, pH 7,0, corados por acetato
de uranila a 0,5%, desidratados em srie cetnica crescente (50 a 100%) e
includos em resina Spurr. Aps ultra seccionamento dos blocos, os cortes
ultrafinos obtidos foram corados positivamente pelo tratamento seqencial de
acetato de uranila (WATSON, 1958) e citrato de chumbo (REINOLDS, 1963),
antes de serem observados ao microscpio eletrnico de transmisso Philips EM
208.

61

2.6 Parasitologia
Estudos da pele e das guelras foram realizados a fresco em
microscpio tico mediante raspagens com lmina de bisturi esterilizada.
(REICHENBACH-KLINKE & ELKAN, 1965).

62

3 RESULTADOS
3.1 Epizootiologia
Em girinos jovens de at 30 dias de idade, a doena foi detectada no
Estado de Gois em todas as pocas do ano, sendo a maior freqncia
observada no perodo das chuvas, ou seja, de Novembro a Abril. A mortalidade
pode atingir percentuais elevados de 90 at 100% da populao total.
Verificou-se

que

girinos

aparentemente

saudveis

morriam

subitamente. Em alguns casos a totalidade dos girinos de um tanque morria em


24 a 48 h. Girinos de tanques contguos, s vezes originados na mesma desova,
no apresentavam sintomas de forma simultnea. Porm, no perodo de uma ou
duas semanas morriam quase todos os exemplares ficando no ranrio s 1-2% da
populao inicial.
Os girinos sobreviventes continuaram seu desenvolvimento sem sinais
aparentes da doena. Todavia no perodo prvio metamorfose, observou-se
uma sndrome caracterizada por morbidade baixa, com alta letalidade, afetando 2
a 3% da populao por dia.

3.2 Evidncias clnicas


O conjunto de sinais evidenciou a existncia de duas formas clnicas,
uma que afeta girinos jovens e outra que acomete girinos prximos
metamorfose.
3.2.1 Quadro clnico em girinos jovens
Caracterizado por surtos super agudos ou agudos com morbidade e
mortalidade acima de 90% da populao do ranrio.
A doena acometeu principalmente girinos entre a segunda e quarta
semana de vida e caracterizou-se por uma forma aguda de infeco, com
aparecimento de sinais clnicos de letargia, aumento do volume abdominal de
duas a trs vezes o tamanho normal, ou diminuio do volume abdominal
sugerindo caquexia. A morte ocorreu dentro das 24 h aps observao dos sinais
clnicos. Outros girinos desenvolveram forma super aguda da infeco com morte
sem evidncia clnica (Figura 1).

63

FIGURA 1 Girinos com sintomas de infeco. a) no centro girino normal, e a


esquerda e direita girinos ascticos; b) no centro girino jovem
normal, esquerda girinos caquecticos, e direita girinos asciticos;
c) girino na pr-metamorfose com ascite e lcera na pele (seta), d)
girino na pr-metamorfose com edema na pata.

3.2.2 Quadro clnico em girinos na pr-metamorfose


Os

poucos

animais

que

sobreviveram,

continuaram

seu

desenvolvimento sem alteraes at atingir o perodo da metamorfose, quando foi


observada uma segunda variante da doena caracterizada por edemas nas patas,
ascite e, s vezes, lceras na pele (Figura 1), com baixa morbidade e alta
mortalidade dos animais afetados.

3.3 Necropsia
3.3.1 Achados macroscpicos em girinos jovens
Observou-se um grau varivel de ascite com lquido sero-hemorrgico
abertura da cavidade celmica e tonalidade plida do fgado.

64

3.3.2 Achados macroscpicos em girinos na pr-metamorfose


Os girinos doentes mostraram diversos graus de leses nos rgos
internos, mas sem padro definido. As de maior freqncia foram aumento do
volume e colorao anormal do fgado, geralmente cinzenta ou amarelada; bao
aumentado de volume e com colorao pardo-escura e rins hemorrgicos.

3.4 Histopatologia
3.4.1 Achados microscpicos em girinos jovens
microscopia os rgos mais afetados foram os rins, seguidos pelo
fgado. Nos rins, observou-se morte celular generalizada, afetando glomrulos e
tbulos, com abundante picnose e cariorexia, com perda total da estrutura normal
do parnquima (Figura 2A). Notou-se, tambm, uma marcada infiltrao de
eosinfilos.
No fgado os hepatcitos mostraram-se vacuolizados, com esteatose e
reas de morte celular com marcada picnose e cariorexia (Figura 2B). Notou-se
um infiltrado inflamatrio predominantemente mononuclear e, em algumas
regies, infiltrao de eosinfilos.
Em girinos de at trs semanas de idade, os cortes histolgicos
corados pelo mtodo de Gram, no revelaram a presena de bactrias no
parnquima dos rgos afetados, ou na mucosa dos rgos digestivos.
Entretanto, em girinos com quatro semanas de idade foram identificados cocos
Gram-positivos nas mucosas do estmago e intestino e colonizao inicial de
diversos tecidos. Os cortes revelaram tambm a presena de cocos grampositivos no contedo gastro intestinal.
3.4.2 Achados microscpicos em girinos na pr-metamorfose
3.4.2.1 Achados em animais aparentemente sadios
Girinos sem sinais aparentes de doena revelaram diversos graus de
leso quando estudados histopatologicamente. Os principais rgos afetados
foram os rins e fgado. Os rins apresentaram infiltrao mononuclear abundante.
O fgado mostrou diversos graus de esteatose e quantidade varivel de

65

granulomas em fases iniciais, com necrose central (Figura 2C). A colorao de


Gram aplicada aos cortes histolgicos dos dois rgos revelou a presena de
cocos Gram positivos.

FIGURA 2

(A) Leso renal em girino jovem produzida por ranavrus, com


perda total da arquitetura do rgo. Necrose celular com picnose e
cariorexia (estrela), infiltrado mononuclear (seta larga) e aumento
dos eosinfilos (seta fina preta). Colorao H&E, 200X. (B) Leso
heptica em girino jovem produzida por ranavrus. Necrose,
notando-se picnose e cariorexia, com perda da estrutura trabecular.
Colorao H&E, 200X. (C) Rim de girino na pr-metamorfose
mostrando acentuado infiltrado mononuclear e tbulos com
abundante material hialino. Colorao H&E, 400X. (D) Fgado de
girino na pr-metamorfose. Observa-se perda da estrutura
trabecular do tecido heptico e a fase inicial da formao dos
granulomas, com rea de necrose central e infiltrado mononuclear
abundante. Colorao de H&E, 200X.

66

3.4.2.2 Forma aguda


A maioria dos girinos apresentaram leses por sepse, caracterizadas
por resposta inflamatria mltipla e granulomas bacterianos distribudos no
parnquima dos diversos rgos, alm de reas de necrose associadas
presena de macrfagos e grande infiltrao linfocitria.
O nmero de focos de melanomacrfagos distribudos no fgado foi
muito reduzido e s vezes ausente. Macrfagos com cocos fagocitados foram
tambm um achado comum no parnquima do rgo, sendo observada forte
relao entre esta resposta e o aparecimento dos granulomas que mostraram
regies necrticas circundadas por macrfagos e fibroblastos. Outro achado
comum foi a esteatose hepatoctria, com perda da estrutura normal do tecido,
associada, por vezes, a necrose. As leses no fgado foram mais intensas na
regio centrolobular que do que na regio periportal.
Os rins sempre foram muito afetados, apresentando infiltrao
mononuclear s vezes focal e outras difusa, necrose glomerular e tubular,
congesto, e granulomas. Foram observados glomrulos com espessamento da
membrana basal, aumento da celularidade, desaparecimento das alas, retrao,
atrofia e esclerose. Foi possvel observar o depsito de material hialino nos
glomrulos e abundantes cilindros hialinos nos tbulos (Figura 2D). Esse tipo de
leso pode ser classificada como glomerulonefrite membranoproliferativa,
evoluindo esclerose, o que determina sndrome nefrtica seguida por
insuficincia renal.
O estudo das seces pela colorao de Gram revelaram a presena
de cocos Gram-positivos em grau varivel associados s leses observadas na
colorao H&E. Observaram-se cocos Gram-positivos nos glomrulos e no
interstcio, demonstrando que os microrganismos so carregados pelo sangue,
produzindo leses e granulomas. As coloraes de PAS e Fite foram negativas
para a presena de fungos e micobacterias respectivamente.
No foram identificados nos tecidos estudados corpsculos de incluso
viral.

67

3.5 Microbiologia
3.5.1 Girinos jovens
As culturas a partir de amostras de tecidos ou lquido asctico no
revelaram a presena de bactrias na fase inicial dos sintomas.
Nos girinos com mais de quatro semanas, as anlises bacteriolgicas
apresentaram resultados inespecficos, com presena de cocos Gram-positivos
dos

gneros

associados

Streptococcus,
bastonetes

Enterococcus,
Gram

negativos

Aerococcus
dos

gneros

Leuconostoc,
Aeromonas,

Pseudomonas, Citrobacter e Proteus. Deve-se ressaltar que no foi detectada a


presena de uma nica espcie bacteriana que pudesse ser incriminada como
agente causal, mas os achados sempre corresponderam a cultivos mistos.
3.5.2 Girinos na pr-metamorfose
Todos os girinos estudados foram positivos para cocos Gram-positivos
de diversos gneros, sendo que 60% deles foram positivos para Aeromonas
hydrophyla e Citrobacter spp. e 35% para Pseudomonas spp. e Proteus spp.
Dentre os cocos Gram-positivos, foram identificados principalmente Streptococcus
uberis, S. agalactie, S. faecalis, S. dysgalactiae, e Enterococcus spp. Em todos os
casos, os rgos afetados com maior freqncia foram o fgado, seguido pelo rim.
Unidades formadoras de colnias no tipificadas no laboratrio foram
identificadas pelo FAME como Enterococcus gallinarium, E. columbae, E.
casseliflavus, Leuconostoc spp. e Aerococcus viridians.

3.6 Reao em cadeia da polimerase (PCR)


Quando foram estudados girinos com menos de 30 dias de idade
apresentando sinais tpicos da doena, a PCR direcionada aos genes que
codificam as protenas MCP e IE detectou em 90% dos casos os genes alvo.
Quando analisados girinos na pr-metamorfose evidenciando edemas e ascite,
10% foram positivos para o virus.

68

3.7 Parasitologia
Os estudos parasitolgicos revelaram a presena de parasitas da pele
cujas leses recebem o nome genrico de opacidade contagiosa da pele, onde
o protozorio mais freqentemente encontrado foi o Oodinum spp.

3.8 Microscopia eletrnica de transmisso


Quando analisadas amostras de girinos at quatro semanas de idade,
foram observadas partculas hexagonais completas e incompletas com a forma
icosadrica tpica dos vrus da famlia (Figura 3). Nestes cortes observou-se a
ocorrncia de alteraes tpicas de infeco viral, com as clulas lisadas, as
organelas todas alteradas e vazias, mitocndrias sem cristas e ncleos disformes
contendo cromatina marginalizada ou grumos de cromatina com ausncia de
membrana nuclear alm de incluses claras, alteraes compatveis com infeco
viral.
Nos estudos das amostras de girinos na pr-metamorfose, no foram
observadas incluses nem partculas virais.

360 nm

FIGURA 3 -

Microscopia eletrnica de transmisso. Microfotografia de corte


ultrafino de rim de girino jovem com sintomas de edema e ascite.
Observam-se, no citoplasma, partculas hexagonais completas
(seta) e incompletas com a forma icosadrica tpica dos vrus da
famlia.

69

4 DISCUSSO E CONCLUSES
Os dados do presente estudo permitiram considerar a existncia de
duas sndromes diferenciadas, uma delas em girinos jovens, de at um ms de
vida e outra em girinos sobreviventes, na pr-metamorfose.

4.1 Infeco em girinos jovens


A infeco em girinos jovens com menos de 30 dias de idade
caracteriza-se pela ocorrncia de edema e ascite de forma aguda, com ndices de
morbidade e mortalidade de mais de 90% da populao do ranrio sendo o
principal agente etiolgico envolvido um vrus da Famlia Iridoviridae, que
segundo os produtos de PCR obtidos pertence ao gnero Ranavirus (GALLI et al.,
2006; MAZZONI et al., dados no publicados).
O quadro clnico caracterizado por ascite e edema, com mortalidade
elevada coincide com as observaes de WOLF et al. (1968) em R. catesbeiana
infectada pelo vrus do edema do girino (TEV) e de ZHANG et al. (2001) e WENG
et al. (2002) para girinos de r na China com a doena da barriga inchada
produzidas, tambm, por ranavrus. Os sinais observados de edema e ascite
tambm so indicativos da presena da leso em nvel histopatolgico.
No que se refere a histopatologia, a leso principal foi observada nos
rins, com destruio quase completa do parnquima, embora o fgado tambm
tenha apresentado importante grau de leses. Esta preferncia do vrus pelo rim
foi tambm assinalada em estudos das leses produzidas em Xenopus laevis
infectadas com a espcie prottipo da famlia, o Frog Virus 3, de acordo com
GANTRESS et al. (2003). No foram observadas petquias nos rgos afetados,
o que difere dos achados de WOLF et al. (1968) e WENG et al. (2002).
A ausncia de corpsculos de incluso viral nos cortes histolgicos
estudados esto em concordncia com os achados de WILLIAMS et al. (2005).
Esses autores verificaram que os ranavirus no produzem este tipo de
corpsculos nos tecidos infectados, sendo que os locais de replicao viral
encontram-se dispersos no citoplasma da clula afetada, sem uma membrana
envolvente.

70

Torna-se relevante assinalar que no foi detectada a presena de


bactrias acompanhando as leses nestes girinos. Ao contrrio, estes girinos
apresentaram constantemente reaes positivas para ranavrus nos testes de
PCR.
Pela primeira vez foi identificada uma doena produzida por iridovirus
no Brasil, sendo um achado de importncia para a ranicultura, e tambm para a
aqicultura em geral, tendo em vista que estes agentes tm a capacidade de
acometer outros grupos de organismos aquticos.

4.2 Infeco em girinos na pr-metamorfose


Girinos que sobrevivem infeco podem desenvolver um segundo
quadro clnico menos grave, que cursa com edemas nas patas, ascite e, s
vezes, lceras na pele. Apresentam baixa morbidade e alta mortalidade.
Os estudos histopatolgicos revelaram danos menos severo nos rins e
fgado, principais rgos afetados. O tipo de leso encontrado caracterizado por
necrose e degenerao com abundantes granulomas e infiltrao mononuclear
linfocitria. Na colorao de Gram observou-se abundante presena de cocos
Gram-positivos associados s leses descritas. Nota-se a penetrao de cocos
Gram-positivos na mucosa do estomago, os quais so transportados pela via
sangunea iniciando assim uma colonizao de outros rgos internos.
Este tipo de leso granulomatosa tm sido descrito no s associado s
leses estreptoccicas bem como a outras bactrias que sobrevivem fagocitose.
Os macrfagos que fagocitam agentes de elevada resistncia, so responsveis
pelo incio de reaes inflamatrias localizadas. O desenvolvimento desses
microrganismos, com conseqente reao imune, d origem s leses
granulomatosas caractersticas das infeces crnicas (AGIUS & ROBERTS,
2003).
O quadro de leso estreptoccica coincide com os achados descritos
em criaes de trutas, (ELDAR et al., 1995; AKHLAGHY et al., 1996; ELDAR et
al., 1997; CHANG et al., 2002; DILER et al., 2002; BACHRACH et al., 2003),
linguados, (TORANZO et al., 1995; ROMALDE et al., 2000),

bagres

71

(SHOEMAKER et al., 2000, 2001) e tilapias (CHANG & PLUMB, 1996; EVANS et
al., 2000a, 2000b; KLESIUS et al., 2000; SHELBY et al., 2002a, 2002b).
No foi possvel, nas condies deste estudo, determinar a causa
primria que antecede a invaso dos tecidos pelos estreptococos. A ao dos
ranavrus nas etapas iniciais dos girinos pode ter sido um fator desencadeante,
atuando isoladamente ou associado a fatores ambientais relacionados ao manejo
e, principalmente, a uma alimentao desbalanceada. A metamorfose constitui
um perodo de acentuado estresse, portanto, parece lgico pensar que girinos
debilitados podem morrer ao longo do processo. Do equilbrio entre a resposta
imune, a presena dos microrganismos, e o grau de leso pr-existente nos
diversos tecidos, surge a severidade da doena neste perodo especfico. Estas
afirmaes esto em concordncia com aquelas j assinaladas, mencionando que
os girinos adoecem quando causas estressantes ou debilitantes colaboram para
produzir queda na imunidade e conseqente invaso pelos microrganismos
presentes (GLORIOSO et al., 1974; AMBROSKY et al., 1983; GREEN et al.,
2002; MAUEL et al., 2002; PASTERIS et al., 2006).
A presena de diversas espcies sem a determinao de um patgeno
permanente ou constante, indica o carter secundrio da infeco. Porm, o
papel dos cocos no pode ser descartado na evoluo da doena e, portanto,
devem ser levados em conta nos planos de controle sanitrio dos ranrios
comerciais.
No foram associados agentes virais s mortes de girinos nesta fase.
As leses identificadas na histopatologia, diferem daquelas descritas para os
ranavrus, e nos estudos de PCR s 10% dos girinos estudados foram positivos
para esses vrus. Estes resultados indicam que o papel dos vrus nos quadros de
mortalidade em girinos na pr-metamorfose no fundamental. Os achados da
histopatologia sugerem que a patognese do quadro seja de leso estreptoccica
secundria. Aps ao primria do vrus, os estreptococos penetram atravs das
paredes dos rgos digestivos e colonizam diversos tecidos, iniciando assim, o
processo de infeco, formao de granulomas e septicemia. O papel do vrus na
depleo imunitria que habilita a penetrao das bactrias, no foi determinado,
mas poderia ser uma das causas envolvidas.

72

Nas descries realizadas para epizootiologia e patogenia dos


Ranaviurs, tem sido feita referncia maior susceptibilidade dos girinos mais
jovens s infeces por estes agentes (WOLF et. al., 1968; GRANOFF et al.,
1969; JANCOVICH et al., 1997; HYATT et al., 2000; CULLEN & OWENS, 2002) e
estudos avaliando as respostas imunes em anfbios corroboram estes resultados
(GANTRESS et al., 2003).
A presena de parasitas do gnero Oodinum na pele dos girinos
estudados pode ser considerada uma conseqncia do estado geral dos anfbios,
sendo secundria s infeces descritas acima.

73

9 REFERNCIAS
1. AGIUS, C.; ROBERTS, R. Melano-macrophage centres and their role in fish
pathology. Journal of Fish Diseases. Oxford, n. 26, p. 499-509, 2003.
2. AHNE, W.; BEARZOTTI, M.; BREMONT, M.; ESSBAUER, S. Comparison of
European systemic piscine and amphibian iridoviruses with epizootic
haematopoietic necrosis virus and frog virus 3. Zentralbl Veterinarmed Berlin, v.
45, n. 6, p. 373-383, 1998.
3. AKHLAGHI, M.; MUNDAY, B.; WHITTINGTON, R. Comparison of passive and
active immunization of fish against streptococcosis (enterococcosis). Journal of
Fish Diseases. Oxford, n. 19, p. 251-258, 1996.
4. AMBORSKI, R. L.; SNIDER, T. G.; THUNE, R. L.; CULLEY, D. D. A nonhemolytic, group B Streptococcus infection of cultured bullfrogs, Rana catesbiana,
in Brazil. Journal of Wildlife Diseases. Ames-IO, v.19, n. 3, p. 180-184, 1983.
5. AUSTIN, B. The future of bacterial fish vaccines. Vaccine. London, v.2, n. 4, p.
249-254, 1984.
6. BACHRACH, G.; ZLOTKIN, A.; HURVITZ, A.; EVANS, D. L.; ELDAR, A.
Recovery of Streptococcus iniae from diseased fish previously vaccinated with a
streptococcus vaccine, Applied and environmental microbiology. WashingtonDC, v. 67, n. 8, p. 3756-3758, 2003.
7. BERRIDGE, B. R.; FULLER, J. D.; DE AZAVEDO, J.; LOW, D. E.;
BERCOVIER, H.; FRELIER, P. F. Development of specific nested oligonucleotide
PCR primers for the Streptococcus iniae 16S-23S ribosomal DNA intergenic
spacer. Journal of Clinical Microbiology. Washington-VA, v. 36, n. 9, p. 27782781, 1998.
8. BRASIL. Ministrio da Agricultura, Pecuria e Abastecimento. Mtodos
analticos oficiais para anlises microbiolgicas para o controle de produtos de
origem animal e gua. Instruo Normativa 62, de 26 de agosto de 2003. Dirio
Oficial [da] Republica Federativa do Brasil, Poder Executivo, Braslia, DF, 18
set., 2003. Seo I, p.14-50.
9. BRENNER, S.; HORNE, R. A negative staining method for high resolution
electron microscopy of viruses. Biochimica et Biophysica Acta. Amsterdam, n.
34, p. 103-110, 1959.
10. CHANG, P.; PLUMB, J. Histopathology of experimental Streptococcus sp.
infection in tilapia, Oreochromis niloticus (L.), and channel catfich, Ictalurus
punctatus (Refinsque). Journal of Fish Diseases. Oxford, v. 19, p. 235-241,
1996.
11. CHANG, P.; LIN, P.; LEE, Y. Lactococcus graviae infection of cultured rainbow
trout, (Oncorhynchus mikiss) in Taiwan and associated biophysical characteristics

74

and histopathology. Bulletin of the European Association of Fish Pathologists.


The Netherlands, v. 22, n. 5, p. 319-327, 2002.
12. CHINCHAR, V. Ranaviruses (family Iridoviridae): emerging cold-blooded
killers. Archives of Virology, New York-NY, v. 147, n. 3, p. 447-470, 2002
13. CULLEN, B.; OWENS, L. Experimental challenge and clinical cases of Bohle
iridovirus (BIV) in native Australian anurans. Diseases of Aquatic Organisms,
Amelinghausen, v. 49, n, 2, p.83-92, 2002.
14. CUNNINGHAM, A.; LANGTON, T.; BENNETT, P.; LEWIN, J.; DRURY, S.;
GOUGH, R.; MACGREGOR, S. Pathological and microbiological findings from
incidents of unusual mortality of the common frog (Rana temporaria).
Philosophical Transactions of the Royal Society of London. Series B,
Biological Sciences, London, v. 351, n. 1347, p. 1539-1557, 1996.
15. DASZAK, P.; BERGER, L.; CUNNINGHAM, A.; HYATT, A.; GREEN, D.;
SPEARE, R. Emerging infectious diseases and amphibian population declines.
Emerging Infectious Diseases, Atlanta, v. 5, n. 6, p. 735-748, 1999
16. DILER, O.; ALTUN, S.; ADILOGLU, A.; KUBILAY, A.; ISIKLI, B. First
occurence of Streptococcosis affecting framed rainbow trout, (Oncorhynchus
mikiss) in Turkey. Bulletin of the European Association of Fish Pathologists.
The Netherlands, v. 22, n. 1, p. 21-26, 2002..
17. ELDAR, A.; BEJERANO, Y.; LIVOFF, A.; HOROVITCZ, A.; BERCOVIER, H.
Experimental streptococcal meningo-encephalitis in cultured fish. Veterinary
Microbiology. Amsterdam, v. 43, p. 33-40, 1995.
18. ELDAR, A.; HOROVITCZ, A.; BERCOVIER, H. Development and efficacy of a
vaccine against Streptococcus iniae infection in farmed rainbow trout. Veterinay
Immunology and Immunopathology. Amsterdam, v. 56, p. 175-183, 1997.
19. EVANS, J.; KLESIUS, P.; GILBERT, P.; SHOEMAKER, C.; AL SARAWI, M.;
LANDSBERG, J.; DUREMDEZ, R.; AL MARZOUK, A.; AL ZENKI, S.
Characterization of -haemolytic Group B reptococcus agalactiae in cultured
seabream, Sparus auratus L., and wild mullet, Liza klunzingeri (Day), in Kuwait.
Journal of Fish Diseases. Oxford, v. 25, p. 505-513, 2000.
20. EVANS, D. L.; TAYLOR, S.; LEARY, J.; BISHOP, G.; ELDAR, A.; JASOFRIEDMANN, L. In vivo activation of tilapia nonspecific cytotoxic cells by
Streptococcus iniae and amplification with apoptosis regulatory factor(s). Fish and
Shellfish Immunology. London, v.10, n. 5, n. 6, p. 419-434, 2000.
21. GALLI, L.; PEREIRA. A. ; MARQUEZ, A.; MAZZONI, R. Ranavirus detection by
PCR in cultured tadpoles (Rana catesbeiana Shaw 1802) from South America.
Aquaculture, Amsterdam, v., 257, n. 1-4, p. 78-82, 2006.

75

22. GANTRESS, J.; MANIERO, G.; COHEN, N.; ROBERT, J. Development and
characterization of a model system to study amphibian immune responses to
iridoviruses. Virology, New York-NY, v. 311, n. 2, p. 254-262, 2003.
23. GLORIOSO, J. C.; AMBORSKI, R. L.; AMBORSKI, G. F.; CULLEY, D. D.
Microbiological studies on septicaemic bullfrogs (Rana catesbiana). American
Journal of Veterinary Research. Chicago-IL, v. 35, n. 9, p. 1241-1245, 1974.
24. GONZALES-SANTANDER, R. Tcnicas de microscopia eletrnica en biologa.
Madrid, Aguilar, 1969, 666 p.
25. GOSNER, K. A simplified table for staging anuran embryos and larva with
notes on identification. Herpetologica, Austin-TX, v. 16, p. 183-190, 1960.
26. GRANOFF, A. Viruses of Amphibia. Current topics in Microbiology and
Immunology. New York-NY. v. 50, p. 107-137, 1969.
27. GREEN. D.; CONVERSE, K.; SCHRADER, A. Epizootiology of sixty-four
amphibian morbidity and mortality events in the USA, 1996-2001. Annals of the
New York Accademy of Science, New York, v. 969, p. 323-339, 2002.
28. GREER, A.; BERRILL, M.; WILSON, P. Five amphibian mortality events
associated with ranavirus infection in south central Ontario, Canada. Diseases of
Aquatic Organisms, Amelinghausen, v. 67, p. 9-14, 2005.
29. HE, J.; LU, L.; DENG, M.; HE, H.; WENG, S.; WANG, X.; ZHOU, S.; LONG, Q.;
WANG, X.; CHAN, S. Sequence analysis of the genoma completo of an iridovirus
isolated from the tiger frog. Virology, New York-NY, v. 292, n. 2, p.185-197, 2002
30. HYATT, A.; GOULD, A.; ZUPANOVIC, Z.; CUNNINGHAM, A.;
HENGSTBERGER, S.; WHITTINGTON, R.; KATTENBELT, J.; COUPAR, B.
Comparative studies of piscine and amphibian iridoviruses. Archives of Virology,
New York-NY, v. 145, n. 2, p.301-331, 2000.
31. JANCOVICH, J.; DAVIDSON, E.; MORADO, J.; JACOBS, B.; COLLINS, J.
Isolation of a lethal virus from the endangered tiger salamander, Ambystoma
tigrinum stebbinsi Lowe. Diseases of Aquatic Organisms, Amelinghausen v. 31,
p. 161167, 1997.
32. KLESIUS, P.; SHOMAKER, C.; EVANS, J. Efficacy of single and combined
Streptococcus iniae isolate vaccine administred by intraperitoneal and
intramuscular routes in tilapia (Oreochromis niloticus). . Aquaculture. Amsterdam,
v. 188, p. 237-246, 2000.
33. LUFT, J. A. Improvements in an epoxy resin embedding methods. Journal of
Biophysics, Biochemestry and Cytology, v. 9, p. 409-414, 1961.
34. LUNA, L.G. Manual of histology staining methods of the Armed Forces
Institute of Pathology. 3.ed. New York : McGraw-Hill, 1968. 258p.

76

35. MAO, J.; GREEN, D.; FELLERS, G.; CHINCHAR, V. Molecular


characterization of iridoviruses isolated from sympatric amphibians and fish. Virus
Research, Amsterdam, v. 63, n. 1-2, p.45-52, 1999.
36. MARSH, I.; WHITTINGTON, B.; OROURKE, B.; HYATT, A.; CHISHOLM, O.
Rapid differentiation of australian, european, and american ranaviruses based on
variation in major capsid protein gene sequence. Molecular and Celular Probes.
New York-NY, v. 16, n. 2, p. 137-151, 2002.
37. MATHIAS, M.; SCOTT, P. Potencial produtivo de criao de rs no Estado do
Rio de Janeiro. Srie Agronegcios, SEBRAE/RJ, 100p., 2004.
38. MAUEL, M.; MILLER, K; FRAZIER, K; HINES, M. Bacterial pathogens isolated
from cultured bullfrogs (Rana catesbeiana). Journal of Veterinary Diagnostic
and Investigations. Columbia-MO, v. 14, n. 5, p. 431-433, 2002.
39. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000, Cairns, Austrlia. Conference and Workshop Compendium. Cairns,
Rainforest CRC, 2000a, p. 37-38.
40. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000b,
Cairns,
Austrlia.
Power
Point
presentation.
http://www.jcu.edu.au/school/phtm/PHTM/frogs/mazzoni.ppt, 2000. Acesso em: 25
oct. 2003..
41. MAZZONI, R.; CARNEVIA, D. Enfermedades de ranas en criadero: Una limitante
real para el desarrollo de la ranicultura. In: ENCONTRO LATINO AMERICANO DE
PATOLOGISTAS EM ORGANISMOS AQUTICOS. Resumos.... Florianpolis:
ABRAPOA, v.2, p. 228, 2000.
42. NACE, G. (ed.): Amphibians: Guidelines for the breeding, care and
management of laboratory animals. Washington D.C., NRC/NAS, 1974, 153p.
Disponvel em: http://www.nap.edu/catalog/661.html#toc , Acesso em: 15 fev
2004.
43. PASTERIS, S.; BUHLER, M.; NADER-MACIAS, M. Microbiological and
histological studies of farmed-bullfrog (Rana catesbeiana) tissues displaying redleg syndrome. Aquaculture. Amsterdam, v. 251, n. 1, p. 11-18, 2006.
44. REICHENBACH-KLINKE, H.; ELKAN, E. The principal diseases of lower
vertebrates, New York, Academic Press, 600 pp., 1965.
45. REINOLDS, E.S. The use of lead citrate at high pH as an electron-opaque
stain in electron microscopy. Journal of Cell Biology, v. 17, p. 208-212, 1963.

77

46. ROBERT, J.; MORALES, H.; BUCK, W.; COHEN, N.; MARR, S.; GANTRESS,
J. Adaptive immunity and histopathology in frog virus 3-infected Xenopus.
Virology, New York-NY, v. 332, n. 2, p. 667-675, 2005.
47. ROMALDE, J.; LORES, F.; MAGARIOS, B.; BARJA, J.; TORANZANO, A.
Study of cell surface associated virulence factors of Streptococcus parauberis
strains pathogenic for turbot. Bulletin of the European Association of Fish
Pathologists. The Netherlands, v. 20, n. 6, p. 244-251, 2000.
48. SAMBROOK, J.; FRITCSH, E.; MANIATIS, T. Molecular cloning: A
laboratory manual. 2. ed. New York: Cold Spring Harbor Laboratory, 1989. 3v.
3104p.
49. SHELBY, R.; KLESIUS, P.; SHOEMAKER, C.; EVANS, J. Passive and active
immunization of tilapia, Oreochromis niloticus (L.), with anti-Streptococcus iniae
whole sera. Journal of Fish Diseases. Oxford, v. 25, p. 1-6, 2002.
50. SHELBY, R.; SHOEMAKER, C.; KLESIUS, P. Detection of Streptococcus
iniae infection of Nile Tilapia, Oreochromis niloticus, by a monoclonal antibodybased ELISA. Journal of Applied Aquaculture. Binghamton-NY, v. 12, n. 3, p.
23-31, 2002.
51. SHOMAKER, C.; EVANS, J.; KLESIUS, P. Density and dose: factors affecting
mortality of infected tilapia (Oreochromis niloticus). Aquaculture. Amsterdam, v.
188, p. 229-235, 2000.
52. SHOEMAKER, C.; KLESIUS, P.; EVANS, J.. Prevalence of Streptococcus
iniae in tilapia, hybrid stripped bass and channel catfich on commercial fish farms
within the United States. American Journal of Veterinary Research. Chicago-IL,
v.62, n. 2, p. 174-177, 2001.
53. SPEARE, R. Summary of formidable infectious diseases of amphibians.
In: AMPHIBIAN DISEASE HOME PAGE. Webmaster SPEARE, R. School of
Public Health and Tropical Medicine, James Cook University, 2001
Disponvel em: http://www.jcu.edu.au/school/phtm/PHTM/frogs/formidable.htm.
Acesso em: 11 jan.2003.
54. TORANZO, A.; DEVESA, S.; ROMALDE, J.; LAMAS, J.; RIAZA, A.; LEIRO, J.;
BARJA, J. Efficay of intraperitoneal and immersion vaccination against
Enterococcus sp. infection in turbot. Aquaculture. Amsterdam, v. 134, n. 1, p. 1727, 1995.
55. WATSON, M. L. Staining of tissue sections for electron microscopy with heavy
metals. Journal of Biophysics, Biochemestry and Cytology, v. 4, p. 75-478,
1958.
56. WENG, S.; WANG, Y.; HE, J.; DENG, M.; LU, L.; GUAN, H.; LIU, Y.; CHAN, S.
Outbreaks of na iridovirus in red drum, Scianenops ocellata (L.), cultured in

78

southern China. Journal of Fish Diseases. Oxford, v. 25, n. 11, p. 681-685,


2002.
57. WOLF, K.; BULLOCK, G.; DUNBAR, C.; QUIMBY, M. Tadpole edema virus: a
viscerotropic pathogen for anuran amphibians. Journal of Infectious Diseases,
Chicago-IL, v. 118, n. 3, p.253-262,1968.
58. ZHANG, Q.; XIAO, F.; LI, Z.; GUI, J.; MAO, J.; CHINCHAR, V.
Characterization of an iridovirus from the cultured pig frog Rana grylio with lethal
syndrome. Diseases of Aquatic Organisms, Amelinghausen, v. 48, n. 1, p. 2736, 2001.
59. ZHANG, Q.; ZHE, Z.; XIAO, F.; LI, Z.; GUI, J. Molecular characterization of
three Rana grylio virus (RGV) isolates and Paralichthys olivaceus lymphocystis
disease virus (LCDV-C) in iridoviruses. Aquaculture, Amsterdam, v. 251, n. 1, p.
1-10, 2006

79

CAPITULO 4
QUADROS INFECCIOSOS EM RS DE CRIAO (Rana catesbeiana Shaw,
1802) NA FASE PS-METAMRFICA EM RANRIOS COMERCIAIS.
RESUMO
Doenas com alta mortalidade tm sido comuns em todos os ranrios. Apesar dos
numerosos trabalhos realizados, existe ainda desconhecimento dos agentes
etiolgicos envolvidos, e principalmente do papel dos vrus. Objetivou-se com o
presente trabalho realizar a caracterizao dos processos infecciosos em rs de
criao, dando nfase participao etiolgica dos ranavrus. Um ranrio
comercial do Estado de Gois foi utilizado para estudos clnicos e obteno de
amostras para anlises complementares que envolveram necropsia, anlises
histopatolgicas, microbiolgicas, moleculares e de microscopia eletrnica de
transmisso. Foram identificados quatro quadros diferentes, subclnico, super
agudo, agudo e crnico. No quadro subclnico os animais no apresentaram
sinais clnicos evidentes. Nos casos agudos predominaram sintomas inespecficos
como apatia, edemas e, s vezes, manifestaes nervosas. As leses atingiram
diversos rgos internos, com predominncia no fgado, rins e bao. Necrose,
degenerao e granulomas, associados presena de cocos Gram-positivos
constituram os achados de maior significncia na histopatologia. No quadro
crnico as rs apresentaram-se debilitadas e com sintomas nervosos evidentes.
As leses neste quadro se assemelharam quelas do quadro agudo, sendo mais
graves e incluindo, em todos os casos, alteraes no sistema nervoso central. Os
quadros observados foram identificados como septicemias estreptoccicas
secundrias. Foi descartado o papel dos vrus na produo dos sinais clnicas e
leses macro e microscpicas encontradas nesta fase da criao.
Palavras chave: Aqicultura, estreptococos, ranicultura, septicemias.

80

ABSTRACT
Disease outbreaks with high mortality have been frequent events in all frog farms.
In spite of several papers been published on this issue, there is still a lack of
knowledge about etiological agents involved, and mainly the role of virus in adult
frog diseases. The goal of this study was a primary characterization of farmed frog
diseases, stressing on the determination of an eventual viral etiology. Clinical
observations, as well as frog sampling for necropsy, histopathology, microbiology,
molecular studies and transmission electron microscopy were performed at a frog
farm from Gois State. Four different syndromes were identified: sub clinical,
super-acute, acute and chronic. The sub clinical syndrome showed no evident
disease signs. Both acute syndromes showed mainly non-specific symptoms like
apathy, edemas and nervous signs. Several internal organs were affected, mostly
liver, kidney and spleen. Most common histopathological findings were necrosis,
degeneration and granulomas, in association with Gram-positive. On the chronic
syndrome frogs were weak, with evident nervous symptoms. Lesions resemble
those found at the acute syndrome but with more severe pattern, including, in all
cases, central nervous system disorders. The disease was characterized as
secondary streptococcal septicemia. No viral role was detected in the disease.
Key words: Aquacultre, frog farming, septicemia, streptococci.

81

1 INTRODUO
A pesar de constituir uma das atividades mais novas dentro da
aqicultura mundial a criao de rs uma atividade em expanso em toda a
Amrica do Sul, especialmente no Brasil. A r touro (Rana catesbeiana Shaw,
1802) foi introduzida ao Brasil em 1935, mas as populaes atualmente criadas
foram originadas de 300 casais importados da Amrica do Norte em 1970
(MATHIAS & SCOTT 2004). Em decorrncia do clima favorvel, e da excelente
adaptao da espcie, assim como da tecnologia desenvolvida pelos produtores e
pesquisadores brasileiros, a ranicultura constitui uma atividade importante no
Brasil, particularmente no Estado de Gois. Dados referentes produo obtida
entre os anos 2000 e 2004 indicam que Gois ocupa o primeiro lugar no ranking
nacional com 150 toneladas anuais, das quais 90% destina-se exportao
(SILVA, 2005).
Com os avanos no conhecimento sobre manejo e alimentao, a
ranicultura transformou-se numa atividade intensiva, com altas densidades de
populao e estrita dependncia dos alimentos balanceados artificiais fatores que
produzem estresse e conseqentemente maior suscetibilidade a doenas de
diversas etiologias (ROTTMAN et al., 1992).
Sendo a ranicultura uma atividade nova, a experincia do estudo
cientfico com as doenas em rs de criao ainda incipiente. Diversos
trabalhos nas ltimas dcadas foram direcionados principalmente para a
identificao dos agentes envolvidos em surtos ou em episdios de mortalidade
maior que a esperada, seja na fase de girino ou adulta (AMBROSKY et al., 1983;
HIPLITO et al., 1987; GUIMARAES et al., 1988; HIPLITO et al., 1988a, b, c;
HIPLITO, 1995; FIORIO et al., 1997; HIPLITO, 1997; HIPLITO et al., 1997;
HIPLITO, 1999; HIPLITO, 2002; MAUEL et al., 2002; HIPLITO et al., 2003;
PASTERIS et al. 2006). Os diagnsticos concentraram-se exclusivamente na
identificao de agentes parasitrios e bacterianos, no sendo realizado
acompanhamento dos surtos, no intuito de estabelecer o papel etiolgico dos
agentes detectados e de outros aspectos das doenas que permitam a
elaborao de medidas de preveno ou controle. Segundo HIPLITO (2002), a

82

maioria dos trabalhos consistiram em comunicados efmeros, no tendo


continuidade no estudo do caso.
As septicemias tm sido reportadas como a causa mais importante de
mortalidade em anfbios, sendo freqente o achado de animais mortos sem sinais
prvios (CRAWSHAW, 1994). Porm, existe ainda um certo grau de incerteza em
relao s caractersticas desta infeco. Nos estudos e publicaes realizados
no perodo compreendido entre o final do sculo XIX e o ano 1995, a maioria dos
trabalhos de diagnstico identificou bactrias como responsveis pelos surtos.
Estes estudos incluram uma patologia denominada de perna vermelha ou red
leg, considerada como um complexo microbiolgico ou sndrome sendo apontada
como a doena de maior importncia em anfbios (RUSSEL, 1898; EMERSON &
NORRIS, 1905; KULP & BORDEN, 1942; MILES, 1950; REICHENBACH-KLINKE
& ELKAN, 1965; GIBBS et al., 1966; GLORIOSO et al., 1974; VAN DER WAAIJ et
al., 1974; COSGROVE, 1980; HIRD et al., 1981; NYMAN, 1986; VIZOTTO, 1988).
As pesquisas assinalando a importncia da sndrome da perna
vermelha ainda continuam na bibliografia mais recente (SOMSIRI, 1994; MAUEL
et al., 2002; HADFIELD et al., 2005; PASTERIS et al., 2006). Porm,
CUNNINGHAM et al. (1996), tm atribudo s bactrias papel secundrio, e
responsabilizado os vrus da famlia Iridoviridae, gnero Ranavirus como os
verdadeiros agentes etiolgicos.
As primeiras suspeitas do envolvimento de vrus pertencentes
Famlia Iridoviridae, gnero Ranavirus foram levantadas a partir de observaes
em ranrios do Uruguai (MAZZONI, 2000a, b; MAZZONI & CARNEVIA, 2000) e
confirmadas pelo trabalho de deteco por reao em cadeia da polimerase
(GALLI et al., 2006). HIPLITO et al. (2003) realizaram estudo empregando a
tcnica de microscopia eletrnica de transmisso e detectaram partculas virais
semelhantes aos grupos Herpesvrus, Togavrus e Paramixovrus em rs criadas
comercialmente no Brasil, mas no foram vinculadas a nenhuma doena.
Tambm no foram detectados no citado estudo, agentes da Famlia Iridoviridae.
Os vrus das rs, particularmente aqueles do gnero Ranavirus, tm
sido identificados tanto em doenas de anfbios na natureza, bem como em
cativeiro (ZUPANOVIC et al., 1998; DASZAK et al., 1999, 2000, 2003; CHINCHAR
& MAO, 2000; DASZAK et al., 2000; HYATT et al., 2000; ZHANG et al., 2001;

83

CHINCHAR, 2002; CULLEN & OWENS, 2002; GREEN et al., 2002; HE et al.,
2002; KIM et al., 2002; MARSH et al., 2002; WENG et al., 2002; DASZAK et al.,
2003; GANTRESS et al., 2003; JANCOVICH et al., 2003; GREER et al. 2005.
ROBERT et al., 2005; ZHANG et al., 2006). Porm existem dvidas em relao a
patogenicidade destes agentes em rs adultas da espcie Rana catesbeiana, pois
foram detectados tanto em anfbios sadios como em doentes (WOLF et al., 1968)
alm de ter sido detectados em outras espcies de anfbios (ZUPANOVIC et al.,
1998; ZHANG et al., 2001; GANTRESS et al., 2003, GREER et al. 2006).
Fato semelhante est ocorrendo com uma doena emergente
produzida pelo fungo Batrachochytrium dendrobatidis que tem sido implicada com
muita freqncia em surtos de mortalidade e reduo de populaes ao redor do
mundo (BERGER et al., 1998, 1999; DASZAK et al., 1999; LONGCORE et al.,
1999; SPEARE & BERGER, 2000; MAZZONI, 2000a, b; BERGER et al., 2002;
GUAYASAMIN

et

al.,

2002;

MAZZONI

et

al.,

2003;

SPEARE,

2003;

HANSELMANN et al., 2004; BLAUSTEIN & DOBSON, 2006). O fungo tem sido
identificado na Amrica do Sul, Equador (BERGER et al., 1999; RON & MERINO,
2000), Venezuela, (GUAYASAMIN et al., 2002; BONACCORSO et al., 2003;
HANSELMAN et al., 2004), Uruguai (MAZZONI, 2000a, b; MAZZONI et al., 2003),
Argentina (HERRERA et al., 2005) e Brasil (CARNAVAL et al., 2006). Apenas no
Uruguai, o diagnstico foi realizado em rs de criao da mesma espcie
cultivada no Brasil.

Esse fato reveste-se de grande interesse pois existe a

possibilidade do aparecimento da doena nas rs brasileiras.


Outros fungos pertencentes ao clado Mesomycetozoa tem sido tambm
implicados em doenas de anfbios na natureza (GREEN et al., 2002).
As dificuldades e a escassez de diagnsticos etiolgicos, o achado de
vrias espcies bacterianas em forma conjunta, geralmente todas elas
pertencentes flora normal, o desconhecimento do papel dos vrus, os quadros
clnicos inespecficos e como conseqncia, a falta de conhecimento acerca de
medidas profilticas e teraputicas apropriadas, levaram realizao do presente
trabalho.
Considerando a importncia adquirida pelos vrus do gnero Ranavirus
como agentes etiolgicos de doenas em anfbios, peixes e rpteis, props-se o
presente trabalho com o objetivo de realizar a caracterizao dos processos

84

infecciosos em rs de criao, dando nfase participao etiolgica dos


ranavrus. Para tanto, foram realizadas pesquisas dos agentes etiolgicos, a
epizootiologia das doenas, a sintomatologia clnica, a anatomia patolgica
macroscpica, a histopatologia, a bacteriologia convencional, e a virologia, sendo
esta por meio do emprego de tcnicas moleculares, cultura de clulas e a
microscopia eletrnica de transmisso.

85

2 MATERIAL E MTODOS
O presente estudo se refere a surtos de uma doena ocorridos durante
quatro anos consecutivos, de 2002 at 2005. Apesar da doena ter sido reportada
em quase todos os ranrios do Brasil, a descrio aqui apresentada baseou-se
fundamentalmente nas observaes realizadas em um ranrio localizado no
Municpio de Hidrolndia, Estado de Gois. Aloja constantemente um milho de
girinos e 400.000 rs. As rs, logo aps a metamorfose, foram confinadas em
baias de concreto de seis m2 localizadas em galpes fechados. Quando
alcanaram aproximadamente 50 g foram transferidas para novas baias de 12 m2.
Todas as baias possuam uma piscina de cinco cm de profundidade que ocupava
20% da superfcie total. A gua foi obtida a partir de uma represa de 20 hectares
alimentada por vrias nascentes. A represa possua uma variada populao de
peixes, bem como rpteis, outras espcies de anfbios e aves.
As rs foram alimentadas duas vezes por dia com rao artificial
extrusada contendo 45% de protena bruta. Somente as rs aps a metamorfose
receberam como complemento 5% de larvas de mosca domstica, produzida no
prprio ranrio, por um perodo de 21 dias para estimular o consumo da rao.
Outras prticas de manejo incluram a eliminao diria do alimento
mido no consumido e dos animais mortos. A gua das piscinas era
constantemente renovada, e drenada completamente uma vez ao dia, juntamente
com os sedimentos das fezes. A baia inteira era lavada pelo menos duas vezes
na semana. Periodicamente as rs eram submetidas a um processo de triagem
para manter os tamanhos uniformes e reduzir o canibalismo. A densidade foi
mantida na faixa de 150 rs por m2 durante a fase inicial, at diminuir para 40 por
m2 na etapa de terminao. Toda vez que uma baia era esvaziada, a gua era
drenada e realizava-se uma limpeza e desinfeco final com cloro.

2.1 Amostragem das rs


Os animais doentes utilizados no presente estudo originaram de um
ranrio localizado no Municpio de Hidrolndia. O grupo controle foi constitudo
por rs sem sintomas aparentes oriundas de ranrios localizados nos Estados do

86

Par, Gois, Maranho e Mato Grosso. Um total de 1155 rs doentes e 75 sadias


foram utilizadas no presente estudo.
Os exemplares machos e fmeas foram distribudos em trs categorias
de 410 anfbios cada: 1) Rs ps-metamorfose; 2) Rs jovens, de 20 at 80 g; e
3) Rs adultas. Foram selecionadas preferencialmente rs nos estgios iniciais do
processo infeccioso, exceo das rs que apresentaram quadro crnico.
Animais mortos no foram utilizados para evitar erros induzidos pelas alteraes
ps-mortem,

principalmente

em

relao

aos

resultados

das

anlises

microbiolgicas, segundo recomendaes do NACE (1974).


As rs foram sacrificadas mediante o emprego de clorofrmio
(SPEARE, 1989) ou insensibilizadas por concusso craniana e sacrificadas por
meio de corte da medula cervical (AVMA, 1993).

2.2 Microbiologia
Uma vez sacrificados os exemplares foram submersos em soluo de
cido peractico a 0,2%. Aps abertura da pele e da cavidade celmica, fgado,
rins, bao, pulmes, corao e crebro foram extrados assepticamente. As
amostras foram processadas imediatamente no laboratrio de bacteriologia do
Centro de Pesquisa em Alimentos da Escola de Veterinria da Universidade
Federal de Gois, sendo inoculadas em caldos BHI (Brain Heart Infussion Broth),
Casoy (Tripticase Soy Broth), Glicose Azide e Selenito-Cistina, segundo os
mtodos rotineiros (BRASIL, 2003). Todas as amostras foram incubadas a 30C
por 24-72 h. O perodo de 72 horas deveu-se ao crescimento lento de alguns
estreptococos, e procurou-se de esta forma propiciar um tempo suficiente para o
desenvolvimento, evitando a ocorrncia de falsos negativos. Assim que foi
observado crescimento bacteriano foram semeadas alquotas em placas de gar
sangue contendo 5% de sangue desfibrinado de carneiro, e incubadas a 30C,
determinando-se as caractersticas hemolticas e morfologia das colnias-UFC.
As UFC isoladas, com diferente morfologia, foram selecionadas para colorao de
Gram, observao em microscpio de contraste de fase, e identificao mediante
provas bioqumicas complementares. Os cocos Gram-positivos foram estudados
mediante

provas

bioqumicas

complementares.

As

UFC

identificadas

primariamente pela bioqumica como estreptococos, foram enviadas para

87

determinao da espcie ao Aquatic Animal Health Research Laboratory em


Auburn - Alabama, nos Estados Unidos. As culturas foram processadas pelo
mtodo de Identificao de cidos graxos da membrana, FAME (Fatty Acid Methyl
Ester).
Os bastonetes Gram-negativos foram incubados em placas de gar
McConkey e as UFC selecionadas inoculadas em tubos de TSI (Triple Sugar Iron
Agar) para finalmente serem submetidas bateria de testes bioqumicos para
identificao da espcie (BRASIL, 2003).
Amostras de gua e da rao foram analisadas periodicamente por
tcnicas microbiolgicas convencionais para determinao de contaminao fecal
(BRASIL,

2003)

presena

de

cocos

Gram-positivos

como

descrito

anteriormente.

2.3 Histopatologia
Fragmentos de fgado, rins, bao, estomago, pulmes, corao e
crebro foram extrados e preservados em formol tamponado a 10% (vol-vol) e
processados segundo a rotina de estudos de histopatologia no laboratrio de
Histopatologia do Hospital das Clnicas da Universidade Federal de Gois,
utilizando as tcnicas propostas por LUNA (1968). Os blocos parafinados foram
secionados em cortes de 4-5 e corados com hematoxilina-eosina (H&E) para as
avaliaes primrias das leses. Adicionalmente, os cortes selecionados foram
tambm corados pelo mtodo de Gram para visualizao de bactrias em geral,
pelo mtodo de Fite para deteco de micobacterias e colorao de PAS para
visualizao de fungos.

2.4 Reao em cadeia da polimerase (PCR)


Fragmentos de fgado, rim, bao e msculo foram preservados em
etanol a 95% ou congelados a -20C at processamento no laboratrio de
Biologia Molecular do Centro de Pesquisa em Alimentos da Escola de Veterinria
da Universidade Federal de Gois. A extrao do DNA foi realizada a partir de
pores de 50 mg utilizando o mtodo do fenol/clorofrmio (SAMBROOK et al.,
1989). Foram utilizados iniciadores direcionados a regies conservadas no
genoma dos iridovrus (Quadro 1). Para o gene que codifica a protena imediata

88

precoce (IE) ICP-18 utilizaram-se iniciadores propostos por GALLI et al. (2006), e
para o gene que codifica a protena MCP foram utilizados iniciadores localizados
nas extremidades 5e 3 da seqncia de FV3 (TAN et al., 2004) sendo que o
iniciador forward original do presente trabalho e o reverse j utilizado por
HYATT et al. (2000) segundo apresentado no Quadro 1.

QUADRO 1 Iniciadores utilizados para amplificao parcial do genoma de


ranavirus, bp indica o comprimento do amplicon.
Nome

Forward

Reverse

Produto
(bp)

MCP

ATGTCTTCTGTAACTGGTTCA

AAAGACCCGTTTTGCAGCAAAC (1)

ATGATCCAAGCCTACCTGTGC (2)

AAATGTCCTAATCTATACACC (2)

1483

IE
479

(2) HYATT et al. (2000); (2) GALLI et al. (2006).

O mix utilizado para a amplificao com os diferentes iniciadores


constitua-se de 2,5 L 10x tampo de PCR [Tris-HCl 20 mM (pH 8.4), KCl 50
mM], dNTP 200 M, 2,5 mM MgCl2, 2.5 M de cada iniciador, 1 U de Taq DNA
Polymerase, 5 L de DNA template e gua MilliQ at completar 50 L para cada
reao. Os produtos de amplificao foram submetidos a corrida em gel de
agarose a 1%, corados com brometo de etdeo 0.5 g/mL e visualizados em
transiluminador de luz UV.
Foram tambm utilizados iniciadores direcionados identificao da
bactria Streptococcus iniae aplicando a metodologia de PCR proposta por
BERRIDGE et al. (1998). Os cocos Gram-positivos, independentemente do
gnero foram purificados, sendo o DNA extrado pela metodologia do
fenol/clorofrmio (SAMBROOK et al., 1989).

89

2.5 Microscopia eletrnica de transmisso


As amostras foram processadas no laboratrio de Microscopia
Eletrnica do Instituto Biolgico de So Paulo. O material analisado foi
selecionado a partir de leses identificadas nas lminas da histopatologia. Uma
vez delimitada a regio suspeita, a mesma foi localizada no bloco parafinado e
realizado corte de aproximadamente 1 mm de dimetro. O fragmento extrado foi
desparafinado, reidratado e finalmente processado pela tcnica de incluso em
resina, seguida de contrastao positiva de cortes ultrafinos de acordo com os
procedimentos usuais de incluso em resina, baseando-se nos mtodos de LUFT,
(1961) e GONZALES-SANTANDER, (1969). Quando utilizamos esta tcnica, os
fragmentos de rgos so fixados em glutaraldedo a 2,5% em tampo fosfato
0,1M e pH 7,0, ps-fixados em tetrxido de smio a 2% em tampo fosfato 0,2M,
pH 7,0, corados por acetato de uranila a 0,5%, desidratados em srie cetnica
crescente (50 a 100%) e includos em resina Spurr. Aps ultra seccionamento dos
blocos, os cortes ultrafinos obtidos foram corados positivamente pelo tratamento
seqencial de acetato de uranila (WATSON, 1958) e citrato de chumbo
(REINOLDS, 1963), antes de serem observados ao microscpio eletrnico de
transmisso Philips EM 208.

2.6 Protenas sricas totais


Visando avaliao primria das funes heptica e renal foi realizado
um estudo eletrofortico das protenas totais no soro das rs, comparando 30
exemplares para cada um dos quadros clnicos observados: rs sadias, rs na
fase aguda dos sintomas e rs na fase crnica. O sangue foi coletado diretamente
do corao, deixando-o coagular a temperatura ambiente dentro da seringa. As
seringas foram acondicionadas em caixa de material isotrmico contendo gelo e
transportadas ao laboratrio. Extraiu-se o soro e centrifugou-se a 5000 rpm por 15
minutos. O sobrenadante foi retirado e congelado a 20C at o uso. Fez-se a
eletroforese em SDS-PAGE, pelo mtodo de LAEMILLI (1970).
2.7 Pesquisa do fungo Batrachochytrium dendrobatidis
A pele das rs foi amostrada realizando-se raspagens nas regies
ventrais do abdmen e dos membros posteriores com bisturi esterilizado. O

90

material obtido foi colocado sobre uma lmina de vidro, corado com uma mistura
de KOH 10% e azul de algodo em propores de 50:50 (vol-vol) e coberto por
lamnula para observao em microscpio ptico, segundo descrio de
MAZZONI et al. (2003).

2.8 Reproduo da Doena


No intuito de comprovar a patogenicidade primria dos agentes
isolados, culturas puras obtidas dos animais doentes foram inoculadas em rs
aparentemente sadias. UFC com, no mximo dois repiques no laboratrio foram
diludas segundo a escala de Mac Farland em concentraes crescentes de 103
at 1010 UFC por mL e inoculadas nas rs por via intra peritoneal. Nove grupos de
30 rs sadias, de igual peso e idade, foram colocados em baias separadas para
cada teste realizado. Oito grupos receberam cada um deles um inoculo de 1.0 mL
da concentrao correspondente de bactrias, e o nono grupo 1.0 mL de soluo
salina tamponada (PBS). O mesmo procedimento foi realizado utilizando uma
mistura de todas as bactrias isoladas, testando-se desta forma a possibilidade
de uma ao conjunta dos agentes envolvidos.
Macerados de rgos obtidos de rs com sintomatologia aguda foram
tambm aplicados pela via intraperitoneal nos exemplares do experimento
visando observar os resultados da aplicao conjunta dos diversos agentes
envolvidos. Os testes foram realizados a partir de fgado, rins e crebro. Os
tecidos foram macerados, diludos em PBS e 1 mL do sobrenadante foi inoculado
em cada r. Nesse caso, grupos de 10 animais sadios foram utilizados, bem como
um grupo controle inoculado com PBS.

91

3 RESULTADOS
Observou-se

existncia

de

quatro

diferentes

formas

de

apresentao do processo infeccioso. A primeira, inaparente ou subclnica, onde


os sinais clnicos no so evidentes, mas em nvel microscpico foram detectadas
leses moderadas acompanhadas da presena de cocos Gram-positivos. A
segunda, super aguda, que lembra a sndrome de choque txico ou choque
sptico. A terceira, aguda, com sintomatologia inespecfica, decorrente de leses
de tipo necrtico-degenerativas, associadas a presena de cocos Gram-positivos
e septicemia. A quarta, crnica, onde os animais apresentaram-se caqucticos e
predominaram os sinais nervosos.
No foram observadas diferenas entre as trs categorias de rs
que justificasse a descrio em separado do processo infeccioso. Nesse contexto,
so apresentados os resultados relevantes obtidos para cada uma das quatro
formas de apresentao da infeco.

3.1 Epizootiologa
A enfermidade pode aparecer repentinamente na forma aguda
espalhando-se pelo criatrio inteiro ou permanecer na forma latente, com baixa
morbidade e mortalidade, podendo aumentar a severidade ao longo do ano.
Merece destaque o fato de que durante o perodo mais frio a morbidade e a
mortalidade foram menores, mas quando a temperatura voltou a subir, a doena
recrudesceu.

A doena acometeu rs em todas as fases, desde a ps-

metamorfose at animais no ponto de abate. Observou-se que as rs afetadas


geralmente apresentavam boas condies de desenvolvimento.

3.2 Sinais Clnicos


Os sinais clnicos de doena septicmica em rs de criao podem ser
considerados pouco especficos e evidenciam-se pouco tempo antes da morte.
Porm, existe reduzido nmero de rs que consegue sobreviver, mas permanece
com sintomas crnicos de tipo neurolgico. Foram caracterizadas trs formas
clnicas diferentes.

92

3.2.1 Forma sub-clnica ou inaparente


Os animais permaneceram sem sinais aparentes da doena e com
comportamento normal (Figura 1A) at os momentos que antecederam a morte.
Um percentual varivel de rs no evidenciou sinais da doena alcanando a fase
de abate ou tornando-se reprodutor.
3.2.2 Forma aguda
Nas baias afetadas observou-se um padro definido de rs com
sintomas da doena e animais mortos. No foram evidenciados sinais prvios que
pudessem indicar que uma determinada r estivesse doente.
Os sinais clnicos incluram: modificaes da postura normal,
depresso, diminuio da reao aos estmulos externos (Figura 1B), edemas,
ascite, bem como pulmes insuflados que assemelham ao aspecto de balo,
responsveis pelo aumento da presso interna que pode provocar prolapso retal
(Figura 1C), sintomas nervosos de incordenao, natao errtica e diversos
graus de curvatura da coluna vertebral o que leva ao desvio da cabea para um
dos lados (Figura 1D).
Em alguns casos, a alta mortalidade dizimou, em curto perodo de
tempo, 90% das rs. Nas rs que morreram observou-se perda de movimentos,
postura de cabea baixa, seguida por estado tipo comatoso, ou convulsivo e
quadro tetnico caracterizado pelos membros estendidos. Eventualmente
observou-se vmito sanguinolento no momento da morte acompanhado de um
som forte e agudo. No foram observadas hemorragias na pele nem ulceraes.
Quando as rs foram colhidas imediatamente aps a morte, no se observou
nenhuma colorao vermelha na pele. Evidenciou-se a caracterstica aguda ou
super aguda do aparecimento dos sinais e, conseqentemente, o bito dos
animais que podia acontecer em um curto perodo de tempo. Notou-se
necropsia que as rs se alimentavam at o aparecimento dos sinais clnicos. O
quadro fatal assemelhou-se s descries realizadas para o choque sptico em
outras espcies animais incluindo o homem.

93

3.2.3 Forma crnica


Entre 0,1 a 0,5% da populao desenvolveu um quadro crnico
caracterizado clinicamente pelas seqelas nervosas.

Foram achados comuns

nestes animais a falta de coordenao, posturas anormais como lordose e


diversos graus de escoliose levando ao desvio da cabea para um dos lados
indistintamente. Alguns deles tinham dificuldades para manterem-se na posio
normal, nadar ou pular. Algumas rs, apesar dos sintomas assinalados
conseguiam se alimentar e continuavam crescendo lentamente. Poucas
recuperavam a condio normal sem algum tipo de tratamento.

FIGURA - 1

(A) R sadia em posio normal. (B) R com sintomas iniciais


da doena. Posio anormal do corpo com a cabea voltada
para baixo, apatia e falta de reao aos estmulos externos.
(C) R com sintomatologia aguda, pulmes insuflados, com
aumento da presso interna e prolapso retal. (D) R com
sintomas nervosos de incordenao e postura anormal com
nado errtico.

94

3.3 Achados de necropsia


3.3.1 Rs sadias
Diversos

graus

de

alterao

heptica

foram

observados,

principalmente aumento de tamanho associado a coloraes anormais, sendo as


mais comuns as amareladas ou em noz-moscada.
3.3.2 Rs sem sintomas, forma sub-clnica ou inaparente
Os animais sem sintomas aparentes exibiam diversos graus de leso
tissular,

independentemente

da

idade,

incluindo

rs

recentemente

metamorfoseadas. Macroscopicamente, os rgos mais afetados na observao


foram fgado, rins e bao. O fgado mostrou diversos graus de pigmentao
anormal, desde coloraes pardo escuras a quase preto, bem como tons
acinzentados ou amarelados. O bao mostrou-se aumentado de tamanho e s
vezes de cor pardo-escura. Os rins apresentaram-se congestos ou hemorrgicos.
3.3.3 Forma aguda
Nas rs doentes observou-se diversos graus de leso nos rgos internos,
mas sem um padro definido. As alteraes mais freqentes foram o aumento do
tamanho do fgado alm de colorao anormal, geralmente acinzentada ou
amarelada, bao com aumento de tamanho e colorao pardo-escura, e rins
hemorrgicos. s vezes, pequenos ndulos esbranquiados foram observados na
superfcie do fgado e bao e corao. Algumas rs tinham os pulmes insuflados,
cheios de ar, o que proporcionava ao corpo o aspecto de balo, levando ao
aumento da presso interna e ao prolapso retal. necropsia, observaram-se
algumas rs com pulmes fortemente hemorrgicos e grau varivel de ascite com
exsudato sero-hemorrgico. A maioria dos animais apresentou o tubo digestivo
contendo alimento, incluindo o estomago e o duodeno. O corpo adiposo
apresentava caractersticas normais.

95

3.3.4 Forma crnica


Esta foi a nica fase da doena na qual as rs apresentaram perda de
peso de moderada a intensa. O fgado mostrou-se s vezes plido ou muito
escuro, o bao exibia aumento de volume e os rins apresentavam-se
hemorrgicos. Os corpos adiposos exibiam menor tamanho que aqueles das rs
sadias e das rs com sndrome aguda.

3.4 Histopatologia
3.4.1 Forma subclnica ou inaparente
Rs sem sinais aparentes da doena revelaram diversos graus de
leso nos estudos histolgicos, independentemente da idade. Os principais
rgos afetados foram o rim e o fgado. Enquanto o fgado mostrou diversos
graus de esteatose e uma quantidade varivel de granulomas em suas fases
iniciais (Figura 2), os rins apresentaram infiltrao mononuclear abundante e
alguns tbulos esclerosados. A colorao de Gram aplicada aos cortes revelou a
presena de cocos Gram-positivos (Figura 2).
3.4.2 Forma aguda
Um quadro de leses septicmicas foi constatado na maioria das rs
estudadas. Fgado, rins, bao, corao, pulmes e crebro foram afetados em
grau varivel de severidade. Uma resposta inflamatria focal mltipla e
granulomas bacterianos foram observados distribudos no parnquima dos
diversos rgos e nas serosas das vsceras. reas de necrose associadas
presena de macrfagos e uma grande infiltrao linfocitria foram identificadas
na maioria dos tecidos (Figura 3). O nmero de focos de melanomacrfagos
distribudos no fgado foi muito reduzido e, s vezes, ausente por completo.
Macrfagos, contendo em seu interior cocos fagocitados, constituiu um achado
comum no parnquima do fgado, e notou-se forte relao entre esta resposta e o
aparecimento dos granulomas. Estes mostraram regies necrticas rodeadas por
macrfagos e fibroblastos (Figura 3). A esteatose hepatocitria com perda da
estrutura normal do tecido associada a necrose foi outro achado comum. As

96

leses hepticas foram de maior gravidade na regio centrolobular do que na


regio periportal.
Os rins sempre foram muito afetados, apresentaram infiltrao
mononuclear, necrose glomerular e tubular, congesto e granulomas. Foram
observados

glomrulos

com

espessamento

da

membrana

basal,

desaparecimento das alas, retrao, atrofia e esclerose. Foi possvel observar o


depsito de material hialino nos glomrulos e abundantes cilindros hialinos nos
tbulos (Figura 3). O tipo de leso pde ser qualificada como glomerulonefrite
membranoproliferativa evoluindo para esclerose e insuficincia renal com
sndrome nefrtica. Todas as rs estudadas apresentaram mineralizao tubular
multifocal. Estomago e intestino no apresentaram leses.
A maioria das rs estudadas mostrou grau varivel de congesto no
epicrdio com hemorragias e infiltrao de macrfagos mononucleares e linfcitos
(Figura 3). Em alguns coraes estudados observaram-se granulomas com o
mesmo padro histolgico j assinalado. O bao apresentou grau varivel de
congesto, hiperplasia linfoctica inespecfica, granulomas e necrose (Figura 3).
Os pulmes revelaram diversos graus de infiltrao mononuclear, congesto e
hemorragias.
O estudo dos cortes histolgicos corados pelo Gram revelou a
presena de cocos Gram-positivos, em grau varivel, associados s leses
observadas na colorao H&E (Figura 3). As coloraes de PAS e Fite foram
negativas para a presena de fungos e micobacterias, respectivamente. Tambm
no foram identificados nos tecidos estudados corpsculos de incluso viral.

97

FIGURA 2 (A) Fgado de r sem sintomas, com alterao da estrutura


trabecular e infiltrao focal (setas) formada por leuccitos
mononucleares. Estes aglomerados constituem a fase inicial dos
granulomas. H&E 200x. (B) Corte de rim de r sadia. Colorao de
Gram. So observados cocos gram-positivos colonizando a regio
dos tbulos proximais, 1000x. (C) Fgado com degenerao
gordurosa, predominantemente na regio centro lobular. H&E,
100x. (D) Rim de r sem sintomas apresentando forte infiltrado
mononuclear e zonas de necrose. H&E, 200x.

98

C
C

FIGURA 3 (A) Fgado de r na fase aguda da doena mostrando abundante


necrose e degenerao dos hepatcitos. Nota-se forte infiltrao
inflamatria predominantemente por mononucleares e formao de
um granuloma (seta). H&E 400x. (B) Rim de r na fase aguda com
necrose e degenerao glomerular (setas), e infiltrado
mononuclear. Observa-se material hialino nos tbulos proximais.
H&E 100x.) (C) Glomrulode r com sinais agudas, notam-se
abundantes cocos Gram-positivos (setas). Colorao de Gram,
1000x. (D) Corao de r na fase aguda mostrando epicardio com
forte infiltrado mononuclear e formao de granuloma (seta). H&E
400x. (E) Bao de r na fase aguda com reas de necrose e
formao de granulomas (seta), H&E, 200x. (F) Infiltrado
inflamatrio mononuclear e hemorragia nas meninges de rs na
fase crnica com sintomas nervosos. H&E, 200x.

99

3.4.3 Forma crnica


Os achados histopatolgicos nestas rs lembraram aqueles descritos
para o quadro agudo, mas com maior gravidade.

Em particular o estudo do

sistema nervoso central mostrou diversos graus de infiltrao mononuclear nas


meninges com formao de granulomas (Figura 3). O encfalo foi tambm
afetado em algumas rs, apresentando o mesmo infiltrado inflamatrio e formao
de granulomas. Na colorao de Gram realizada nas seces de tecidos,
evidenciou-se a presena de cocos Gram-positivos. As coloraes de PAS e Fite
foram negativas.

3.5 Microbiologia
Verificou-se que 90% das rs estudadas foram positivas para cocos
Gram-positivos; 50% para Edwarsiella tarda e Escherichia coli.; 40% para
Citrobacter spp.; 25% para Pseudomonas spp. e Proteus spp; e menos de 10%
para Aeromonas hydrophyla, sempre associada a outros microorganismos. Dentre
os cocos, foram isolados principalmente Streptococcus uberis, S. agalactie, S.
faecalis, S. dysgalactiae e Enterococcus spp.
A anlise das amostras de rao e da gua de abastecimento do
ranrio

no

revelaram

contaminao

por

Streptococcus.

As

condies

microbiolgicas da gua eram compatveis com os valores aceitados para o uso


em aqicultura.

3.6 Reao em cadeia da polimerase (PCR)


Nas rs estudadas, a pesquisa de ranavirus e S. iniae foi sempre
negativa.

3.7 Microscopia eletrnica de transmisso


No foram encontradas incluses tpicas de vrus e nem a presena de
partculas virais, nas amostras estudadas.

3.8 SDS page das protenas sricas totais


Estudos de eletroforese de protenas sanguneas revelaram grande
depleo nos animais doentes quando comparados com aqueles sadios. O valor

100

mdio encontrado para rs sadias foi de 2,56 g/dL, para rs na fase aguda da
doena foi de 0,725 g/dL, e 1,24 g/dL para animais na fase crnica.

3.9 Pesquisa do fungo Batrachochytrium dendrobatidis


Os resultados da pesquisa para fungos produtores da chytridiomicose
foram negativos em todos os casos estudados.

3.10 Reproduo da doena


No foi possvel realizar a reproduo da doena em animais sadios
com nenhuma das doses utilizadas, seja de bactrias puras ou em cultura mista.
Tambm no foi possvel reproduzir a doena injetando macerados de rgos de
rs doentes com sintomatologia aguda.

101

DISCUSSO E CONCLUSES
Os resultados obtidos confirmaram que nos ranrios comerciais de

Gois existe uma doena severa, com alta morbidade e mortalidade que
acarretam significativos danos econmicos. Epizootiologicamente h maior
prevalncia nas pocas de temperaturas mais elevadas, sendo acometidas rs
em todas as fases do ciclo produtivo, principalmente animais em bom estado
geral.
A sintomatologia foi inespecfica, cursando de forma subclnica,
super aguda, aguda ou crnica. No quadro subclnico, os animais no
apresentaram sintomas evidentes. Nos casos agudos, as rs morriam
rapidamente sem evidenciar sinais prvios ou se apresentaram letrgicas,
ascticas ou edematosas. s vezes tambm eram evidentes sintomas nervosos.
Um quadro especfico super agudo

e fatal assemelhou-se s descries

realizadas para o choque sptico em outras espcies animais incluindo o homem.


(SALLES et al., 1999; MULLER-ALOUF et al., 2001).Algumas rs evoluiram para
quadro

nervoso

de

carter

crnico

caracterizado

por

leses

severas

disseminadas, acometendo inclusive o sistema nervoso central, as quais eram


responsveis pela sintomatologia apresentada, ficando os animais debilitados e
caquticos. necropsia e histopatologia, notava-se que as leses predominaram
no fgado e nos rins. O quadro inicial de tipo necrtico-degenerativo, evoluindo
para infiltraes por linfcitos mononucleares e formao de granulomas. Estas
leses apresentam-se associadas presena de bactrias, principalmente cocos
Gram-positivos.
Surtos de doenas com alta mortalidade tm sido comuns em todos
os ranrios. A presena de cocos Gram-positivos atuando isoladamente ou
combinados com outras bactrias, tem sido observada em doenas septicmicas
nas rs de criao e anfbios na natureza.
GLORIOSO et al. (1974) obtiveram resultados semelhantes aos do
presente trabalho ao analisarem bacteriologicamente amostras de rs touro nos
Estados Unidos. Os autores assinalaram que nessas rs foram isoladas de cada
indivduo entre duas e oito espcies diferentes de bactrias, no existindo padro
definido nessas combinaes. Tambm no foi isolado microrganismo em cultura

102

pura. Fungos e vrus no foram isolados. Verifica-se, portanto, que existe


concordncia entre estes achados e os resultados do presente trabalho.
AMBROSKY et al. (1983) descreveram um surto de mortalidade em rs
de criao, por Streptococcus spp beta hemolticos em R. catesbeiana do Estado
de Par, com epizootiologia e sintomas clnicos coincidentes com as observaes
deste trabalho. As principais leses reportadas pelos autores foram a presena
de septicemia, hepatite e esplenite necrotizante com hemorragias em ambos
rgos. Os autores tambm isolaram a bactria do bao de rs sadias,
confirmando a hiptese de que os germes podem coabitar rgos do animal sem
produzir sinais evidentes de doena. A pesquisa de agentes virais tambm
revelou resultados negativos. Os autores relacionaram o surto a fatores de
estresse e densidade elevada que, associados s bactrias, determinaram a
morte das rs.
GUIMARAES et al. (1988) relataram quadros de infeces produzidas
em R. catesbeiana dos Estados de Gois e Par, nos quais a mortalidade atingiu
80% da populao em epizootias semelhantes aquelas do presente estudo.
Foram isoladas diversas bactrias, incluindo Edwarsiella tarda, Proteus vulgaris,
Staphylococcus epidermidis e Streptococcus spp, a partir de amostras de fgado,
bao, rins, lquido peritoneal e ovrios, com os estreptococos apresentando maior
freqncia. Os autores atriburam o quadro ao estresse produzido por diversos
fatores combinados, mas no determinaram a natureza ou origem da citada
epizootia.
HIPLITO et al. (1988, 1997) isolaram Streptococcus spp do sistema
nervoso central em R. catesbeiana e descreveram leses neurolgicas.
HIPLITO (1995, 1997, 1999) cita os estreptococos entre os agentes causais de
mortalidade em rs de cativeiro. FIORIO et al. (1997) relacionaram bactrias do
gnero Streptococcus com mortalidade de r touro associada a solues de
continuidade na pele. MAZZONI (2000a, b) incriminou os Streptococcus spp
isolados de R. catesbeiana de ranrios comerciais do Uruguai como responsveis
pelos sinais nervosos e edemas.
MAUEL

et

al

(2002)

estudaram

um

surto

com

semelhantes

caractersticas em R. catesbeiana de ranrio do Estado da Gergia nos Estados


Unidos

identificaram

os

seguintes

microrganismos:

A.

hydrophila,

103

Chryseobacterium meningosepticum, Chryseobacterium indolgenes, Edwarsiella


tarda, Citrobacter freundii, Pseudomonas spp., e Streptococcus iniae. PASTERIS
et al. (2006), estudando doenas em rs de criao (R. catesbeiana) da
Argentina, relataram a presena de Proteus vulgaris, Enterococcus faecalis, E.
faecium, Staphylococcus aureus, e leveduras. Sendo que nestes estudos, os
autores no realizaram a pesquisa de ranavrus ou chytrdeos, porm, a
identificao simultnea de diversos microrganismos so concordantes com as
observaes da nossa pesquisa.
Todos os autores (AMBROSKY et al., 1983; GUIMARAES et al., 1988;
HIPLITO et al., 1988; HIPLITO, 1995; FIORIO et al., 1997; HIPLITO, 1997;
HIPLITO et al., 1997, 1999; MAZZONI, 2000a, b; MAUEL et al., 2002;
PASTERIS et al., 2006), foram unnimes em indicar os estreptococos como
agentes envolvidos em processos infecciosos, corroborando com os resultados
obtidos neste estudo. A anlise desses achados sugere maior suscetibilidade das
rs para estes microrganismos, que por sua vez, so habitantes naturais do
ambiente.
Os estreptococos tm sido incriminados freqentemente como
produtores de doenas em organismos aquticos. O quadro de leso
estreptoccica descrita no presente trabalho coincide com aquele observado em
criaes de diversas espcies (ELDAR et al., 1994, 1995; TORANZO et al., 1995;
CHANG & PLUMB, 1996; ELDAR & GHITTINO, 1999; EVANS et al., 2000;
KLESIUS et al., 2000; ROMALDE et al., 2000; SHOEMAKER et al., 2000, 2001;
CHANG et al., 2002; COLORN et al., 2002; SHELBY et al., 2002a, b;
DUREMDEZ, 2004; KVITT & COLORN, 2004).
BERCOVIER et al. (1997) e ELDAR et al., (1997) descreveram a
infeco estreptoccica como uma entidade mrbida produzida por bactrias dos
gneros Streptococcus, Lactococcus, Enterococcus e Vagococcus. Sugeriram
que a estreptococose nos peixes deve ser considerada como um complexo de
doenas semelhantes produzidas por diferentes gneros e espcies de cocos
Gram-positivos, que originam uma sndrome particular. Segundo aqueles autores,
nas estreptococoses dos peixes, as medidas teraputicas tradicionais so
geralmente ineficazes, pois a ao dos antibiticos de curta durao, sendo
necessria repetio dos tratamentos. BERCOVIER et al. (1997); ELDAR et al.

104

(1997); KLESIUS et al. (2000); SHELBY et al. (2002a) estabeleceram que as


vacinas autgenas constituem a nica medida aplicada com sucesso. Estas
observaes coincidem com os resultados obtidos na aplicao de medidas
teraputicas

pelos

ranicultores

durante o curso da doena. Assim, a

administrao de antibitico do grupo das penicilinas foi acompanhada da


diminuio imediata nos ndices de morbidade e mortalidade, mas uma semana
aps a suspenso da medicao, a enfermidade retomou os nveis iniciais.
Apesar das semelhanas entre a estreptococose dos peixes e a
doena em rs, torna-se importante assinalar que nos anfbios no foi possvel
reproduzir os sintomas da enfermidade por meio da inoculao das bactrias
isoladas, bem como o uso de vacinas no mostrou eficincia na preveno ou
controle da doena (dados no apresentados).
No foi possvel, nas condies deste estudo, determinar a causa
primria que antecede a invaso dos tecidos pelos estreptococos. A ao dos
ranavrus nas etapas iniciais dos girinos (MAZZONI et al., dados no publicados)
pode ter sido fator desencadeante, atuando isoladamente ou associado a fatores
ambientais relacionados ao manejo e, principalmente, a uma alimentao no
balanceada.
Tem sido discutido entre os ranicultores e tcnicos envolvidos na
pesquisa do setor, a qualidade das raes oferecidas s rs. O elevado contedo
em carboidratos e protenas nestes alimentos pode, sem dvidas, constituir-se na
origem de alteraes que levam degenerao gordurosa do fgado,
impedimento ou diminuio de suas funes metablicas, e sobrecarga dos rins
que acabam sendo lesados (CARNEVIA & MAZZONI, 1988; HIPLITO, 2001). As
causas da degenerao gordurosa heptica citadas na bibliografia referem tanto a
excessos de gordura no alimento como a carncias dos aminocidos colina e
metionina na alimentao (KING & ALROY, 2000). A sintomatologia predominante
de edemas e ascites associada presena de leses importantes nos rins e
fgado esto em concordncia com esta doena. A sndrome hepato-renal
descrita,

detalhadamente,

na

bibliografia

cientfica

em

outras

espcies,

fundamentalmente no homem (ROBBINS et al., 1996; GUINS, 2001). De igual


forma, os sintomas nervosos observados freqentemente na fase aguda da
doena, podem ter origem no quadro de encefalopatia heptica (COTRAN, 1994),

105

no qual as toxinas no eliminadas pelo fgado chegam ao sistema nervoso


central, lesando-o e originando sinais semelhantes aos descritos neste trabalho.
Os resultados da anlise das protenas totais do soro indicam, em
geral, baixa concentrao plasmtica, quando comparados com os obtidos por
COPPO (2003) em rs de criao (R. catesbeiana) na Argentina. Este autor
encontrou valores mdios de 4,34 g/dL, quase o dobro do verificado no presente
estudo para rs sadias. Isto pode ser atribudo leso do fgado e rins dessas
rs, constatada na histopatologia. Este tipo de leso provoca diminuio da
funo heptica bem como perda de protenas pelo rim, constituindo a causa dos
baixos valores encontrados. A grande diferena entre os valores obtidos para rs
que no apresentam sintomas da doena e rs que apresentam o quadro agudo
revela o severo comprometimento metablico destas ltimas, e corrobora com os
achados na histopatologia e as observaes clnicas de edemas e ascites.
No foi possvel fazer associao dos ranavirus com a doena
estudada. Os resultados no PCR foram sempre negativos e as leses na
histopatologia foram diferentes daquelas descritas para estes agentes. Apesar
dos rgos mais afetados serem os mesmos acometidos pelos vrus, a leso
predominante foi a necrose e degenerao, com infiltrao mononuclear e
formao de granulomas. No foram observadas leses de picnose e cariorexia,
nem as hemorragias na maioria dos rgos, mencionadas nas infeces por
iridovrus (WOLF et al., 1968; CUNNINGHAM et al., 1996; ZHANG et al., 2001)
nem a leso predominante nos tbulos proximais (ROBERT et al., 2005).
WOLF et al. (1968) trabalhando com R. catesbeiana nos Estados
Unidos, isolaram um vrus polidrico citoplasmtico que chamaram de vrus do
edema do girino ou tadpole edema vrus (TEV). O agente foi isolado de todos
os girinos e rs adultas independentemente do seu estado sanitrio. Os
resultados do presente estudo diferem fundamentalmente destes achados pois o
vrus no foi detectado pelas tcnicas de PCR e microscopia eletrnica de
transmisso

nas

rs

ps-metamorfose.

Observaram-se

sinais

clnicos

semelhantes aos descritos pelos autores, mas vale ressaltar que so


inespecficos e decorrentes do quadro de leso renal e heptica, que
predominaram em ambos dos estudos.

106

CUNNINGHAM et al. (1996) apresentaram dois tipos de sndrome em


Rana temporaria coletadas em locais de mortalidades elevadas no Reino Unido.
Uma sndrome hemorrgica que afeta a musculatura esqueltica e no trato
alimentar e sistema urinrio e outra ulcerativa que acomete a pele e provoca
necrose nos membros posteriores. Em alguns casos foram encontradas rs com
sinais comuns s duas sndromes. Os autores concluram que o agente
responsvel da doena foi um iridovrus, entretanto neste estudo no foi
detectada a presena do agente, nem o tipo de leso descrita pelos autores.
ZHANG et al. (2001) reportaram casos de mortalidades acima de 90%
em rs de criao (Rana grylio) na China e atriburam a causa a um ranavirus
(Rana grylio vrus, RGV). A descrio dos sintomas inclui hemorragias petequiais
na pele que evoluem para ulceraes. As hemorragias tornam-se evidentes
medida

que

doena

avana

no

parnquima

dos

rgos

internos,

fundamentalmente fgado e rins. microscopia ptica, diversos graus de leso,


incluindo necrose, foram observados, resultando em destruio do tecido e
formao de cavidades de diversos tamanhos no fgado e bao. No corao,
foram observadas atrofia, fibrose e necrose. No intestino, verificou-se a presena
de clulas epiteliais aumentadas de volume e numerosas clulas necrticas, alm
de sangue na cavidade. Nas septicemias estudadas no Brasil, no se observou
presena de hemorragias petequiais, nem as ulceraes referidas por esses
autores. Ao microscpio, as leses diferiram com as encontradas neste estudo
principalmente em relao aos granulomas sem formao de cavidades
decorrentes da necrose, alm da ausncia de leses nas paredes do tubo
digestivo.
GREEN et al. (2002), ao estudar 30 surtos em rs silvestres nas fases
ps-metamorfose e adultas, atriburam aos iridovrus a etiologia de quatro deles e
atribuindo os demais surtos a fungos, os quais no foram identificados em nosso
estudo. Isto era o esperado tendo em vista que as condies de cativeiro
favorecem o desenvolvimento e a ao bacteriana e, na natureza, as condies
de alimentao e densidade populacionais so apropriadas.
WENG et al. (2002) reportaram na China surtos de doena da barriga
inchada causados por iridovrus em rs de criao da espcie Rana tigrina
rugulosa. A presena do iridovrus foi confirmada por microscopia eletrnica e por

107

tcnicas

moleculares.

necropsia,foram

observados

hepatomegalia

esplenomegalia e, na histopatologia foi detectada necrose heptica e renal, sem


presena de degenerao e de

granulomas, a diferena dos resultados do

presente estudo.
ROBERT et al. (2005) descreveram leses produzidas pelo vrus FV3
em Xenopus laevis experimentalmente inoculadas. Os autores comprovaram o
tropismo do agente pelo rim, observando que sinais de edemas e hemorragias
foram os mais evidentes e tem ntima relao com leso do rgo. Nos cortes
corados pela H&E, os autores observaram leses de necrose principalmente nos
tbulos proximais e glomrulos. Nos tbulos distais foi observada apenas a
presena de cilindros hialinos. No fgado, foi verificada necrose celular, mas em
menor grau. Ao contrrio do presente estudo, os autores no detectaram leses
degenerativas e granulomatosas.
GREER et al. (2005) estudaram cinco surtos de mortalidade em girinos
de Rana sylvatica e rs ps-metamorfose da espcie Rana pipiens, no Canad.
Baseados em observaes a campo, na avaliao histopatolgica e em tcnicas
moleculares, atriburam aos ranavirus a causa dos surtos. Porm, relataram que
resultados positivos foram obtidos na PCR para rs sadias criadas em laboratrio
e ovos coletados em locais onde infeces por iridovrus haviam sido reportadas.
A partir desses resultados, notou-se a importncia da realizao de diagnstico
diferencial consistente, devido semelhana dos sinais clnicos e da preferncia
ou eleio de rgos como o fgado e o rim. Os fungos envolvidos nas doenas
de anfbios j citadas, tambm no foram detectados.
A sndrome denominada de perna vermelha no foi observada em
nenhuma das rs quando a anlise foi realizada com o animal ainda vivo.
Quando as rs foram encontradas mortas, ou moribundas, os sinais clssicos de
eritema na regio ventral do corpo e patas comearam a ser evidentes. Estes
resultados so coincidentes com aqueles citados por GREEN et al. (2002) que
estudando surtos em anfbios dos Estados Unidos, no diagnosticaram red leg.
So concordantes tambm quanto constatao de que a maioria das
mortalidades atribudas sndrome de perna vermelha refere-se a diagnsticos
incompletos, nos quais a premissa bsica de no realizar estudos microbiolgicos
em rs em fases terminais ou mortas no foi cumprida, bem como, no foi

108

pesquisada a presena de vrus, nem realizadas as anlises histopatolgicas


correspondentes. Assim, h que se concordar com a afirmao dos autores: a
perna vermelha um diagnostico erroneamente e excessivamente utilizado na
medicina de anfbios e na epizootiologa herpetolgica. Em funo dos resultados
obtidos e das afirmaes de GIBBS et al.(1966) CUNNINGHAM et al. (1996) e
GREEN et al. (2002) os autores do presente estudo apresentam a proposta de
eliminar da nmina cientfica o termo perna vermelha ou red leg, por considerlo uma fonte de confuso no que se refere etiologia do surto, bem como por
fazer referncia a um evento que se apresenta em vrias situaes, associadas
ou no com agentes infecciosos.
A leso granulomatosa caracterstica da doena descrita no presente
estudo, tem sido associada infeces estreptoccicas bem como de outras
bactrias resistentes fagocitose AGIUS & ROBERTS (2003). Os macrfagos
uma vez que fagocitam agentes de elevada resistncia so responsveis pelo
inicio de reaes inflamatrias localizadas. O desenvolvimento daqueles
microrganismos, com conseqente

reao imune, d origem a leses

granulomatosas caractersticas das infeces crnicas.


Em determinadas situaes, as bactrias coabitam os tecidos das rs
produzindo leses sem sintomatologia evidente demonstrando que os anfbios
conseguem atingir condies de produo aceitveis convivendo com uma certa
contaminao bacteriana. Segundo MITCHELL (2003) e IICAB (2005) os
estreptococos

potencialmente

patognicos

podem

colonizar

de

forma

assintomtica, animais normais e humanos, requerendo ao de fatores


desencadeantes para produzir sintomas evidentes. Sabe-se que o nmero de
bactrias limitado usualmente pelas defesas no-especficas. Algumas espcies
chegam a produzir doenas quando estes mecanismos falham ou quando uma
cepa nova aparece, seja pelo ganho de determinados genes de virulncia ou pela
presena de cpsulas polisacardeas de proteo.
A

morte

das

rs

causada

por

septicemia

associada

ao

comprometimento funcional do fgado e rins principalmente, mas outros rgos


como bao, e corao so afetados medida que a doena avana. O quadro
pode ser qualificado como septicemia estreptoccica secundria.

109

Observaes a campo indicam que a utilizao, pelos produtores, de


penicilina na rao ou penicilina e estreptomicina injetvel mostraram resultados
imediatos na reduo do aparecimento de novos casos, assim como da
mortalidade, mas a ao destes antibiticos durou entre sete e 10 dias. Aps esse
perodo, a doena retomou aos nveis originais. Foi tambm observado que a
aplicao

de

imprescindveis

medidas
em

de

outras

biossegurana
criaes

com

bsicas,
maior

comprovadamente
desenvolvimento

(SOBESTIANSKY, 2002) revelaram-se efetivas. Um vazio sanitrio de trs


meses, seguido de medidas de desinfeco adequadas controlaram a doena no
ranrio em estudo e tambm em outros ranrios (VIANA, 2005). Esta observao
sugere que, provavelmente, em funo das modificaes das condies
ambientais, ocorrem mudanas que diminuem a quantidade de microrganismos
presentes e controlam a doena.
Ficou demonstrado que o papel dos cocos Gram-positivos no pode
ser descartado na evoluo da doena e, portanto, devem ser levados em conta
nos planos de controle sanitrio dos ranrios comerciais. Porm, a presena de
diversas espcies sem a determinao de um patgeno permanente ou
constante, indica o carter secundrio da infeco.
O curso insidioso, a ausncia de um patgeno especfico, a
associao de diversas espcies bacterianas, a resposta imune de tipo crnico e
a leso degenerativo-necrtica encontrada nos principais rgos de metabolismo,
sugerem provvel causa mltipla para a doena, decorrente da ao conjunta de
fatores infecciosos, ambientais e alimentares. provvel que uma ao inicial dos
ranavrus, identificada nos girinos, possa constituir a porta de entrada das
bactrias.

110

REFERNCIAS
1. AGIUS, C.; ROBERTS, R. Melano-macrophage centres and their role in fish
pathology. Journal of Fish Diseases. Oxford, n. 26, p. 499-509, 2003.
2. AMBORSKI, R. L.; SNIDER, T. G.; THUNE, R. L.; CULLEY, D. D. A nonhemolytic, group B Streptococcus infection of cultured bullfrogs, Rana catesbiana,
in Brazil. Journal of Wildlife Diseases. Ames-IO, v.19, n. 3, p. 180-184, 1983.
3. A.V.M.A. 1993 Report of the A.V.M.A. Panel for euthanasia. Journal of the
American Veterinary Medical Association, v. 202, n.2, p. 229-249, 1993.
4. BERCOVIER, H.; GHITTINO, C.; ELDAR, A Immunization with bacterial
antigens: infections with streptococci and related organisms. Developments in
Biological Standardization. Basel-NY, v. 90, p. 153-160, 1997.
5. BERGER, L.; SPEARE, R.; DASZAK, P.; GREEN, D.; CUNNINGHAM, A.;
GOGGIN, C.; SLOCOMBE, R.; RAGAN, M.; HYATT, A.; MCDONALD, K.; HINES,
H.; LIPS, K.; MARANTELLI, G.; PARKES, H. Chytridiomycosis causes amphibian
mortality associated with population declines in the rain forests of Australia and
Central America. Proceedings of the National Academy of Science,
Washington- DC, v. 95, n. 15, p. 9031-9036, 1998.
6. BERGER, L.; SPEARE, R.; HYATT, A. Chytrid fungi and amphibian declines:
Overview, implications and future directions. Ed. A. Campbell. Declines and
Disappearances of Australian Frogs. Environment Australia: Canberra. p. 2333, 1999.
7. BERGER, L.; HYATT, A.; OLSEN, V.; HENGSTBERGER, S.; BOYLE, D.;
MARANTELLI, G.; HUMPHREYS, K.; LONGCORE, J. Production of polyclonal
antibodies to Batrachochytrium dendrobatidis and their use in an
immunoperoxidase test for chytridiomycosis in amphibians. Diseases of Aquatic
Organisms, London, v. 48, n 3, p.213-220, 2002.
8. BERRIDGE, B. R.; FULLER, J. D.; DE AZAVEDO, J.; LOW, D. E.;
BERCOVIER, H.; FRELIER, P. F. Development of specific nested oligonucleotide
PCR primers for the Streptococcus iniae 16S-23S ribosomal DNA intergenic
spacer. Journal of Clinical Microbiology. Washington-DC, v. 36, n. 9, p. 27782781, 1998.
9. BLAUSTEIN, A.; DOBSON, A. Extinctions: A message from the frogs. Nature,
London, v. 439, n. 7073, p. 143, 2006
10. BRASIL. Ministrio da Agricultura, Pecuria e Abastecimento. Mtodos
analticos oficiais para anlises microbiolgicas para o controle de produtos de
origem animal e gua. Instruo Normativa 62, de 26 de agosto de 2003. Dirio
Oficial [da] Republica Federativa do Brasil, Poder Executivo, Braslia, DF, 18
set., 2003. Seo I, p.14-50.

111

11. BRENNER, S.; HORNE, R. A negative staining method for high resolution
electron microscopy of viruses. Biochimica et Biophysica Acta. Amsterdam, v.
34, p. 103-110, 1959.
12. CARNEVIA, D.; MAZZONI, R. Estudio de un brote de Sindrome de Edema
Generalizado (SEG) en Rana catesbeiana. In: VI ENCONTRO NACIONAL DE
RANICULTURA, 1988, Rio de Janeiro. Anais VI Encontro Nacional de
Ranicultura. ARERJ, 1988, p; 329-333.
13. CHANG, P.; PLUMB, J. Histopathology of experimental Streptococcus sp.
infection in tilapia, Oreochromis niloticus (L.), and channel catfich, Ictalurus
punctatus (Refinsque). Journal of Fish Diseases. Oxford, v. 19, p. 235-241,
1996.
14. CHANG, P.; LIN, P.; LEE, Y. Lactococcus graviae infection of cultured rainbow
trout, (Oncorhynchus mikiss) in Taiwan and associated biophysical characteristics
and histopathology. Bulletin of the European Association of Fish Pathologists.
The Netherlands, v. 22, n. 5, p. 319-327, 2002.
15. CHINCHAR, V. Ranaviruses (family Iridoviridae): emerging cold-blooded
killers. Archives of Virology, New York-NY, v. 147, n. 3, p. 447-470, 2002
16. CHINCHAR, V.; MAO, J. Molecular diagnosis of iridovirus infections in coldblooded animals. Seminars in avian and exotic pet medicine. v. 9, n.1, p. 2735, 2000.
17. COLORN, A.; DIAMANT, A.; ELDAR, A.; KVITT, H.; ZLOTKIN, A.
Streptococcus iniae infections in Red Sea cage-cultured and wild fishes. Diseases
of Aquatic Organisms. Amelinghausen, v. 49, n. 3, p. 165-170, 2002.
18. COPPO, J. El medio interno de la rana toro (Rana catesbeiana, Shaw 1802).
Revisin bibliogrfica. Revista Veterinaria, Corrientes, v. 14, n. 1, p. 25-41,
2003.
19. COSGROVE, G. Amphibian carea and diseases. In: Current Veterinary
Therapy VII, Kirk, R. W. Ed. W. Saunders and Co. Phyladelphia, p. 616-618, 1980.
20. COTRAN R.; KUMAR,V.; ROBBINS.S. Robbins - Pathologic basis of
disease. 5 ed. Philadefphia, Saunders Company, 1994. 1400p.
21. CRAWSHAW, G. Medicina de anfibios. In: Teraputica veterinaria de
pequeos animles. KIRK, R. W. & BONAGURA, J.D. Eds. Interamericana-Mc
Graw Hill. Mxico, 1994, p. 1355-1369.
22. CULLEN, B.; OWENS, L. Experimental challenge and clinical cases of Bohle
iridovirus (BIV) in native Australian anurans. Diseases of Aquatic Organisms,
Amelinghausen, v. 49, n. 2, p.83-92, 2002.

112

23. CUNNINGHAM, A.; LANGTON, T.; BENNETT, P.; LEWIN, J.; DRURY, S.;
GOUGH, R.; MACGREGOR, S. Pathological and microbiological findings from
incidents of unusual mortality of the common frog (Rana temporaria).
Philosophical Transactions of the Royal Society of London. Series B,
Biological Sciences, London, v. 351, n. 1347, p. 1539-1557, 1996.
24. DASZAK, P.; BERGER, L.; CUNNINGHAM, A.; HYATT, A.; GREEN, D.;
SPEARE, R. Emerging infectious diseases and amphibian population declines.
Emerging Infectious Diseases, Atlanta, v. 5, n. 6, p. 735-748, 1999.
25. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Emerging Infectious Diseases of
Wildlife - Threats to biodiversity and human health. Science. Washington-DC v.
287, n. 5452, p. 443-449, 2000
26. DASZAK, P.; CUNNINGHAM, A.; HYATT, A. Infectious Diseases and
amphibian population declines. Diversity and Distributions. Oxford-UK, n. 9, p.
141-150, 2003.
27. DUREMDEZ, R.;
AL-MARZOUK, A.;
QASEM, J.;
AL-HARBI, A.;
GHARABALLY, H. Isolation of Streptococcus agalactiae from cultured silver
pomfret, Pampus argenteus (Euphrasen), in Kuwait. Journal of Fish Diseases,
Oxford, v. 27, n. 5, p. 307, 2004.
28. ELDAR, A.; BEJERANO, Y.; BERCOVIER, H. Streptococcus shiloi and
Streptococcus difficile: Two new Streptococcal species causing a
meningoencephalitis in fish. Current Microbiology. New York-NY, v. 28, p. 139143, 1994.
29. ELDAR, A.; BEJERANO, Y.; LIVOFF, A.; HOROVITCZ, A.; BERCOVIER, H.
Experimental streptococcal meningo-encephalitis in cultured fish. Veterinary
Microbiology. Amsterdam, v. 43, p. 33-40, 1995.
30. ELDAR, A.; HOROVITCZ, A.; BERCOVIER, H. Development and efficacy of a
vaccine against Streptococcus iniae infection in farmed rainbow trout. Veterinay
Immunology and Immunopathology. Amsterdam, v. 56, n. 1-2, p. 175-183,
1997.
31. ELDAR, A. ; GHITTINO, C. Lactococcus garvieae and Streptococcus iniae
infections in rainbow trout Oncorhynchus mykiss: similar, but different diseases.
Diseases of Aquatic Organisms. Amelinghausen, v. 36, n. 3, p. 227-231, 1999.
32. EMERSON, H.; NORRIS, C. Red-Leg, an infectious disease of frogs. Journal
of Experimental Medicine, New York, v. 7, n. 1, p. 32-58, 1905.
33. EVANS, J.; KLESIUS, P.; GILBERT, P.; SHOEMAKER, C.; AL SARAWI, M.;
LANDSBERG, J.; DUREMDEZ, R.; AL MARZOUK, A.; AL ZENKI, S.
Characterization of -haemolytic Group B reptococcus agalactiae in cultured
seabream, Sparus auratus L., and wild mullet, Liza klunzingeri (Day), in Kuwait.
Journal of Fish Diseases. Oxford, v. 25, p. 505-513, 2000.

113

34. FIORIO, W.A.B.; MAIORINO,F.C.; HOGE,A.Y.A. & RAMOS,M.C.C.


Mortalidade em rs touro gigante (Rana catesbeiana Shaw, 1802) associada a
solues de continuidade na pele: Estudo antomo-patolgico e microbiolgico.
In: 2nd. Technofrog- International Meeting on Frog Research and Technology & IX
ENAR, 1997, Santos. Anais 2nd. Technofrog- International Meeting on Frog
Research and Technology & IX ENAR. Santos, SP, ABETRA/ABCR, p. 214,
1997. [resumos].
35. GALLI, L.; PEREIRA. A. ; MARQUEZ, A.; MAZZONI, R. Ranavirus detection
by PCR in cultured tadpoles (Rana catesbeiana Shaw 1802) from South America.
Aquaculture, Amsterdam, v., 257, n. 1-4, p. 78-82, 2006.
36. GANTRESS, J.; MANIERO, G.; COHEN, N.; ROBERT, J. Development and
characterization of a model system to study amphibian immune responses to
iridoviruses. Virology, New York-NY, v. 311, n. 2, p. 254-262, 2003.
37. GIBBS, E.; GIBBS, T.; VAN DICK, P. Rana pipiens: Health and disease.
Laboratory Animal Care, Baltimore, v. 16, p. 142-157. 1966.
38. GLORIOSO, J. C.; AMBORSKI, R. L.; AMBORSKI, G. F.; CULLEY, D. D.
Microbiological studies on septicaemic bullfrogs (Rana catesbiana). American
Journal of Veterinary Research. Chicago-IL, v. 35, n. 9, p. 1241-1245, 1974.
39. GONZALES-SANTANDER, R. Tcnicas de microscopia eletrnica en
biologa. Madrid, Aguilar, 1969, 666 p.
40. GREEN. D.; CONVERSE, K.; SCHRADER, A. Epizootiology of sixty-four
amphibian morbitidy and mortality events in the USA, 1996-2001. Annals of the
New York Accademy of Science, New York, v. 969, p. 323-339, 2002.
41. GREER, A.; BERRILL, M.; WILSON, P. Five amphibian mortality events
associated with ranavirus infection in south central Ontario, Canada. Diseases of
Aquatic Organisms, Amelinghausen, v. 67, p. 9-14, 2005.
42. GUAYASAMIN, J.M.; BONACCORSO, E.; SPEARE, R.; MENDEZ, D. The
roles of climatic variation and pathogenic fungus in declining populations of
Aletopus cruciger (Anura: Bufonidae) in Venezuela.In:. Abstracts of the Joint
Meeting of the American Society of Ichthyologists and Herpetologists, 2002
[on line] Herpetologists' League, and Society for the Study of Amphibians and
Reptiles,
Kansas
City,
USA.
Disponvel
em:
http://www.asih.org/meetings/2002/Abstracts.pdf Acesso em: 21 jan. 2003.
43. GUIMARAES, N.; SILVEIRA,W.; RODRIGUES, M. Isolamentos de bactrias
patgenas nos ranrios de Gois e Par. In: VI ENCONTRO NACIONAL DE
RANICULTURA, 1988, Rio de Janeiro. Anais VI Encontro Nacional de
Ranicultura. Rio de Janeiro: ARERJ, 1988, p. 287-291.

114

44. GUINS, P. Sndrome hepato-renal [on line]. In: ASOCIACION ESPAOLA


PARA EL ESTUDIO DEL HIGADO. 2001 p. 129-138 Disponvel em:
http://www.aeeh.org/trat_enf_hepaticas/C-13.pdf Acesso em: 29 mar 2006.
45. HADFIELD, C.; WHITAKER, B. Amphibian Emergency Medicine and Care.
Seminars in Avian and Exotic Pet Medicine, v. 14, n. 2 , p. 79-89, 2005.
46. HANSELMANN, R.; RODRIGUEZ, A.; LAMPO, M,; FAJARDO-RAMOS
L.;ALONSO AGUIRRE, A.;. MARM KILPATRICK, A.; RODRIGUEZ J.P., DASZAK,
P. Presence of an emerging pathogen of amphibians in introduced bullfrogs Rana
catesbiana in Venezuela. Biological Conservation, Barking-Essex, v. 120, n. 1,
p. 115-119, 2004.
47. HE, J.; LU, L.; DENG, M.; HE, H.; WENG, S.; WANG, X.; ZHOU, S.; LONG, Q.;
WANG, X.; CHAN, S. Sequence analysis of the genoma completo of an iridovirus
isolated from the tiger frog. Virology, New York-NY, v. 292, n. 2, p.185-197, 2002
48. HIPLITO, M. Causas de mortalidade na Ranicultura. In: 1st. TECHNOFROG
- I INTERNATIONAL MEETING ON FROG RESEARCH AND TECHNOLOGY &
VIII ENAR, 1995, Viosa. Anais 1st. Technofrog - I International Meeting on
Frog Research and Technology & VIII ENAR. Viosa, MG. ABETRA/ABCR, v.
2, p. 199-207, 1995.
49. HIPLITO, M. Causas de mortalidade e Sanidade. In: 2nd. TECHNOFROG- I
INTERNATIONAL MEETING ON FROG RESEARCH AND TECHNOLOGY & IX
ENAR, 1997, Santos. 2nd. Technofrog- International Meeting on Frog
Research and Technology & IX ENAR. Santos, SP. ABETRA/ABCR, p. 5-9,
1997.
50. HIPLITO, M. Doenas na Ranicultura. In: X ENCONTRO NACIONAL DE
RANICULTURA 1999, So Miguel do Iguau. Anais X ENAR. So Miguel de
Iguau, PR, ABETRA/ABCR, p. 3-15, 1999.
51. HIPLITO, M. Alteraes hepticas: Problemas nutricionais? In: XI
ENCONTRO NACIONAL DE RANICULTURA 2001, Bragana Paulista. Anais XI
ENAR. Bragana Paulista, ABETRA/Ranrio Beija-Flor, p. 49, 2001.
52. HIPLITO, M. Patologias em r touro (Rana catesbeiana Shaw 1802).
Primeira reviso da bibliografia brasileira. Arquivos do Instituto Biolgico de
So Paulo. So Paulo, v. 69, n. 2, p. 113-120, 2002.
53. HIPLITO, M.; BALDASSI, L.; MOULIN, A.; CALIL, M.; BARBOSA, M;
CUNHA, R. Presena de agentes patognicos bacterianos em rs-touro gigante
(Rana catesbeiana). In: ENCONTRO DE PESQUISA VETERINARIA, 1987,
Jaboticabal, SP. Encontro de Pesquisa Veterinria, Jaboticabal, SP, p. 12.
1987.
54. HIPLITO, M.; BALDASSI, L.; PIRES, C.; SOUZA, C.; SOUZA, J.
Sensibilidade bacteriana de agentes oportunistas isolados de anfbios. In: VI

115

ENCONTRO NACIONAL DE RANICULTURA, 1988, Rio de Janeiro. Anais VI


Encontro Nacional de Ranicultura. Rio de Janeiro: ARERJ, 1988, p. 341-346.
55. HIPLITO, M.; MOULIN, A.; CALIL, M. L.; PIRES, C. C.; SOUZA, C.; SOUZA,
J. Estudo da microbiota de anfbios capturados em ranrio comercial. In: VI
ENCONTRO NACIONAL DE RANICULTURA, 1988, Rio de Janeiro. Anais VI
Encontro Nacional de Ranicultura. Rio de Janeiro: ARERJ, 1988, p. 149-154.
56. HIPLITO, M.; SOUZA, C.; SOUZA, J. R. Presena de Streptococcus sp. ao
nvel de sistema nervoso central em Rana catesbeiana com sintomatologia
nervosa. In: VI SIMPOSIO LATINOAMERICANO DE ACUICULTURA & V
SIMBRAQ, 1988, Florianpolis. VI Simposio Latinoamericano de Acuicultura &
V SIMBRAQ, Florianpolis, Brasil, p. 46, 1988. [resumos].
57. HIPLITO, M. ; MOULIN, A.; MARACRUZ, R. Afeces neurolgicas em ra
touro (Rana catesbeiana Shaw 1802). In: X Reunio Anual do Instituto
biolgico. So Paulo, v. 64, p. 49, 1997.
58. HIPLITO, M.; CATROXO, M.; CURI, N.; BACH, E. Deteco ao microscpio
eletrnico de transmisso de partculas virais semelhantes aos grupos Herpes,
Toga e Paramixovrus em r-touro (Rana catesbeiana Shaw, 1802) criadas
comercialmente. Primeiras observaes no Brasil. Arquivos do Instituto
Biolgico de So Paulo. So Paulo, v. 70, n. 1, p. 107-111, 2003.
59. HIRD, D.; DIESCH, S.; MCKINNEL, R.; GORHAM, E.; MARTIN, F.; KURTZ,
S.; DUBROVOLNY, C. Aeromonas hydrophila in wild-caught frogs and tadpoles
Rana pipiens in Minnesota. Laboratory Animal Science, Memphis-TN, v. 31, n. 2,
p. 166-169, 1981.
60. HYATT, A.; GOULD, A.; ZUPANOVIC, Z.; CUNNINGHAM, A.;
HENGSTBERGER, S.; WHITTINGTON, R.; KATTENBELT, J.; COUPAR, B.
Comparative studies of piscine and amphibian iridoviruses. Archives of Virology,
New York-NY, v. 145, n. 2, p.301-331, 2000.
61. IICAB . Desenvolvido pela Iowa State University- AOIEC Center - Institute for
International Cooperation in Animal Biologics. An OIE Collaborating Center, 2005.
Apresenta textos sobre doenas infecciosas nos animais e riscos na sade
pblica. Disponvel em: http://www.cfsph.iastate.edu Acesso em 23 nov. 2005.
62. JANCOVICH, J.; MAO, J.; CHINCAR, V.; WYATT, C.; CASE, S.; KUMAR, S.;
VALENTE, G.; SUBRAMANIAN, S.; DAVIDSON, E.; COLLINS, J.; JACOBS, B.
Genomic sequence of a ranavirus (family Iridoviridae) associated with salamander
mortalities in North America. Virology, New York-NY, v. 316, n. 1, p. 90-103,
2003.
63. KIM, Y.; JUNG, S.; CHOI, T.; KIM, H.; RAJENDRAN, K.; OH, M. PCR
amplification and sequence analysis of irido-like virus infecting fish in Korea.
Journal of Fish Diseases, Oxford, v. 25, n. 2, p. 121-124, 2002.

116

64. KING, N., & ALROY, J. Deposies intracelulares e extracelulares;


degeneraes. In: JONES, T.C.; HUNT, E.D.; KING, N.W. Patologia Veterinria.
6.ed. So Paulo: Editora Manole Ltda., 2000. cap. 2, p. 27-29.
65. KLESIUS, P.; SHOMAKER, C.; EVANS, J. Efficacy of single and combined
Streptococcus iniae isolate vaccine administred by intraperitoneal and
intramuscular routes in tilapia (Oreochromis niloticus). . Aquaculture. Amsterdam,
v. 188, p. 237-246, 2000.
66. KULP, W.; BORDEN, K. Further studies on Proteus hydrophilus, the
ethiological agent in Red-Leg disease of frogs. Journal of Bacteriology,
Washington DC, v. 44, p. 673-679, 1942.
67. KVITT, H., COLORN, A. Strain variation and geographic endemism in
Streptococcus iniae. Diseases of Aquatic Organisms, Amelinghausen, v. 61, n.
1-2, p. 67-73, 2004.
68. LAEMMILI, U. Cleavage of structural proteins during assembly of the head of
the bacteriophage T. Nature, London, v. 277, p. 680-685, 1970
69. LONGCORE, J.; PESSIER, A.; NICHOLS, D. Batrachochytrium dendrobatidis
gen. et sp. nov., a chytrid pathogenic to amphibians. Mycologia, New York-NY. v.
91, n. 2, p. 219-227, 1999.
70. LUFT, J. A. Improvements in an epoxy resin embedding methods. Journal of
Biophysics, Biochemestry and Cytology, v. 9, p. 409-414, 1961.
71. LUNA, L.G. Manual of histology staining methods of the armed forces
institute of pathology. 3.ed. New York : McGraw-Hill, 1968. 258p.
72.
MAO, J.; GREEN, D.; FELLERS, G.; CHINCHAR, V. Molecular
characterization of iridoviruses isolated from sympatric amphibians and fish. Virus
Research, Amsterdam, v. 63, n. 1-2, p.45-52, 1999.
73. MARSH, I.; WHITTINGTON, B.; OROURKE, B.; HYATT, A.; CHISHOLM, O.
Rapid differentiation of australian, european, and american ranaviruses based on
variation in major capsid protein gene sequence. Molecular and Cellular Probes.
New York-NY, v. 16, n. 2, p. 137-151, 2002.
74. MATHIAS, M.; SCOTT, P. Potencial produtivo de criao de rs no Estado do
Rio de Janeiro. Srie Agronegcios, SEBRAE/RJ, 100p., 2004.
75. MAUEL, M.; MILLER, K; FRAZIER, K; HINES, M. Bacterial pathogens isolated
from cultured bullfrogs (Rana catesbeiana). Journal of Veterinary Diagnostic
and Investigations. Columbia-MO, v. 14, n. 5, p. 431-433, 2002.
76. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,

117

2000, Cairns, Austrlia. Conference and Workshop Compendium. Cairns,


Rainforest CRC, p. 37-38, 2000a.
77. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000b,
Cairns,
Austrlia.
Power
Point
presentation.
http://www.jcu.edu.au/school/phtm/PHTM/frogs/mazzoni.ppt, 2000. Acesso em: 30
mai. 2004.
78. MAZZONI, R.; CARNEVIA, D. Enfermedades de ranas en criadero: Una
limitante real para el desarrollo de la ranicultura. Resumos do Encontro Latino
Americano de Patologistas em Organismos Aquticos. Florianpolis, SC, v.2, p.
228, 2000, [resumos].
79. MAZZONI, R.; CUNNINGHAM, A.; DASZAK, P.; APOLO, A; PERDOMO, E.;
SPERANZA, G. Emerging pathogen of wild amphibians in frogs (Rana
catesbeiana) farmed for international trade. Emerging Infectious Diseases,
Atlanta, v. 9, n. 8, p. 995-998, 2003.
80. MILES, E. Red-leg in tree frogs caused by Bacterium alcaligenes. Journal of
General Microbiology, Reading UK, v. 4, n. 3, p. 434-436, 1950.
81. MITCHELL, T. The pathogenesis of streptococcal infections: From tooth decay
to meningitis. Nature Reviews. Microbiology. London, v. 1., p. 219-230, 2003.
82. MULLER-ALOUF, H.; CARNOY, C.; SIMONET, M.; ALOUF, J. Superantigen
bacterial toxins: state of the art. Toxicon, Oxford, v. 39, p. 1691-1701, 2001.
83. NACE, G. (ed.): Amphibians: Guidelines for the breeding, care and
management of laboratory animals. Washington D.C., NRC/NAS, 1974, 153p.
Disponvel em: http://www.nap.edu/catalog/661.html#toc , Acesso em: 15 fev.
2004.
84. NYMAN S., Mass mortality in larval Rana sylvatica attributable to the
bacterium, Aeromonas hydrophila. Journal of Herpetology, Athens-OH, v. 20, n.
2, p. 196-201, 1986.
85. PASTERIS, S.; BUHLER, M.; NADER-MACIAS, M. Microbiological and
histological studies of farmed-bullfrog (Rana catesbeiana) tissues displaying redleg syndrome. Aquaculture. Amsterdam, v. 251, n. 1, p. 11-18, 2006
86. REICHENBACH-KLINKE, H.; ELKAN, E. The principal diseases of lower
vertebrates, New York, Academic Press, 600 pp., 1965.
87. REINOLDS, E.S. The use of lead citrate at high pH as an electron-opaque
stain in electron microscopy. Journal of Cell Biology, v. 17, p. 208-212, 1963.

118

88. ROBBINS, S.; COTRAN, R.; KUMAR, V. Fundamentos de Robbins:


patologia estrutural e funcional. 5 ed. Rio de Janeiro: Guanabara Koogan,
1996, p. 605.
89. ROBERT, J.; MORALES, H.; BUCK, W.; COHEN, N.; MARR, S.; GANTRESS,
J. Adaptive immunity and histopathology in frog virus 3-infected Xenopus.
Virology, New York-NY, v. 332, n. 2, p. 667-675, 2005.
90. ROMALDE, J.; LORES, F.; MAGARIOS, B.; BARJA, J.; TORANZANO, A.
Study of cell surface associated virulence factors of Streptococcus parauberis
strains pathogenic for turbot. Bulletin of the European Association of Fish
Pathologists. The Netherlands, v. 20, n. 6, p. 244-251, 2000.
91. ROTTMANN, R.; FRANCIS-FLOYD, R.; DURBOROW, R. The role of stress in
fish disease. South Regional Aquaculture Center Publication [online] n. 474,
1992. Disponvel em: http://aquanic.org/publicat/usda_rac/efs/srac/474fs.pdf
Acesso em: 15 mar. 2005.
92. RUSSEL, F. An epidemic septicemic disease among frogs due to the Bacillus
hydrophilus fuscus. Journal of the American Medical Association, Chicago, v.
30, p. 1442-1449, 1898.
93. SALLES, M.; SPROVIERI, S.; BEDRIKOW, R.; PEREIRA, A.; CARDENUTO,
S.; AZEVEDO, P.; SILVA, T.; GOLIN, V. Sndrome da resposta inflamatria
sistmica/sepse reviso e estudo da terminologia e fisiopatologia. Revista da
Associao Mdica Brasileira, So Paulo, v. 45, n. 1, p. 86-92, 1999.
94. SAMBROOK, J.; FRITCSH, E.; MANIATIS, T. Molecular cloning: A
laboratory manual. 2. ed. New York : Cold Spring Harbor Laboratory, 1989. 3v.
3104p.
95. SHELBY, R.; KLESIUS, P.; SHOEMAKER, C.; EVANS, J. Passive and active
immunization of tilapia, Oreochromis niloticus (L.), with anti-Streptococcus iniae
whole sera. Journal of Fish Diseases. Oxford, v. 25, p. 1-6, 2002.
96. SHELBY, R.; SHOEMAKER, C.; KLESIUS, P. Detection of Streptococcus
iniae infection of Nile Tilapia, Oreochromis niloticus, by a monoclonal antibodybased ELISA. Journal of Applied Aquaculture. Binghamton-NY, v. 12, n. 3, p.
23-31, 2002.
97. SHOMAKER, C.; EVANS, J.; KLESIUS, P. Density and dose: factors affecting
mortality of infected tilapia (Oreochromis niloticus). Aquaculture. Amsterdam, v.
188, p. 229-235, 2000.
98. SHOEMAKER, C.; KLESIUS, P.; EVANS, J.. Prevalence of Streptococcus
iniae in tilapia, hybrid stripped bass and channel catfich on commercial fish farms
within the United States. American Journal of Veterinary Research. Chicago-IL,
v.62, n. 2, p. 174-177, 2001.

119

99. SILVA, D. (dinis@ranajax.com.br) Exportao de rs. Informao geral.


Mensagem recebida por MAZZONI, R. (rolo@pes.fvet.edu.uy). Acesso em: 20
dec. 2005.
100.
SOBESTIANSKY, J. Sistema intensivo de produo de sunos.
Programa de Biossegurana. Goinia: Sobestiansky, 2002, 108 p.
101.
SOMSIRI, T. Diseases of cultured frogs in Thailand. AAHRI
Newsletter, Bangkok, v.3, n. 2, 1994. Disponvel em:
http://www.agri-aqua.ait.ac.th/aahri/Article17.htm . Acesso em: 15 ago. 2004.
102.
SPEARE, R. Anesthesia of anurans.. Workshop on the medicine an
management of amphibians. American Association of Zoo Veterinarians,
Greensboro. 1989. p. 10. [Apostila]
103.
SPEARE, R. Summary of formidable infectious diseases of
amphibians. In: AMPHIBIAN DISEASE HOME PAGE. Webmaster SPEARE, R.
School of Public Health and Tropical Medicine, James Cook University, 2003.
Disponvel em: http://www.jcu.edu.au/school/phtm/PHTM/frogs/formidable.htm.
Acesso em: 11 jan.2005.
104.
SPEARE, R.; BERGER L. Global distribution of chytridiomycosis in
amphibians.
Disponvel
em
:
http://www.jcu.edu.au/school/phtm/PHTM/frogs/chyglob.htm
2000. Acesso em:
20 mai. 2005;
105. TORANZO, A. ; DEVESA, S.; ROMALDE, J.; LAMAS, J.; RIAZA, A.;
LEIRO, J.; BARJA, J. Efficay of intraperitoneal and immersion vaccination against
Enterococcus sp. infection in turbot. Aquaculture. Amsterdam, v. 134, p. 17-27,
1995.
106. VAN DER WAAIJ, D.; COHEN, B.; NACE, G. Colonization patterns in the
cloaca of Rana pipiens. Laboratory Animal Science, Memphis, v. 24, n. 2, p.
307-317, 1974.
107.
VIANA, S. sviana@terra.com.br Mortalidade em rs. . Informao
geral. Mensagem recebida por MAZZONI, R. (rolo@pes.fvet.edu.uy). Acesso em:
10 dec. 2005.
108. VIZOTTO, L. Rs: Doenas e profilaxia. In: VI Encontro Nacional de
Ranicultura, 1988, Rio de Janeiro. Anais VI Encontro Nacional de Ranicultura.
Rio de Janeiro: ARERJ, 1988, p. 310-328.
109. WATSON, M. L. Staining of tissue sections for electron microscopy with
heavy metals. Journal of Biophysics, Biochemestry and Cytology, v. 4, p. 475478, 1958.
110.
WENG, S.; HE, J.; WANG, X.; LU, L.; DENG, M.; CHAN, S-M. Outbreaks
of an iridovirus disease in cultured tiger frog, Rana tigrina rugulosa, in southern

120

China. Journal of Fish Diseases, Oxford, v. 25, n. 11, p. 423-427, 2002.


111. WOLF, K.; BULLOCK, G.; DUNBAR, C.; QUIMBY, M. Tadpole edema
virus: a viscerotropic pathogen for anuran amphibians. Journal of Infectious
Diseases, Chicago-IL, v. 118, n. 3, p.253-262, 1968.
112. ZHANG, Q.; XIAO, F.; LI, Z.; GUI, J.; MAO, J.; CHINCHAR, V.
Characterization of an iridovirus from the cultured pig frog Rana grylio with lethal
syndrome. Diseases of Aquatic Organisms, Amelinghausen, v. 48, n. 1, p. 2736, 2001.
113. ZHANG, Q.; ZHE, Z.; XIAO, F.; LI, Z.; GUI, J. Molecular characterization of
three Rana grylio virus (RGV) isolates and Paralichthys olivaceus lymphocystis
disease virus (LCDV-C) in iridoviruses. Aquaculture, Amsterdam, v. 251, n. 1, p.
1-10, 2006.
114. ZUPANOVIC, Z.; MUSSO, C.; LOPEZ, G.; LOURIERO, C.; HYATT, A.;
HENGSTBERGER, S.; ROBINSON, A. Isolation and characterization of
iridoviruses from the giant toad Bufo marinus in Venezuela. Diseases of Aquatic
Organisms, Amelinghausen, v. 33, n. 1, p. 1-9, 1998.

121

CAPITULO 5
PROCESSO INFECCIOSO SUPER AGUDO SEMELHANTE AO CHOQUE
ENDOTXICO EM RS DE CRIAO (Rana catesbeiana Shaw, 1802).
RESUMO
Na realizao de estudos de doenas septicmicas em rs de criao foi
observado uma forma super aguda que acontece em 15 a 20% dos animais
doentes. O objetivo do presente trabalho foi estudar as caractersticas particulares
desta forma da infeco, mediante estudos clnicos e para-clnicos que
envolveram
amostragem
de
exemplares
para
necropsia,
anlises
histopatolgicas, microbiolgicas, moleculares e de microscopia eletrnica de
transmisso. Os sinais clnicos observados incluem modificaes da postura
normal, depresso, e diminuio da reao aos estmulos externos. As rs
morrem em curto perodo de tempo apresentando incoordenao, opisttomo e
convulses, permanecendo em quadro tetnico com os membros estendidos.
necropsia, foram observados aumento do tamanho do fgado e colorao
anormal, geralmente cinzenta ou amarelada, bao pardo-escuro e aumentado de
tamanho, rins e pulmes hemorrgicos e ascite leve com exsudato sorohemorrgico. histopatologia, observou-se um quadro caracterstico de leses
produzidas por sepse generalizada. Fgado, rins, bao, corao, pulmo e crebro
foram afetados. Verificou-se nesses rgos uma resposta inflamatria mltipla,
necrose associada presena de macrfagos e infiltrao linfocitria.
Granulomas bacterianos foram observados distribudos no parnquima dos
diversos rgos. A alterao histopatolgica mais freqente neste quadro foi o
aparecimento de aglomerados basoflicos arredondados distribudos na maioria
dos rgos afetados, correspondendo a cocos Gram-positivos. O quadro clnico
super agudo, associado aos achados de necrpsia e histopatologia sugerem a
ocorrncia de um choque que, devido a quantidade e distribuio generalizada
dos microrganismos, indicam origem sptica. Por tanto, a anlise dos resultados
do presente estudo permitem-nos concluir sobre a presena de uma sndrome
semelhante sndrome de choque endotxico ou choque sptico em rs de
criao.
Palavras chave: Aqicultura, choque, estreptococos, ranicultura.

122

ABSTRACT
During the study of septicemic diseases in farmed frogs, it was detected a
particular syndrome characterized by super acute mortality affecting 15 to 20% of
the sick population. Clinical signs included abnormal posture, depression, and low
reaction to external stimuli. Frogs died in a very short time showing incoodination,
opistotonous and convulsions with tetany, remaining with the four legs extended.
Necropsy findings included hepatomegaly with abnormal color, generally grayish
or yellowish, dark red and swollen spleen, hemorrhagic kidneys, strongly
hemorrhagic lungs and slight ascites with serum-hemorrhagic exudate.
Histopathologically, a septicemic pattern was observed. Liver, kidney, spleen,
heart, lungs and brain showed a multiple inflammatory response with necroses in
association with macrophage and lymphocitic infiltration. Bacterial granuloma were
observed spread in all organs. The most frequent histopathological lesion were
basophilic aggregates spotted through all affected organs. The super acute
condition, associated with necropsy and histopathological findings suggested
shock syndrome that, due to bacterial quantity and distribution indicated a septic
origin. These results resembled the existence of a toxic shock syndrome or septic
shock in farmed frogs, and indicate that this kind of disease could be an usual
finding in other aquaculture species.
Key words: Frogs, septicemia, streptococci, shock

123

1 INTRODUO
Com os avanos nos conhecimentos sobre manejo e alimentao, a
ranicultura transformou-se numa atividade intensiva, com altas densidades de
populao e estrita dependncia de alimentos balanceados artificiais. Os mtodos
intensivos de cultivo favorecem o aparecimento de doenas que constituem
ameaa viabilidade tcnica e econmica dos ranrios e so considerados
fatores que limitam o crescimento da atividade (NACE, 1974; AMBROSKY et al.,
1983; GUIMARAES et al., 1988; CRAWSHAW, 1994; MAZZONI, 2000a;
MAZZONI & CARNEVIA, 2000; ZHANG et al., 2001; MAZZONI, 2003).
No Brasil, conforme reviso realizada por HIPLITO (2002), a maioria
dos trabalhos relativos ao assunto, foram comunicados efmeros, no tendo
continuidade

no

estudo

do

caso.

Os

diagnsticos

concentraram-se

exclusivamente na identificao de agentes parasitrios e bacterianos, no sendo


realizado acompanhamento dos surtos, no intuito de estabelecer o papel
etiolgico dos agentes detectados e de outros aspectos das doenas que
permitam a elaborao de medidas de preveno ou controle.
Trabalhos realizados com rs de criao na China (Rana grylio e Rana
tigrina rugulosa) identificaram a presena de vrus da famlia Iridoviridae gnero
Ranavirus como produtores de doenas com elevada mortalidade e impacto
econmico (ZHANG et al., 2001, 2006; WENG et al., 2002; ZHANG et al., 2006).
Nas rs de ambientes naturais tem sido identificada uma doena
emergente com alta mortalidade, produzida pelo fungo Batrachochytrium
dendrobatidis (BERGER et al., 1998; BERGER et al., 1999; DASZAK et al., 1999;
LONGCORE et al., 1999; SPEARE & BERGER, 2000; MAZZONI, 2000a, b;
BERGER et al., 2002, GUAYASAMIN et al., 2002; MAZZONI et al., 2003;
SPEARE, 2003; HANSELMANN et al., 2004; BLAUSTEIN & DOBSON, 2006).
O presente trabalho constitui parte de estudos realizados no Brasil com
o intuito de aprofundar o conhecimento sobre as doenas das rs de criao
(Rana catesbeiana Shaw, 1802), principalmente aquelas com alta mortalidade, e
conseqentemente de maior impacto econmico.

124

As observaes clnicas dos surtos acompanhados neste estudo, bem


como daqueles citados na bibliografia sobre doenas de rs, revelaram
sintomatologia inespecfica e, portanto, insuficiente para conferir o diagnstico.
Dentre as diversas formas clnicas observadas, constatou-se a
presena de mortes sbitas de forma super aguda, j informadas pelos
ranicultores (informao pessoal) e outros autores (NACE, 1974; GUIMARAES et
al., 1988), mas, nunca estudado em forma isolada. Em funo da importncia
apresentada por esta forma clnica props-se este estudo com o objetivo de
conhecer as caractersticas etiolgicas e fisiopatolgicas envolvidas neste
processo infeccioso super agudo. Para tanto, foram realizadas pesquisas dos
agentes etiolgicos, a epizootiologia das doenas, a sintomatologia clnica, a
anatomia patolgica macroscpica, a histopatologia, a bacteriologia convencional,
e a virologia, sendo esta por meio do emprego de tcnicas moleculares, cultura de
clulas e a microscopia eletrnica de transmisso.

125

2 MATERIAL E MTODOS
O presente estudo foi realizado em um ranrio de ciclo completo
localizado no Estado de Gois, no Municpio de Hidrolndia. As rs, logo aps a
metamorfose, foram confinadas em baias de concreto localizadas em galpes
fechados. Todas as baias possuam piscina de cinco cm de profundidade
ocupando 20% da superfcie total. A gua foi obtida a partir de uma represa de
20 hectares alimentada por vrias nascentes.
As rs foram alimentadas duas vezes por dia com rao extrusada
apresentando 45% de protena bruta. De forma peridica, as rs foram
submetidas a triagem para manter tamanhos uniformes e reduzir o canibalismo. A
densidade foi mantida na faixa de 150 animais por m2 durante a fase inicial, at
alcanar 40 por m2 na etapa de terminao.

2.1 Amostragem das rs


Foram utilizadas 60 rs com sinais tpicos do quadro super agudo da
doena. Os exemplares estudados foram coletados no momento prvio morte
ou durante o processo de convulses e vmito decorrentes da apresentao
super aguda da enfermidade. As rs foram insensibilizadas por concusso
craniana e sacrificadas por corte da medula nervosa cervical (AVMA, 1993).

2.2 Anlise Histopatologica


Fragmentos de fgado, rins, bao, estomago, pulmes, corao e
crebro foram extrados e preservados em formol tamponado a 10% (vol-vol) e
processados segundo a rotina de estudos de histopatologia no laboratrio de
Histopatologia do Hospital das Clnicas da Universidade Federal de Gois,
utilizando as tcnicas propostas por LUNA (1968). Os blocos parafinados foram
secionados em cortes de 4-5 e corados com hematoxilina-eosina (H&E) para as
avaliaes primrias das leses. Adicionalmente, os cortes selecionados foram
tambm corados pelo mtodo de Gram para visualizao de bactrias em geral,
pelo mtodo de Fite para deteco de micobacterias e colorao de PAS para
visualizao de fungos.

126

2.3 Reao em cadeia da polimerase (PCR)


Fragmentos de fgado, rim, bao e msculo foram preservados em
etanol a 95% ou congelados a -20C at processamento no laboratrio de
Biologia Molecular do Centro de Pesquisa em Alimentos da Escola de Veterinria
da Universidade Federal de Gois. A extrao do DNA foi realizada a partir de
pores de 50 mg utilizando o mtodo do fenol/clorofrmio (SAMBROOK et al.,
1989). Foram utilizados iniciadores direcionados a regies conservadas no
genoma dos iridovrus (Quadro 1). Para o gene que codifica a protena imediata
precoce (IE) ICP-18 utilizaram-se iniciadores propostos por GALLI et al. (2006), e
para o gene que codifica a protena MCP foram utilizados iniciadores localizados
nas extremidades 5e 3 da seqncia de FV3 (TAN et al., 2004) sendo que o
iniciador forward original do presente trabalho e o reverse j utilizado por
HYATT et al. (2000) segundo apresentado no Quadro 1.

QUADRO 1 Iniciadores utilizados para amplificao parcial do genoma de


ranavirus, bp indica o comprimento do amplicon.

Nome

Forward

Reverse

Produto
(bp)

MCP

ATGTCTTCTGTAACTGGTTCA

AAAGACCCGTTTTGCAGCAAAC (1)

ATGATCCAAGCCTACCTGTGC (2)

AAATGTCCTAATCTATACACC (2)

1483

IE
479

(3) HYATT et al. (2000); (2) GALLI et al. (2006).

O mix utilizado para a amplificao com os diferentes iniciadores


constitua-se de 2,5 L 10x tampo de PCR [Tris-HCl 20 mM (pH 8.4), KCl 50
mM], dNTP 200 M, 2,5 mM MgCl2, 2.5 M de cada iniciador, 1 U de Taq DNA
Polymerase, 5 L de DNA template e gua MilliQ at completar 50 L para cada
reao. Os produtos de amplificao foram submetidos a corrida em gel de

127

agarose a 1%, corados com brometo de etdeo 0.5 g/mL e visualizados em


transiluminador de luz UV.
Foram tambm utilizados iniciadores direcionados identificao da
bactria Streptococcus iniae aplicando a metodologia de PCR proposta por
BERRIDGE et al. (1998). Os cocos Gram-positivos, independentemente do
gnero foram purificados, sendo o DNA extrado pela metodologia do
fenol/clorofrmio (SAMBROOK et al., 1989).

2.4 Anlise Microbiolgica


O sangue foi colhido assepticamente diretamente do corao das rs
vivas e foram preparados esfregaos que foram posteriormente corados com
Giemsa. Uma vez sacrificados os exemplares foram submersos em soluo de
cido peractico a 0,2%. Aps abertura da pele e da cavidade celmica, fgado,
rins, bao, pulmes, corao e crebro foram extrados assepticamente. As
amostras foram processadas imediatamente no laboratrio de bacteriologia do
Centro de Pesquisa em Alimentos da Escola de Veterinria da Universidade
Federal de Gois, sendo inoculadas em caldos BHI (Brain Heart Infussion Broth),
Casoy (Tripticase Soy Broth), Glicose Azide e Selenito-Cistina, segundo os
mtodos rotineiros (BRASIL, 2003). Todas as amostras foram incubadas a 30C
por 24-72 h. O perodo de 72 horas deveu-se ao crescimento lento de alguns
estreptococos, e procurou-se de esta forma propiciar um tempo suficiente para o
desenvolvimento, evitando a ocorrncia de falsos negativos. Assim que foi
observado crescimento bacteriano foram semeadas alquotas em placas de gar
sangue contendo 5% de sangue desfibrinado de carneiro, e incubadas a 30C,
determinando-se as caractersticas hemolticas e morfologia das colnias-UFC.
As UFC isoladas, com diferente morfologia, foram selecionadas para colorao de
Gram, observao em microscpio de contraste de fase, e identificao mediante
provas bioqumicas complementares. Os cocos Gram-positivos foram estudados
mediante

provas

bioqumicas

complementares.

As

UFC

identificadas

primariamente pela bioqumica como estreptococos, foram enviadas para


determinao da espcie ao Aquatic Animal Health Research Laboratory em
Auburn - Alabama, nos Estados Unidos. As culturas foram processadas pelo

128

mtodo de Identificao de cidos graxos da membrana, FAME (Fatty Acid Methyl


Ester).
Os bastonetes Gram-negativos foram incubados em placas de gar
McConkey e as UFC selecionadas inoculadas em tubos de TSI (Triple Sugar Iron
Agar) para finalmente serem submetidas bateria de testes bioqumicos para
identificao da espcie (BRASIL, 2003).
Amostras de gua e da rao foram analisadas periodicamente por
tcnicas microbiolgicas convencionais para determinao de contaminao fecal
(BRASIL,

2003)

presena

de

cocos

Gram-positivos

como

descrito

anteriormente.

2.5 Microscopia eletrnica de transmisso


As amostras foram processadas no laboratrio de Microscopia
Eletrnica do Instituto Biolgico de So Paulo. O material analisado foi
selecionado a partir de leses identificadas nas lminas da histopatologia. Uma
vez delimitada a regio suspeita, a mesma foi localizada no bloco parafinado e
realizou-se corte de aproximadamente 1 mm de dimetro. O fragmento extrado
foi desparafinado, reidratado e finalmente processado pela tcnica de incluso em
resina, seguida de contrastao positiva de cortes ultrafinos de acordo com os
procedimentos usuais de incluso em resina, baseando-se nos mtodos de LUFT
(1961) e GONZALES-SANTANDER (1969). Quando utilizou-se esta tcnica, os
fragmentos de rgos foram fixados em glutaraldedo a 2,5% em tampo fosfato
0,1M e pH 7,0, ps-fixados em tetrxido de smio a 2% em tampo fosfato 0,2M,
pH 7,0, corados por acetato de uranila a 0,5%, desidratados em srie cetnica
crescente (50 a 100%) e includos em resina Spurr. Aps ultra seccionamento dos
blocos, os cortes ultrafinos obtidos so corados positivamente pelo tratamento
seqencial de acetato de uranila (WATSON, 1958) e citrato de chumbo
(REINOLDS, 1963), antes de serem observados ao microscpio eletrnico de
transmisso Philips EM 208.

2.6 Pesquisa do fungo Batrachochytrium dendrobatidis


A pele das rs foi amostrada realizando raspagens nas regies
ventrais do abdome e dos membros posteriores com bisturi esterilizado. O

129

material obtido foi colocado sobre uma lmina de vidro, corado com uma mistura
de KOH 10% e Azul de Algodo em propores de 50:50 (vol-vol) e coberto por
uma lamnula para observao em microscpio ptico, segundo a descrio de
MAZZONI et al. (2003).

130

3 RESULTADOS
Os resultados da epizootiologa, microbiologia, PCR e microscopia
eletrnica de transmisso no diferem daqueles descritos para rs septicmicas
em trabalhos anteriores (MAZZONI et al. dados no publicados) pelos autores.
Rs doentes e mortas foram detectadas em todas as etapas do ciclo
de vida no sendo encontrado relao com o manejo, tipo de alimentao ou
localizao dentro do ranrio. Observou-se que entre 15 e 20% dos animais
afetados evoluram para um quadro super agudo. Esse quadro coexiste no
mesmo ranrio, inclusive nas mesmas baias, com outros quadros da doena
(MAZZONI et al., dados no publicados). No foram observados sinais
premonitrios que pudessem indicar que uma determinada r seria afetada.
Os sinais

clnicos

incluram: modificaes da postura normal,

depresso, e diminuio da reao aos estmulos externos. As rs apresentaram


ainda incordenao, opisttomo e convulses, permanecendo em quadro tetnico
com os membros estendidos (Figura 1).

FIGURA 1 -

Rs em posio estendida, tpica do quadro


super agudo

s vezes, foi observado vmito sanguinolento no momento da morte e


emisso de um som forte e agudo. No foram observadas hemorragias na pele e
nem ulceraes. Quando as rs foram colhidas imediatamente aps a morte, no
se observou nenhuma colorao vermelha na pele. Torna-se imperativo relatar
que o aparecimento super agudo dos sintomas e o conseqente bito dos animais
pode acontecer em perodo muito curto, de cerca de 30 minutos. Verificou-se que
as rs se alimentavam at o aparecimento dos sinais clnicos, fato comprovado

131

necropsia. O quadro que levou os animais morte lembrou as descries


realizadas em outras espcies animais e no homem para o choque sptico.

3.1 Necrpsia
As rs doentes mostraram diversos graus de leses nos rgos
internos, mas sem um padro definido. As leses de maior freqncia foram:
aumento do volume e colorao anormal do fgado, geralmente cinzenta ou
amarelada, bao aumentado de volume e com colorao pardo-escura alm de
rins hemorrgicos. s vezes, observaram-se pulmes fortemente hemorrgicos e
ascite leve contendo exsudato sero-hemorrgico.
A maioria dos animais apresentou alimento no tubo digestivo, incluindo
o estmago e o duodeno, enquanto o corpo adiposo apresentava-se com
caractersticas normais.

3.2 Histopatologia
Foi observado um quadro de leses inflamatrias e vasculares
produzidas pela sepse na maioria das rs afetando o fgado, rins, bao, corao,
pulmo e crebro.
Foram observados resposta inflamatria mltipla, localizada nas
serosas das vsceras bem como granulomas bacterianos distribudos no
parnquima dos diversos rgos. Tambm ocorreram reas de necrose
associadas presena de macrfagos e grande infiltrao linfocitria na maioria
dos tecidos.
A alterao mais freqente neste quadro foi o aparecimento de focos
basoflicos

arredondados

distribudos

na

maioria

dos

rgos

afetados,

correspondendo a aglomerados de bactrias, provavelmente cocos (Figura 2).


Um achado comum foi a esteatose heptica com perda da estrutura
normal do tecido e necrose. Os rins apresentaram-se muito afetados, com
infiltrao mononuclear, necrose glomerular e tubular, congesto, granulomas e
abundantes cilindros hialinos nos tbulos, bem como mineralizao tubular
multifocal. Os pulmes revelaram diversos graus de infiltrao mononuclear,
congesto e hemorragias.

132

FIGURA 2

R adulta. Focos basoflicos correspondendo a


aglomerados de cocos. (A) Fgado 200X; (B) Bao
200X; (C) Corao 400X; (D) Rim 200X.. Colorao
H&E.

As rs estudadas mostraram grau varivel de congesto no epicrdio


com hemorragias e infiltrao de moncitos macrfagos e linfcitos. No corao
observaram-se granulomas com o mesmo padro histolgico j assinalado nos
outros tecidos, assim como abundantes bactrias infiltrando o miocrdio e o
epicardio. No bao notou-se grau varivel de congesto, hiperplasia linfoctica
inespecfica, granulomas e necrose, sempre associados presena bacteriana.

133

Figura 3 -

Aglomerado de cocos gram-positivos no miocrdio (A), e em


rim de rs (B). Colorao de Gram, 1000X.

FIGURA 4 -

Esfregao de sangue cardaco corado pelo Giemsa.


Observam-se abundantes cocos isolados ou em cadeias
na superfcie das hemceas (seta), assim como em um
leuccito (ponta de seta), 1000x.

A colorao de Gram revelou a presena de grandes aglomerados de


cocos Gram-positivos associados s leses observadas na H&E (Figura 3). Esses
aglomerados de bactrias foram identificados na intimidade de todos os tecidos
dos rgos e vsceras examinados. No foi observada reao inflamatria
circundando esses aglomerados bacterianos. A pesquisa de corpsculos de
incluso viral foi negativa.

134

3.3 Microbiologia
Todas as rs estudadas com esta sndrome albergaram cocos Grampositivos

de

diversas

espcies

gneros.

Assim,

foram

identificados

principalmente, Streptococcus uberis, S. agalactie, S. faecalis, S. dysgalactiae, e


Enterococcus spp. Staphylococcus spp foi identificado em 40% dos casos. Apesar
de no serem observados outros microrganismos nos cortes histolgicos
submetidos colorao de Gram, Edwarsiella tarda, Escherichia coli, Citrobacter
spp., Pseudomonas spp., Proteus spp, e Aeromonas hydrophyla, foram tambm
detectados eventualmente, mas sem um padro constante, nem quanto sua
presena nem quanto a combinaes entre eles.
Amostras de sangue colhido diretamente do corao das rs, coradas
pelo mtodo de Giemsa revelaram a presena de abundantes cocos, muitas
vezes em cadeias aderidos s paredes das hemceas, bem como no interior de
clulas de defesa (Figura 4).

3.4 Reao em cadeia da polimerase (PCR)


Nas rs estudadas, a pesquisa de ranavirus e S. iniae foi negativa.

3.5 Microscopia eletrnica de transmisso


No foram encontradas incluses tpicas de vrus, nem presena de
partculas virais.

3.6 Pesquisa do fungo Batrachochytrium dendrobatidis


As pesquisas do fungo foram negativas em todos os animais
estudados.

135

4 DISCUSSO E CONCLUSES
A anlise do conjunto de resultados permite evidenciar a presena de
um quadro particular, do tipo septicmico e super agudo, mediado principalmente
pelos estreptococos, que aps um perodo varivel de infeco sub-clnica,
conseguem proliferar em quantidades muito elevadas que rapidamente levam a
morte.
As septicemias tm sido reportadas como a causa mais importante de
mortalidade em anfbios, sendo freqente o achado de animais mortos sem
sintomas premonitrios (CRAWSHAW, 1994). Este mesmo autor assinala que os
microrganismos normais do meio ambiente podem tornar-se patognicos quando
os anfbios so submetidos a condies de estresse, sendo que a sintomatologia
observada no depende do tipo de microrganismo envolvido. Os resultados das
pesquisas realizadas confirmaram estas observaes.
Apesar da importncia das septicemias nos anfbios, o risco de isolar
bactrias oportunistas que entram no organismo submetido a condies de
choque e colapso generalizado elevado (NACE, 1974). O autor recomenda
utilizar amostras para processamento microbiolgico oriundas de rs que
sobreviveram pelo menos oito horas aps a colheita. As observaes do citado
trabalho indicaram que os resultados da bacteriologia para este quadro clnico
no so de completa validade.
Apesar dessas consideraes, os estudos microbiolgicos revelaram a
constante presena de cocos Gram-positivos. histopatologia, as quantidades
elevadas destas bactrias, formando verdadeiros aglomerados no parnquima
dos rgos, indicam o papel fundamental das mesmas no quadro. importante
ressaltar que estes microrganismos foram observados nos estgios prvios da
doena, em amostras obtidas de rs sem sinais evidentes, assim como em rs
com sintomatologia aguda (MAZZONI et al., dados no publicados). Isto sugere
que estas bactrias no pertencem aos invasores oportunistas. Esses cocos
foram detectados nos cortes de tecidos e nos esfregaos sanguneos, podendo o
quadro ser nomeado de septicemia estreptoccica.

136

Quando os tecidos foram submetidos a anlises bacteriolgicas de


rotina, outras bactrias principalmente bastonetes Gram-negativos tambm foram
identificadas, mas provavelmente pertenam ao grupo de invasores secundrios.
Septicemias por estreptococos ocorrem de forma espordica ou
epizotica em populaes selvagens ou de criao em grande numero de
espcies aquticas (ROMALDE et al., 2000; TORANZO et al., 2005).
Nas rs, diversos autores (GLORIOSO et al., 1974; AMBROSKY et al.,
1983, GUIMARAES et al., 1988) obtiveram na bacteriologia, resultados
semelhantes aos do presente trabalho.
Mortalidades de anfbios foram estudadas em relao a surtos na
natureza (CUNNINGHAM et al., 1996; BERGER et al., 1998; GREEN et al., 2002)
sendo identificados alm de diversos grupos de bactrias, agentes virais e fungos.
No presente estudo, no foi possvel incriminar esses patgenos como
responsveis diretos pela mortalidade.
Os estreptococos potencialmente patognicos podem ser albergados
de forma assintomtica por animais normais e humanos. O nmero de bactrias
limitado usualmente pelas defesas no especficas, requerendo a ao de fatores
desencadeantes para agir e produzir sintomas evidentes. Algumas espcies
chegam a produzir doenas quando estes mecanismos falham ou quando uma
cepa nova ou virulenta aparece (MITCHELL, 2003; IICAB, 2005).
As caractersticas do quadro clnico super agudo, de durao muito
curta desde o aparecimento dos sintomas at a morte, associadas aos achados
de necropsia e histopatologia sugerem a ocorrncia de um choque sptico,
devido quantidade e distribuio generalizada dos microrganismos.
Quadros de choque foram observados em estgios terminais das
doenas septicmicas nos anfbios com iguais caractersticas clnicas s
assinaladas no presente estudo. (NACE, 1974).
Choque sptico ou sndrome de choque txico (TSS) um quadro
amplamente conhecido no homem, caracterizado pelo rpido incio da doena
com febre, hipotenso, vmitos, diarria e eventualmente falha em mltiplos
rgos (SALLES et al., 1999; WHITE, 2000; MULLER-ALOUF et al., 2001). uma
condio muito grave e quase sempre fatal se no tratada de imediato, e ocorre
quando uma infeco generalizada determina diminuio do fluxo sanguneo e

137

perda conseqente da funcionalidade dos rgos vitais. A sndrome acontece em


indivduos imunologicamente comprometidos ou com doenas crnicas, e tem
como causa diversos microrganismos que liberam toxinas que danificam
diretamente os tecidos ou estimulam respostas inflamatrias exageradas.
Antecedentes de infeces urinrias, biliares ou do trato gastrintestinal so
tambm mencionadas como possveis causas predisponentes (ENCICLOPEDIA
MEDICA EN ESPAOL, 2004; IICAB, 2005; THE MERCK VETERINARY
MANUAL, 2005). A presena de severas leses hepticas e renais nas rs
estudadas corrobora com estas afirmaes.
Apesar de a patognese da sndrome no ser ainda bem conhecida, a
TSS produzida por superantgenos pertencentes famlia das toxinas
pirognicas

bacterianas,

principalmente

de

Staphylococcus

aureus

Streptococcus pyogenes e outros estreptococos do grupo A (GAS) de Lancefield


(SCHLIEVERT, 1993). S. pyogenes e GAS foram considerados os produtores de
uma sndrome especfica e diferente, chamada sndrome semelhante ao choque
txico [toxic shock like syndrome] (TSLS) com os mesmos sintomas, mas com a
adio de uma necrose severa dos tecidos (BOHACH et al., 1990; STEVENS,
1995). As causas do quadro so exotoxinas pirognicas de trs sorotipos (A, B e
C) e um superantgeno estreptoccico (SSA). Existe super estimulao dos
linfcitos T e das clulas apresentadoras de antgenos mediados pelas toxinas,
que determinam liberao de grandes quantidades de citocinas, desencadeando
uma cascata de respostas inflamatrias que leva ao aparecimento da sndrome
(SALLES et al., 1999; MULLER-ALOUF et al., 2001). O envolvimento de
bacterifagos na difuso dos genes codificadores das toxinas produtoras de TSLS
tm sido tambm demonstrado (KAPUR et al., 1992).
As fraes lipdicas dos lipopolisacardeos da parede celular das
enterobactrias foram tambm incriminadas na origem da sndrome (THE MERCK
VETERINARY MANUAL, 2005). Porm, no foram detectadas quantidades
destes microrganismos que pudessem evidenciar o envolvimento deles como
causa principal do choque. Entretanto, o papel destas bactrias no pode ser
descartado totalmente.
Trabalhos desenvolvidos nas ltimas dcadas tm revelado que outros
germes esto tambm envolvidos na produo da sndrome. KORMAN et al.

138

(2004) observaram estes quadros de choque associados ao Streptococcus equi


subespcie.

zooepidemicus

pertencente

ao

grupo

de

Lancefield.

microorganismo no possui nenhum dos genes conhecidos como produtor de


super antgenos GAS, mas mostrou evidencias de sua produo. S. canis e S.
equi subespcie zooepidemicus tm sido isolados de ces com TSLS. Os
sintomas observados foram, entre outros, vmitos, estado de choque, debilidade
e depresso extremas, convulses, dores intensas e hemorragias espontneas
levando a epistaxe e a esputos sanguinolentos. Os sunos albergaram com
freqncia o S. suis, sem sintomas, mas cepas virulentas podem causar doenas
severas com sintomas de labirintite, otite mdia e interna que levam a disfunes
vestibulares, meningite com tremores, incordenao, convulses e opisttomo.
O conjunto dos resultados obtidos permite-nos evidenciar a presena
de um quadro particular do tipo septicmico e super agudo em rs doentes.
O vrus do gnero Ranavirus foi descartado como produtor do quadro,
devido ausncia de resultados positivos na PCR, assim como na microscopia
eletrnica de transmisso.

Foi tambm descartado o papel do fungo B.

dendrobatidis, pois no foi possvel identific-lo nos estudos realizados.


Os achados do presente trabalho indicam a presena de uma sndrome
semelhante ao TSS ou TSLS em rs de criao, levantando a suspeita de que
este tipo de sndrome pode ser comum tambm em outras espcies empregadas
aqicultura. A observao de quadros de choque sptico em animais
pecilotrmicos reportada neste trabalho, requer novos estudos na procura de
maiores conhecimentos relacionados patognese e aos diversos mecanismos
envolvidos no aparecimento do quadro.

139

REFERNCIAS
1. AMBORSKI, R. L.; SNIDER, T. G.; THUNE, R. L.; CULLEY, D. D. A nonhemolytic, group B Streptococcus infection of cultured bullfrogs, Rana catesbiana,
in Brazil. Journal of Wildlife Diseases. Ames-IO, v.19, n. 3, p. 180-184, 1983.
2. A.V.M.A. 1993 Report of the A.V.M.A. Panel for euthanasia. Journal of the
American Veteterinay Medical Association, Ithaca-NY, v. 202, n. 2, p. 229-249,
1993.
3. BERGER, L.; SPEARE, R.; DASZAK, P.; GREEN, D.; CUNNINGHAM, A.;
GOGGIN, C.; SLOCOMBE, R.; RAGAN, M.; HYATT, A.; MCDONALD, K.; HINES,
H.; LIPS, K.; MARANTELLI, G.; PARKES, H. Chytridiomycosis causes amphibian
mortality associated with population declines in the rain forests of Australia and
Central America. Proceedings of the National Academy of Science,
Washington- DC, v. 95, n. 15, p. 9031-9036, 1998.
4. BERGER, L.; SPEARE, R.; HYATT, A. Chytrid fungi and amphibian declines:
Overview, implications and future directions. Ed. A. Campbell. Declines and
Disappearances of Australian Frogs. Environment Australia: Canberra. p. 2333, 1999.
5. BERGER, L.; HYATT, A.; OLSEN, V.; HENGSTBERGER, S.; BOYLE, D.;
MARANTELLI, G.; HUMPHREYS, K.; LONGCORE, J. Production of polyclonal
antibodies to Batrachochytrium dendrobatidis and their use in an
immunoperoxidase test for chytridiomycosis in amphibians. Diseases of Aquatic
Organisms, London, v. 48, n 3, p.213-220, 2002.
6. BLAUSTEIN, A.; DOBSON, A. Extinctions: A message from the frogs. Nature,
London, v. 439, n. 7073, p. 143, 2006.
7. BOHACH, G.; FAST, D.; NELSON, R.; SCHLIEVERT, P. Staphylococcal and
streptococcal pyrogenic toxins involved in toxic shock syndrome and related
illnesses. Critical Reviews in Microbiology. Boca Raton-FL. v. 17, n. 4, p. 251272, 1990.
8. BRASIL. Ministrio da Agricultura, Pecuria e Abastecimento. Mtodos
analticos oficiais para anlises microbiolgicas para o controle de produtos de
origem animal e gua. Instruo Normativa 62, de 26 de agosto de 2003. Dirio
Oficial [da] Republica Federativa do Brasil, Poder Executivo, Braslia, DF, 18
set., 2003. Seo I, p.14-50.
9. BRENNER, S.; HORNE, R. A negative staining method for high resolution
electron microscopy of viruses. Biochimica et Biophysica Acta. Amsterdam, v.
34, p. 103-110, 1959.
10. CRAWSHAW, G. Medicina de anfibios. In: Teraputica veterinaria de
pequeos animales. KIRK, R. W. & BONAGURA, J.D. Eds. Interamericana-Mc
Graw Hill. Mxico, 1994, p. 1355-1369.

140

11. CUNNINGHAM, A.; LANGTON, T.; BENNETT, P.; LEWIN, J.; DRURY, S.;
GOUGH, R.; MACGREGOR, S. Pathological and microbiological findings from
incidents of unusual mortality of the common frog (Rana temporaria).
Philosophical Transactions of the Royal Society of London.Series B,
Biological Sciences, London, v. 351, n. 1347, p. 1539-1557, 1996.
12. DASZAK, P.; BERGER, L.; CUNNINGHAM, A.; HYATT, A.; GREEN, D.;
SPEARE, R. Emerging infectious diseases and amphibian population declines.
Emerging Infectious Diseases, Atlanta, v. 5, n. 6, p. 735-748, 1999..
13. ENCICLOPEDIA MDICA EN ESPAOL, Coordenador KAUFMAN, D.2004.
Shock bactermico; shock endotxico; shock septicmico; shock caliente.
Disponvel
em:
http://www.nlm.nih.gov/medlineplus/spanish/ency/article/000668.htm Acesso em:
17 mar 2005.
14. GALLI, L.; PEREIRA. A. ; MARQUEZ, A.; MAZZONI, R. Ranavirus detection
by PCR in cultured tadpoles (Rana catesbeiana Shaw 1802) from South America.
Aquaculture, Amsterdam, v., 257, n. 1-4, p. 78-82, 2006.
15. GLORIOSO, J. C.; AMBORSKI, R. L.; AMBORSKI, G. F.; CULLEY, D. D.
Microbiological studies on septicaemic bullfrogs (Rana catesbiana). American
Journal of Veterinary Research. Chicago-IL, v. 35, n. 9, p. 1241-1245, 1974.
16. GONZALES-SANTANDER, R. Tcnicas de microscopia eletrnica en
biologa. Madrid, Aguilar, 1969, 666 p.
17. GREEN. D.; CONVERSE, K.; SCHRADER, A. Epizootiology of sixty-four
amphibian morbitidy and mortality events in the USA, 1996-2001. Annals of the
New York Accademy of Science, New York, v. 969, p. 323-339, 2002.
18. GUAYASAMIN, J.M.; BONACCORSO, E.; SPEARE, R.; MENDEZ, D. The
roles of climatic variation and pathogenic fungus in declining populations of
Aletopus cruciger (Anura: Bufonidae) in Venezuela. In:. Abstracts of the Joint
Meeting of the American Society of Ichthyologists and Herpetologists, 2002
[on line] Herpetologists' League, and Society for the Study of Amphibians and
Reptiles,
Kansas
City,
USA.
Disponvel
em:
http://www.asih.org/meetings/2002/Abstracts.pdf Acesso em: 21 jan. 2003.
19. GUIMARAES,N.; SILVEIRA,W.; RODRIGUES, M. Isolamentos de bactrias
patgenas nos ranrios de Gois e Par. In: VI ENCONTRO NACIONAL DE
RANICULTURA,1988, Rio de Janeiro. Anais VI Encontro Nacional de
Ranicultura. Rio de Janeiro: ARERJ, 1988, p. 287-291.
20. HANSELMANN, R.; RODRIGUEZ, A.; LAMPO, M,; FAJARDO-RAMOS
L.;ALONSO AGUIRRE, A.;. MARM KILPATRICK, A.; RODRIGUEZ J.P., DASZAK,
P. Presence of an emerging pathogen of amphibians in introduced bullfrogs Rana

141

catesbiana in Venezuela. Biological Conservation, Essex, v. 120, n. 1, p. 115119, 2004.


21. HIPLITO, M. Patologias em r touro (Rana catesbeiana Shaw 1802).
Primeira reviso da bibliografia brasileira. Arquivos do Instituto Biolgico de
So Paulo. So Paulo, v. 69, n. 2, p. 113-120, 2002.
22. HYATT, A.; GOULD, A.; ZUPANOVIC, Z.; CUNNINGHAM, A.;
HENGSTBERGER, S.; WHITTINGTON, R.; KATTENBELT, J.; COUPAR, B.
Comparative studies of piscine and amphibian iridoviruses. Archives of Virology,
New York-NY, v. 145, n. 2, p.301-331, 2000.
23. IICAB . Desenvolvido pela Iowa State University- AOIEC Center - Institute for
International Cooperation in Animal Biologics. An OIE Collaborating Center, 2005.
Apresenta textos sobre doenas infecciosas nos animais e riscos na sade
pblica. Disponvel em: http://www.cfsph.iastate.edu Acesso em 23 nov. 2005.
24. KAPUR, V.; NELSON, K.; SCHLIEVERT, P.; SELANDER, R.; MUSSER, J.
Molecular population genetic evidenco of horizontal spread of two alleles of the
pyrogenic exotoxin C gene (speC) among pathogenic cloes of Streptococcus
pyogenes. Infection and Immunity. v. 60, n. 9, p. 3513-3517, 1992.
25. KORMAN, T.; BOERS, A.; GOODING, T.; CURTIS, N.; VISVANATHAN, K.
Fatal Case of Toxic Shock-Like Syndrome Due to Group C Streptococcus
Associated with Superantigen Exotoxin. Journal of Clinical Microbiology,
Washington DC, v. 42, n. 6, p. 28662869, 2004.
26. LONGCORE, J.; PESSIER, A.; NICHOLS, D. Batrachochytrium dendrobatidis
gen. et sp. nov., a chytrid pathogenic to amphibians. Mycologia, New York-NY. v.
91, n. 2, p. 219-227, 1999.
27. LUFT, J. A. Improvements in an epoxy resin embedding methods. Journal of
Biophysics, Biochemestry and Cytology, v. 9, p. 409-414, 1961.
28. LUNA, L.G. Manual of histology staining methods of the Armed Forces
Institute of Pathology. 3.ed. New York: McGraw-Hill, 1968. 258p.
29. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000a, Cairns, Austrlia. Conference and Workshop Compendium. Cairns,
Rainforest CRC, p. 37-38, 2000.
30. MAZZONI, R. Diseases in farmed American bull frog (Rana catesbeiana
Shaw, 1802) in Uruguay. In: GETTING THE JUMP! ON AMPHIBIAN DISEASE,
2000b, Cairns, Austrlia. Power Point presentation. Disponvel em:
http://www.jcu.edu.au/school/phtm/PHTM/frogs/mazzoni.ppt, 2000. Acesso em: 30
mai. 2004.

142

31. MAZZONI, R. Doenas em ranicultura: Preveno e uso de vacinas. Boletim


do Instituto de Pesca. So Paulo, n. 34, p. 41-47, 2003.
32. MAZZONI, R.; CARNEVIA, D. Enfermedades de ranas en criadero: Una
limitante real para el desarrollo de la ranicultura. Resumos do Encontro Latino
Americano de Patologistas em Organismos Aquticos. Florianpolis, SC, v.2, p.
228, 2000, [resumos].
33. MAZZONI, R.; CUNNINGHAM, A.; DASZAK, P.; APOLO, A; PERDOMO, E.;
SPERANZA, G. Emerging pathogen of wild amphibians in frogs (Rana
catesbeiana) farmed for international trade. Emerging Infectious Diseases,
Atlanta-GA, v. 9, n. 8, p. 995-998, 2003.
34. MITCHELL, T. The pathogenesis of streptococcal infections: From tooth decay
to meningitis. Nature Reviews. Microbiology. London, v. 1, n. 3, p. 219-230,
2003.
35. MULLER-ALOUF, H.; CARNOY, C.; SIMONET, M.; ALOUF, J. Superantigen
bacterial toxins: state of the art. Toxicon, Oxford, v. 39, p. 1691-1701, 2001.
36. NACE, G. (ed.): Amphibians: Guidelines for the breeding, care and
management of laboratory animals. Washington D.C., NRC/NAS, 1974, 153p.
Disponvel em: http://www.nap.edu/catalog/661.html#toc , Acesso em: 15 fev.
2004.
37. REINOLDS, E.S. The use of lead citrate at high pH as an electron-opaque
stain in electron microscopy. Journal of Cell Biology, v. 17, p. 208-212, 1963.
38. ROMALDE, J.; LORES, F.; MAGARIOS, B.; BARJA, J.; TORANZANO, A.
Study of cell surface associated virulence factors of Streptococcus parauberis
strains pathogenic for turbot. Bulletin of the European Association of Fish
Pathologists. The Netherlands, v. 20, n. 6, p. 244-251, 2000.
39. SALLES, M.; SPROVIERI, S.; BEDRIKOW, R.; PEREIRA, A.; CARDENUTO,
S.; AZEVEDO, P.; SILVA, T.; GOLIN, V. Sndrome da resposta inflamatria
sistmica/sepse reviso e estudo da terminologia e fisiopatologia. Revista da
Associao Mdica Brasileira, So Paulo, v. 45, n. 1, p. 86-92, 1999.
40. SAMBROOK, J.; FRITCSH, E.; MANIATIS, T. Molecular cloning: A
laboratory manual. 2. ed. New York: Cold Spring Harbor Laboratory, 1989. 3v.
3104p.
41. SCHLIEVERT, P. Role of superantigens in human disease. Journal of
Infectious Diseases, Chicago, v. 167, p. 997-1002. 1993.
42. STEVENS, D. Streptococcal toxic-shock syndrome: Spectrum of disease,
pathogenesis, and new concepts in treatment. Emerging Infectious Diseases,
Atlanta, v. 1, n. 3, p. 69-78, 1995

143

43. SPEARE, R. Summary of formidable infectious diseases of amphibians.


In: AMPHIBIAN DISEASE HOME PAGE. Webmaster SPEARE, R. School of
Public Health and Tropical Medicine, James Cook University, 2003. Disponvel
em: http://www.jcu.edu.au/school/phtm/PHTM/frogs/formidable.htm. Acesso em:
11 jan.2005.
44. SPEARE, R.; BERGER L. Global distribution of chytridiomycosis in
amphibians.
Disponvel
em
:
http://www.jcu.edu.au/school/phtm/PHTM/frogs/chyglob.htm
2000. Acesso em:
20 mai. 2005.
45. THE
MERCK
MANUAL.
Septic
Shock.
Disponvel
http://www.merck.com/mrkshared/mmanual/section13/chapter156/156c.jsp
Acesso em: 16 nov. 2005.

em:

46. TORANZO, A.; DEVESA, S.; ROMALDE, J.; LAMAS, J.; RIAZA, A.; LEIRO, J.;
BARJA, J. Efficay of intraperitoneal and immersion vaccination against
Enterococcus sp. infection in turbot. Aquaculture. Amsterdam, v. 134, p. 17-27,
1995.
47. WATSON, M. L. Staining of tissue sections for electron microscopy with heavy
metals. Journal of Biophysics, Biochemestry and Cytology, v. 4, p. 475-478,
1958.
48. WENG, S.; HE, J.; WANG, X.; LU, L.; DENG, M.; CHAN, S-M. Outbreaks of an
iridovirus disease in cultured tiger frog, Rana tigrina rugulosa, in southern China.
Journal of Fish Diseases, Oxford, v. 25, n. 11, p. 423-427, 2002.
49. WHITE, W. Role of Superantigens in Staphylococcal and Streptococcal Toxic
Shock
Syndrome.
Disponvel
em:
http://www.bio.davidson.edu/Courses/Immunology/Students/spring2000/white/restrict
ed/TSS.html Davidson College Department of Biology, Davidson, NC, 2000. Acesso
em: 16 nov. 2005.
50. ZHANG, Q.; XIAO, F.; LI, Z.; GUI, J.; MAO, J.; CHINCHAR, V. Characterization
of an iridovirus from the cultured pig frog Rana grylio with lethal syndrome.
Diseases of Aquatic Organisms, Amerlinghausen, v. 48, n. 1, p. 27-36, 2001.
51. ZHANG, Q.; ZHE, Z.; XIAO, F.; LI, Z.; GUI, J. Molecular characterization of
three Rana grylio virus (RGV) isolates and Paralichthys olivaceus lymphocystis
disease virus (LCDV-C) in iridoviruses. Aquaculture, Amsterdam, v. 251, n. 1, p.
1-10, 2006.

144

CAPITULO 6
CONSIDERAES FINAIS
Foi caracterizada pela primeira vez em rs de criao do Brasil, uma
doena especfica que acomete girinos de at 30 dias de idade, cujo agente
etiolgico um vrus da Famlia Iridoviridae, gnero Ranavirus. Clinicamente foram
observados girinos com abdome aumentado de tamanho, com edemas e ascite,
assim como girinos finos ou emaciados. Revelaram leso localizada principalmente
no fgado e nos rins, com destruio quase completa do parnquima. Nenhum
agente bacteriano pde ser incriminado na etiologia da enfermidade. A presena
constante nos resultados da PCR de um vrus do gnero Ranavirus, associada aos
achados na histopatologia e na microscopia eletrnica de transmisso, confirmaram
o papel fundamental deste microrganismo nesta enfermidade.
Estudos de epidemiologia molecular realizados permitem incluir o vrus
detectado dentro do gnero Ranavirus. Observou-se homologia de quase 100%
nos setores do genoma estudado com aqueles do Frog Vrus 3, o que indica sua
possvel introduo com as rs importadas da Amrica do Norte.
Foi identificado quadro especfico em girinos na pr-metamorfose, no
qual o papel dos vrus no pde ser determinado. Nesta fase, bactrias
oportunistas, principalmente cocos Gram-positivos foram encontradas em
associao s leses. Estas predominam no fgado e rins, mas tambm alcanam
outros rgos internos. A leso de tipo necrtico-degenerativo, com resposta
inflamatria predominantemente de linfcitos mononucleares e formao de
granulomas. O quadro insidioso, apresentando-se com edemas, ascites e s
vezes lceras na pele. A leso estreptoccica coincide com os achados descritos
em criaes de trutas, linguados, bagres, e tilapias.
Nas rs, foi caracterizado quadro septicmico com sintomatologia
inespecfica, cursando de forma super aguda, aguda ou crnica. Nas fases
agudas predominam sintomas como letargia, apatia, edemas e ascite sendo que,
s vezes, as rs apresentam sintomas nervosos. histopatologia e microbiologia
o quadro comporta-se de forma semelhante quela observada nos girinos na prmetamorfose.

morte

conseqncia

da

septicemia

associada

ao

145

comprometimento funcional do fgado e rins, principalmente. Na fase crnica as


rs apresentam-se emaciadas e com posturas anormais sugestivas de leses
nervosas.
No foi possvel reproduzir a doena injetando as bactrias isoladas a
partir de animais com sintomas agudos, assim como no foi isolado de forma
constante e permanente um nico microrganismo. Vrus e fungos no foram
associados aos surtos estudados.
A doena observada em girinos na pr-metamorfose e nas rs, pode
ser considerada como uma septicemia estreptoccica secundria. As bactrias
cohabitam

inicialmente

os

tecidos

do

animal,

produzindo

leses

sem

sintomatologia evidente. Fatores individuais influenciados seguramente pelas


condies ambientais e de manejo determinam a evoluo a desenvolver-se em
cada animal. A presena de diversas espcies sem determinao de um
patgeno permanente ou constante indica o carter secundrio da infeco.
Porm, o papel dos cocos no pode ser descartado na evoluo da doena e,
portanto, devem ser levados em conta nos planos de controle sanitrio dos
ranrios comerciais. No foi possvel, nas condies deste estudo, determinar a
causa primria que antecede a invaso dos tecidos pelos estreptococos. O papel
primrio dos vrus detectados nas primeiras semanas de vida pode ter sido fator
desencadeante, favorecendo a invaso bacteriana observada em quadros de
animais mais velhos.
A sndrome denominada de perna vermelha no foi observada em
nenhuma das rs estudadas.

Os autores do presente estudo propem a

eliminao da terminologia cientfica do termo perna vermelha ou red leg, por


consider-lo fonte de confuso quanto etiologia do surto, bem como por fazer
referncia a evento que se apresenta em numerosas condies, associadas ou
no com agentes infecciosos.
Os achados do presente trabalho sugerem a presena de uma
sndrome semelhante ao choque sptico em rs de criao, levantando a suspeita
de que esta entidade possa ser tambm comum em outras espcies empregadas
na aqicultura.
Observaes a campo indicam que a aplicao de medidas de
biossegurana bsicas, comprovadamente imprescindveis em outras criaes

146

com maior desenvolvimento revelaram-se efetivas. Um vazio sanitrio de trs


meses, seguido de medidas de desinfeco adequadas controlaram a doena no
ranrio em estudo e tambm em outros ranrios.
O

fungo

Batrachochytrium

dendrobatidis,

agente

produtor

da

chytridiomicose, no foi identificado nas rs estudadas, no sendo, portanto


incriminado como responsvel nos surtos estudados. Tambm no foram
observados outros fungos incriminados como causadores de doenas de anfbios.