Você está na página 1de 21

20/03/2017 Captulo3

3.TransformadaWavelet
3.1Introduo

Astransformaesmatemticassoempregadasnomapeamentodefunesdeumdomnioparaoutro.As
transformaes so particularmente importantes em processamento e anlise de sinais porque no domnio
transformadoalgumaspropriedadesrelevantesdosinalficammaisevidentes.Paraacompressodeimagens,
umdosmtodosmaisutilizadosacodificaoportransformada,cujoobjetivoprincipaldatransformada
produzirumconjuntodevaloresrepresentandoospixelsreordenados,evidenciandoamaiorconcentraode
energiapossvelemmenornmerodecoeficientes.

Comojvimos,nocaptuloanterior,existevriosmtodosdetransformaesquepodemseraplicadosaum
sinal,entreosquaisatransformadadeFourieramaispopular.AtransformadadeFourierutilizafunes
bases (senos e cossenos) para analisar e reconstruir um sinal, alm disso, elas so funes ortogonais, as
quais possuem propriedades desejveis para a sua reconstruo. Tanto a transformada de Fourier quanto a
transformadawavelet so ambas reversveis, porm, a transformada de Fourier possui algumas limitaes.
Como veremos a seguir a transformada wavelet possui algumas vantagens, em especial nos casos onde a
transformadadeFouriernoapresentabonsresultados.

3.2ATransformadadeFourier

AtransformadadeFourierfoidescobertanoinciodosculoXIX,pelomatemticofrancsJosephFourier,
que mostrou que qualquer funo peridica pode ser representada como uma soma infinita de funes
exponenciaiscomplexasperidicas.Atualmente,atransformadadeFouriertemsidoutilizadaeminmeras
aplicaes em processamento de sinais. Na transformada de Fourier uma funo no domnio do tempo
mapeada em uma funo no domnio da freqncia, onde o seu contedo pode ser analisado. Esta
transposioocorreporqueatransformadadeFourierexpandeafunooriginalemtermosdefunessenos
e cossenos de durao infinita. A transformao inversa de Fourier transforma o sinal do domnio da
freqnciaparaodomniodotempo.

Sejax(t)umafunocontnuadavarivelrealt.AtransformadadeFourierdex(t),denotadopor{x(t)},
definidapelaequao[21]

{x(t)}= (3.1)

ouseja,umprodutointernodosinalx(t)comumconjuntodeexponenciaiscomplexas,queconstituemuma
baseortonormal.Naequaoacima,tusadopararepresentarotempo,fafreqnciaejiguala .

DadoX(f),x(t)podeserobtidousandoatransformadainversadeFourier(inverseFouriertransformIFT)
definidapelaequao:

1{X(f)}= (3.2)

Asequaes1.1e1.2existemsex(t)contnuaeintegrveleX(f)integrvel.NatransformadadeFourier
oXdenotaosinalnodomniodotempoenatransformadainversadeFourieroxdenotaosinalnodomnio
dafreqncia.

AtransformadadeFourierpodeserfacilmenteestendidaparaumafunodeduasvarveisf(x,y).Sef(x,y)
continuaeintegrveleF(u,v)integrvel,atransformadadeFourierdefinidapelaequao

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 1/21
20/03/2017 Captulo3

{f(x,y)}= (3.3)

eatransformadainversadeFourierdefinidapor:

1{F(u,v)}= (3.4)

ondeuevsoasvariveisdefreqncia.

Paraumaseqnciadeduraofinita,possveldesenvolverumarepresentaoalternativadatransformada
deFourier,referidacomotransformadadiscretadeFourier(discreteFouriertransformDFT).Umavezque
a transformada de Fourier no pode ser computada, a DFT, que uma verso amostrada, permite o seu
clculo computacional, e para sinais de tempo finito a DFT uma completa representao de Fourier do
sinal. Mais informaes descrevendo a DFT e a transformada rpida de Fourier (fast Fourier transform
FFT)podemserobtidasem[21,42].

3.2.1TransformadadeFourierdeTempoCurto

Asfunessenosecossenostmumsuporteinfinitoesobemadaptadasparaanalisarsinaisestacionrios
(sinaiscujocontedodefreqncianovarianotempo),pormnosoapropriadosparadescreversinais
noestacionrios(transientes),isto,aquelesnosquaisarespostaemfreqnciavarianotempo.Nenhuma
informaodefreqncia est disponvel no domnio do tempo do sinal, e nenhumainformaodetempo
estdisponvelnosinaltransformado(domniodafreqncia).AtransformadadeFourierpossuiresoluo
mxima em freqncia mas nenhuma resoluo no tempo. Isto significa que podemos determinar todas as
freqnciaspresentesemumsinal,pormnopodemossaberquandoelasestopresentes.

AtransformadadeFourierdetempocurto(shorttimeFouriertransformSTFT)umasoluoparaobter
melhorlocalizaonotempoefreqncianadecomposiodeumsinal[10,44].ASTFTumaversoda
transformadadeFourierqueutilizajanelasnotempo,eseusrespectivosdeslocamentos,comobasesparaa
transformada. Em anlise de sinais, existem vrias escolhas possveis para a funo janela g(t), sendo as
principais as que possuem suporte compacto e regularidade razovel. Quando a janela selecionada
Gaussiana,aSTFTconhecidatambmcomotransformadadeGabor.

ASTFTdeumsinalx(t)definidapor:

(3.5)

ondex(t)osinal,g(t)afunojanelacentradoem.

Quandobaixasfreqncias so observadas em um sinal necessrio uma longaobservaonotempo.Ao


contrrio,quandoaltasfreqnciassoobservadas,somenteumacurtaobservaonotemponecessria.O
princpio da incerteza de Heisenberg, da fsica quntica, estabelece que no podemos obter a informao
exatadafreqnciadeumsinaleoinstante/localexatonotempo/espaoondeestafreqnciaocorreu.Oque
podemossaberointervalodetempoosquaiscertasbandasdefreqnciaexistem.Comisso,nopossvel
obter alta resoluo em tempo e freqncia simultaneamente. Em outras palavras, um sinal no pode ser
representadocomoumpontonoespaotempofreqncia.

Pelo fato de uma simples janela ser usada para todas as freqncias na STFT, a resoluo da anlise a
mesmaemtodasaslocalizaesdoplanotempofreqncia.Umavantagemdatransformadawaveletquea
janelavaria,comissoteremosfunesbasescurtasparaaltafreqnciaelongasparabaixafreqncia.A
figura3.1mostraodiagrama,noplanotempofreqncia,asbasesdasfunesdeFouriereWavelets [17,
22].

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 2/21
20/03/2017 Captulo3

Figura3.1Diagramadoplanotempofreqncia.AesquerdarepresentaodebasesdeFourieredireita
representaodebaseswavelets.

Podemos observar na figura 3.1 ( direita) que baixas freqncias possuem a altura dos retngulos mais
baixas (que correspondem para melhor resoluo em freqncia), porm o comprimento mais longo
("pobre"resoluonotempo).Paraaltasfreqnciasocorreocontrrio.Estefatoimportantenaanlisede
sinaisjquegeralmentesooscomponentesdebaixafreqnciaquecaracterizamocomportamentodeum
determinadosinal,enquantoqueoscomponentesdealtafreqncianosfornecemosdetalhesdestesinal.

3.2.2FourierversusWavelets

A transformada de Fourier de tempocurto permite a anlise de um sinal em tempo e freqncia. J a


transformada wavelet, que veremos a seguir, permite decompor um sinal em componentes que so bem
localizados em tempo (via translao) e escala (via dilatao/contrao), introduzindo assim a anlise em
tempoescala.Nocasodewavelets,normalmentenofalamosemrepresentaotempofreqnciamasem
representaotempoescala,porqueotermofreqnciareservadoatransformadadeFourier.Apartirdaqui
usaremosotermotempoescala.Devidoaspropriedadesdelocalizaoemtempoeescala,atransformada
waveletpodefacilmentedetectarinformaolocalemumsinal.

AocontrriodatransformadadeFourier,atransformadawaveletnopossuiumnicoconjuntodefunes
base,massimvrios(infinitos)conjuntosdefunesbases(wavelets)possveis.

Atransformadadiscretawavelet(discretewavelettransformDWT)umafunoortogonalquepodeser
aplicada para um conjunto finito de dados. Ao contrrio das funes senos e cossenos da transformada de
Fourier,aswaveletsnoprecisamterduraoinfinita.Estesuportecompactopermiteatransformadawavelet
transladar uma funo no domnio do tempo em uma representao que no localizada somente em
freqncia(comoatransformadadeFourier)mastambmnodomniodotempo[8].Otermotranslao
usadonomesmosentidocomoeleerausadonaSTFT.Eleestrelacionadoalocalizaodajanela,quandoa
janeladeslocada(shifted)atravsdosinal.

Dopontodevistafuncional,atransformadadiscretadeFouriermuitoparecidacomatransformadadiscreta
wavelet, naquilo em que a funo de transformao ortogonal, so ambas invertveis, as matrizes da
transformada inversa so as transpostas das originais, o sinal de entrada assumido ser um conjunto de
amostrasdiscretaseambasastransformadassoconvolues[17,18].

3.3ATransformadaWavelet

Atransformadawavelet uma ferramenta que permite decompor um sinal em diferentes componentes de


freqncias, permitindo assim, estudar cada componente separadamente em sua escala correspondente. O
termo "wavelet" significa "pequena onda" (small wave em ingls ou ondelette em francs). O termo
"pequena"referesecondiodequeestafunodetamanhofinito(suportadacompactamente).

Atransformadawaveletcontnua(continuouswavelettransformCWT)emL2(R)podeserdefinidacomo
[11,45]

(3.6)
http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 3/21
20/03/2017 Captulo3

As funes wavelets ( a,b) so geradas de uma nica funo (t), denominada wavelet me (mother
wavelet)ouwaveletbsica,atravsdeoperaesdedilataesetranslaesdefinidacomo

(3.7)

ondea,bR,a0,oparmetrobrepresentaodeslocamentonotempo/espao,aofatordeescala(a>0

correspondeadilataoea<0paraacontraode(t)).Ofatordemultiplicao paranormalizao
2
daenergiaatravsdasdiferentesescalas.Almdisso,,L (R),satisfazaseguintecondio

(3.8)

Paraatransformadawaveletserinvertvel,afuno(t)devesatisfazercondiodeadmissibilidade

C= (3.9)

onde atransformadadeFourier,

.(3.10)

Se a condio de admissibilidade for satisfeita, a transformada wavelet contnua W(a, b) invertvel e a


transformadainversadadapelarelao

.(3.11)

AcondiodeadmissibilidadeimplicaqueatransformadadeFourierde(t)seanulanafreqnciazero,ou
seja

(3.12)

eafunowavelet(t)deveoscilar.Emoutraspalavras,(t)deveserumaonda.

3.3.1TransformadaDiscretaWavelet

Natransformadadiscretawavelet(DWT)osparmetrosdedilataoetranslaonovariamcontinuamente,
como no caso da transformada wavelet contnua, mas sim discretamente. Em certas aplicaes, incluindo
aquelasemanlisedesinal,podemosrestringirosvaloresdosparmetrosa,b(daequao1.7)aumagrade
discreta,fixandoumpassodedilataoa0>1eumapassodetranslaob00.Afamliadewaveletsde
interesse,paraj,kZ,tornaseento[11]

,ou(3.13)

(3.14)
http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 4/21
20/03/2017 Captulo3

Notequeistocorrespondepara

,(3.15)

(3.16)

indicandoqueoparmetrodetranslaobdependedataxadedilataoescolhida.Parajgrandeepositivo,a
funo j,0 bastante dilatada, e os passos de translao grandes ( ) so adaptados a esta grande
largura. Para j grande e negativo ocorre o contrrio a funo j,0 bastante contrada e os passos de

translaopequenos sonecessriosparaaindacobrirtodaaextenso.

Seassumirmosdilataesbinriasetranslaesunitrias,isto,a0=2eb0=1,afunowavelettornase

(3.17)

e constitui uma base ortonormal para L2(R). Dessa forma, teremos uma amostragem didica que mais
adequadaparaclculoscomputacionais.

3.4AnliseemMultiresoluo

O conceito de anlise em multiresoluo, desenvolvido por Mallat [32], permite analisar um sinal em
diferentesfreqnciascomdiferentesresolues.Comaanliseemmultiresoluopossvelobterumaboa
resoluonotempoepobreresoluoemfreqncia,quesetornatilpelofatodequeossinaisencontrados
emaplicaesprticasgeralmenteapresentamcomponentesdealtafreqnciaporcurtasduraesdetempo
ecomponentesdebaixafreqnciaporlongaduraodetempo.

UmaanliseemmultiresoluodeL2(R)definidaporumaseqnciadesubespaosfechadosVjL2(R),j
Z,satisfazendoasseguintespropriedades[9,29,32,45,63]:

a.Propriedadedeaninhamento

V2V1V0V1V2(3.18)

b.DensidadedaunioemL2(R)

densoemL2(R)e(3.19)

(3.20)

c.Propriedadedeescala

f(t)Vjf(2t)Vj+1jZ(3.21)

d.Propriedadedeinvarinciadodeslocamento

f(t)V0f(tn)V0nZ(3.22)

e.Existnciadeumafunodeescala

Votalque{(tk)|kZ}umabasedeRieszdeV0.(3.23)

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 5/21
20/03/2017 Captulo3

Se { (t k) | k Z} uma base ortonormal para V0, temos uma anlise em multiresoluo e as bases
waveletconstrudasde(t)sochamadaswaveletsortonormais.Afunochamadadefunodeescala
eusadaparaconstruirbaseswavelets.MultiresoluorequerumabaseparacadaespaoVj.Paraosoutros
subespaosVj(paraj0)definimos

j,k(t)=2j/2(2jtk)(3.24)
ondeondicejdenotaaescalaekindicaodeslocamentointeiro.

DesdequeV0V1,entoexisteumconjuntofinitodecoeficienteshktalqueafunodeescalasatisfaz

(t)= = .(3.25)

Esta equao conhecida por vrios nomes diferentes: equao de refinamento (refinement equation),
equao de dilatao (dilation equation) ou equao de diferena de escaladois (twoscale difference
equation).

Afuno(t)usualmentenormalizada,entotemos

.(3.26)

UmabasedeRieszdeumespaodeHilbertHumsubconjunto{e1,e2,...,en,...}deHtalque[e1,e2,...,
en,...]densoemHeexistemconstantes0<A<B< taisqueparatodaseqnciadeescalares0,1,
2,...temse:[9,19]

(3.27)

3.5FunesWavelets

ComotemosqueosubespaoVjVj+1,podemosdefinirWj,jZ,comoocomplementoortogonaldeVj
emVj+1,isto,umespaoquesatisfaz[9,29,45]

Vj+1=VjWjWjVj(3.28)

ondeosmboloasomadireta,euVj+1,u=v+w,demodoquevVjewWj,comv,w=0,
ouseja,cadaelementodeVj+1podeserescrito,demaneiranica,comoumasomadeumelementodeWj
comumelementodeVj.

OespaoWjcontmasinformaesdetalhe,necessriasparairdeVjemVj+1. Estas informaes detalhe


soextradasdosinaloriginalusandoafunowavelet(t).Consequentemente

Vj+1= ,eL2(R)= (3.29)

ondetodosossubespaosWjsomutualmenteortogonais,isto

WjWk,jk.(3.30)

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 6/21
20/03/2017 Captulo3

Figura3.2rvorededecomposiodatransformadawavelet.

Afunoumawaveletseoconjuntodefunes{(tk)|kZ}umabasedeRieszdeW0[63].A
coleodefuneswavelet{j,k|j,kZ}entoumabasedeRieszdeL2(R).

Umafuno(t)L2(R)talque{(tk)|kZ}ditaserortonormalseasfunesj,kformaremuma
baseortonormalparaW0.ParaosoutrossubespaosWj(paraj0)ekZ,definimos

j,k(t)=2j/2(2jtk).(3.31)

Estafunowavelet didica um tipo particular de transformada wavelet (outras dilataes so possveis,


porm dilataes didicas so mais prticas computacionalmente). Para a transformada unidimensional,
wavelets j,k,sogeradasporescalonamentobinrio(contraindoporumfatorde2)etranslaesdidicas
deumawavelet(t).

PelofatodequeV0eW0sosubespaosdeV1,V0V1eW0V1,podemosexpressarawavelet(x)em
termosdafunodeescala(t)

(t)= = ,(3.32)

paraumconjuntofinitodecoeficientesgk,demodoque

,(3.33)

satisfazendo

.(3.34)

Vimos at momento os aspectos tericos da transformada wavelet, todavia tudo isso seria de pouca
importnciaprticasenofossepelofatodepodermoscomputareficientementeoscoeficienteswaveletse
reconstruir funes a partir desses coeficientes. Estes algoritmos, conhecidos como transformada wavelet
rpida(fastwavelettransformFWT),soanlogosatransformadarpidadeFouriereseguemdaequao
derefinamentomencionadaacima.

VeremosaseguirafunowaveletdeHaar,umafunoortonormalqueapresentasuportecompactoea
formamaissimplesdewavelets.AfunodeHaargeradadiretamentedafunomeeconstituiumabase
ortonormaldeL2(R).

3.6AFunoWaveletdeHaar

AfunowaveletdeHaar,oqualserdiscutidoemmaisdetalhesnestaseo,oexemplomaissimplesde
wavelets. A transformada de Haar foi introduzida em 1910, por Alfred Haar [24], e o mais antigo dos
mtodos de transformada wavelet. A transformada de Haar usa pulsos quadrados para aproximar a funo
http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 7/21
20/03/2017 Captulo3

original.TransformadaswaveletutilizandofunesdeHaar,comofunesbases,soasmaissimplespara
implementaresocomputacionalmenteasmenosexigentes.

Naconstruodebaseswaveletsnormalizada,ofiltropassabaixadeHaarhkdefinidoporh0=h1= e
todos os demais coeficientes iguais a zero. Substituindo o filtro passa baixa de Haar na equao 1.25,
teremos

(t)=(2t)+(2t1)(3.35)

AsoluoparaestarecorrnciaafunodeescaladeHaar

(t)= (3.36)

AsfunesdeescaladeHaarsomostradasnafiguraabaixo.

Figura3.3FunesdeescaladeHaar(t),(2t)e(2t1).

OfiltropassaaltadeHaargkdefinidoporg0= ,g1= ezeroparatodososdemaiscoeficientes.


SubstituindoofiltropassaaltadeHaarnaequao1.32,teremos

(t)=(2t)(2t1)(3.37)

AsoluoparaestarecorrnciaafunowaveletdeHaar

(t)=

Asfunowavelet(t)mostradanafiguraabaixo.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 8/21
20/03/2017 Captulo3

Figura3.4FuneswaveletdeHaar(t),(2t)e(2t1).

Aplicando(t)paraf(t)teremos

<,f>= = ,(3.38)

ovalordamdiadefsobreointervalo[0,1).Aplicando(t)paraf(t)teremos

<,f>= = .(3.39)

Ofiltroumoperadordemdiaqueserveparasuavizarosinaleofiltroumoperadordiferenaque
utilizadoparareconstruirosinal.

Segueabaixoasrotinas,codificadasnalinguagemC,paracalcularatransformadadeHaaresuainversa,de
umsinalunidimensinalarmazenadonovetorM.Adecomposiodosinalefetuado vezes, que
corresponde a transformar o sinal at obter a menor resoluo possvel. O nmero de amostras do sinal
definidoemsize,osquaisdeveserpotnciade2.

voidHaar(intsize)
{

inti
while(size>1)
{

for(i=0i<size/2i++)
{

S[i]=(M[2*i]+M[2*i+1])/2/*filtropassabaixa(mdia)*/
S[size/2+i]=(M[2*i]M[2*i+1])/2/*filtropassaalta(diferena)*/

}
for(i=0i<sizei++)

M[i]=S[i]

size=size/2

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 9/21
20/03/2017 Captulo3

voidInvHaar(intsize)
{

inti,j=1
while(j<size)
{

for(i=0i<ji++)
{

M[2*i]=S[i]+(S[j+i])/*recuperaasamostraspares*/
M[2*i+1]=S[i](S[j+i])/*recuperaasamostrasimpares*/

}
j=j*2
for(i=0i<ji++)
S[i]=M[i]

Computacionalmente, a transformada de Haar tem uma complexidade linear, requerendo apenas O(n)
operaesaritmticas.Defato,seaplicarmosobancodefiltrosdesnteseparaumsinalcomnamostrasser
necessrio kn operaes para alguma constante k, ento o nmero total de operaes para computar a
transformadawaveletser

.(340)

Acadaetapadoprocessodedecomposiohierrquicaocustocomputacionalreduzidopelametade,com
exceodaprimeiraetapa,decorrentedasubamostragempor2.Ocustoinicialdeknoperaes,queser

reduzido para k que corresponde a metade da etapa anterior, porque utilizamos apenas a metade dos
coeficientes (coeficientes passa baixa), e assim por diante, limitando a um custo computacional de no
mximo2knoperaes.

3.7CodificaoSubbandaeBancodeFiltros

Umarepresentaoemtempoescaladeumsinaldigitalobtidousandotcnicasdefiltragensdigitais[44].
Filtrarumsinalcorrespondeaoperaomatemticadeconvoluodosinalcomarespostaaoimpulsodo
filtro. A CWT era computada mudandose a escala da janela em anlise, deslocando a janela no tempo,
multiplicandopelosinal,eintegrandosobretodootempo.Nocasodiscreto,filtrosdediferentesfreqncia
de corte so usados para analisar o sinal em diferentes escalas. O sinal passado atravs de uma srie de
filtrospassaaltaparaanalisarasaltasfreqncias,eatravsdeumasriedefiltrospassabaixaparaanalisar
asbaixasfreqncias.

3.7.1ReduonaTaxadeAmostragemporumFatorInteiro

Subamostragem (decimador) de um sinal corresponde a reduzir a taxa de amostragem (subsampling), ou


removeralgumasamostrasdosinal.Porexemplo,subamostrarumsinaldeentradaporumfatorde2refere
seaextrairumaamostraacadaduas,demodoqueosinaldesadaterametadedonmerodeamostras.
SubamostragemdeumsinalporumfatorMreduzonmerodeamostrasdosinalMvezes,ousejaxd[n]=
x[nM]=xc(nMT).

Arepresentaodosmbolodosubamostradorvistoabaixo[42].

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 10/21
20/03/2017 Captulo3

Figura3.5RepresentaodeumsubamostradordefatorM.

3.7.2AumentonaTaxadeAmostragemporumFatorInteiro

Superamostragem(interpolao)deumsinalcorrespondeaaumentarataxadeamostragem(upsampling)de
um sinal adicionando novas amostras para o sinal. Por exemplo, subamostrar um sinal por 2 referese a
adicionarumanovaamostra,usualmentezeroouumvalorinterpolado,entrecadaduasamostrasdosinal.
SuperamostragemdeumsinalporumfatorLaumentaonmerodeamostrasdosinalLvezes.

Arepresentaodosmbolodosuperamostradorvistoabaixo[42].

Figura3.6RepresentaodeumsuperamostradordefatorL.

3.7.3EsquemadeCodificaoSubbanda

A DWT emprega dois conjuntos de funes chamadas funes de escala e funes wavelet, os quais so
associadas com filtros passa baixa e filtros passa alta respectivamente. A DWT computada analisando o
sinal em diferentes bandas de freqncias com diferentes resolues atravs da decomposio do sinal em
componentesaproximao(ousmooth)ecomponentesdetalhe.Sooscomponentesdetalhequearmazenam
asinformaesnecessriasparapermitirareconstruodaimagemapartirdoscomponentesaproximao.

Figura3.7Codificaosubbandadeanlise.

A decomposio do sinal em diferentes bandas de freqncias obtida simplesmente por sucessivas


filtragens passa baixa e passa alta do sinal no domnio do tempo. Filtros passa baixa e passa alta juntos
constituemumbancodefiltros.Osinaloriginalsj(figura3.7)primeirofiltradoporumfiltropassabaixa
eumfiltropassaalta .Depoisdafiltragemdosinal,ametadedasamostraspodemsereliminadaspor
umsubamostradordefator2(2).Oresultadoserumsinalpassabaixa(sj1)eumsinalpassaalta(dj1),
cadaumdelescontendoametadedasamostrasdosinaldeentradasj.

Em processamento digital de sinais, os filtros e so chamados de filtros de quadratura espelhada


(quadraturemirrorfiltersQMF).Essesfiltrosforamestudadosantesdateoriawavelet.

Esta decomposio reduz pela metade a resoluo no tempo dado que somente a metade do nmero de
amostras agora caracterizam o sinal de entrada. O procedimento acima, que tambm conhecido como
codificaoporsubbanda,podeserrepetidaparaobterumadecomposioadicional[44].

Podemosconstruirumarepresentaohierrquicadeumsinalfiltrandorecursivamenteasadapassabaixa
dobancodefiltros.Esteprocessoilustradograficamentenafigura3.8paraquatronveisderesoluo(os
filtrosaplicadosquatrovezes),ondesjosinaloriginalqueserdecomposto(outransformado)e e so
filtros passa baixa e passa alta, respectivamente. Este esquema conhecido tambm como decomposio
piramidal.
http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 11/21
20/03/2017 Captulo3

Figura3.8Bancodefiltrosdeanlisehierrquico.

Asadasj4dobancodefiltrosumaversodosinaldeentradanumaresoluodezesseisvezesmenor.O
filtropassaaltaproduzoscoeficienteswaveletsparaonvel,eofiltropassabaixaproduzafunoescala
paraoprximonveldadecomposiohierrquica.

Os coeficientes da sada sj4 corresponde ao subespao V4 e os coeficientes dj4, dj3, dj2 e dj1,
correspondemaossubespaosW4,W3,W2eW1respectivamente.Oconjuntodeaproximaessucessivas
(Vj) juntamente com o conjunto de detalhes sucessivos (Wj) forma o que chamamos de decomposio em
multiresoluodosinaloriginal.

Nossistemasditosdedoiscanais,osinaldeentradatransformadoemduasbandas,sendoumadebaixa
freqnciaeoutradealtafreqncia.Quandoasbandasdebaixafreqnciaforementradasparaumoutro
sistemadebancodefiltros,idnticoaoprimeiro,criaseumaestruturadotiporvore,comonafigura3.8,
quedivideoespectrodosinaloriginalemoitavas.Afigura3.9ilustraadecomposiodosinalemoitavas,
queopontoinicialdoesquemaemmultiresoluo.

Figura3.9Decomposiodoespectroemoitava.

O processo de sntese, ou reconstruo, consiste em interpolar o sinal por um fator de 2 ( 2), ou seja,
colocarzerosentrecadaamostra.Emseguida,osinalfiltradoutilizandoumfiltropassabaixaHeumfiltro
passa alta G inversos aos filtros e , respectivamente. Uma representao do processo de sntese,
utilizandoumbancodefiltrosdedoiscanaisilustradoabaixo:

Figura3.10Codificaosubbandadesntese.

Afiguraabaixoilustraoprocessodereconstruohierrquicadeumsinalquefoitransformadoemquatro
nveisderesoluo.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 12/21
20/03/2017 Captulo3

Figura3.11Bancodefiltrosdesntesehierrquico.

Um banco de filtro digital uma coleo de filtros digitais, com uma entrada ou uma sada comum. O
esquemacompletoparaumbancodefiltroscomdoiscanaisdescritoabaixonafigura3.12.Eleenvolve
doisfiltrosdeanlise (passabaixa)e (passaalta)edoisfiltrosdesnteseH(passabaixa)eG (passa
alta).

Figura3.12Bancodefiltroscomdoiscanais.

UmaperfeitareconstruodosinaldeentradaSpodeserobtidacasosejarealizadoumprojetoapropriado
dos filtros de anlise e filtros de sntese do banco de filtros. Um banco de filtros dito ser um banco de
filtrosdereconstruoperfeita(perfectreconstructionfilterbank PRFB) seosinal de sada for igual ao
sinal de entrada, como na figura 3.12, e teremos nesse caso, os filtros de anlise seguido pelos de sntese
igualaidentidade

H +G =I,(3.41)

eosfiltrosdesnteseseguidopelosdeanliseaidentidadetambm,ouseja

H=I, G=0, H=0, G=I.(3.42)

Ateoriadebancodefiltrosestabelecequeparaeliminaraliasingarelao[66]

g1(n)=(1)n+1h0(n)eh1(n)=(1)ng0(n)(3.43)

devemsersatisfeitas,ondeg0(n)eg1(n)soosfiltrosdesnteseeh0(n)eh1(n)osfiltrosdeanlise.Neste
caso,temososfiltrosdesntesedefinidosemtermosdosfiltrosdeanlise.

3.8TransformadaWaveletAplicadoImagens

Afigura3.13mostraosprocessosdecompressoedescompressoaplicadosemimagensdigitais.Aperda
deinformaesgeralmenteocorremnaaplicaodatransformadawavelet(decorrentesdoarredondamentos
devaloresdepontoflutuante)enaetapadequantizao/limiar(threshold) dos coeficientes transformados.
Oscodificadoresdeentropiapermitemacompressosemquehajaaperdadeinformaes.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 13/21
20/03/2017 Captulo3

Figura3.13Diagramaemblocosdoprocessodecompresso/descompressodeimagens.

Atransformadawavelet direta mapeia os dados da imagem original para um outro domnio, sem fornecer
nenhuma compresso dos dados em relao a imagem original, porm a transformada inversa, em muitos
casos, permite uma reconstruo exata das informaes anteriores. Neste novo domnio os dados so
caracterizadosporumagrandequantidadedevaloresiguaisouprximosdezero,quetornaeficienteouso
de codificadores de entropia. A compresso realizada pela quantizao/limiar e pela codificao dos
coeficientes wavelets. A reconstruo da imagem efetuada invertendo as operaes do processo de
compresso.

Considerando novamente a transformada wavelet de Haar no normalizada, demonstraremos como


multiplicaesdematrizespodemserutilizadasparaefetuarasmdiasediferenas.SejaA1umamatriz8
8formadapelabasedeHaareassumindoMumvetorcom8elementoscorrespondenteaosdadosdeentrada
econtidoemV0.

Multiplicando a matriz M pela matriz A1 obteremos a matriz M, que corresponde ao primeiro nvel de
decomposio da matriz de entrada. Isto significa que os componentes de entrada separado em duas
seqncias,umarepresentadoasmdiaseoutraasdiferenas.AmatrizA1mostradaaseguir[37].

AoperaoacimacorrespondedecomposiodosubespaoV0emV1eW1.EmseguidaosubespaoV1,
quecorrespondeaoscoeficientesmdia,deversertransformado.Paraisso,deveremosmultiplicaramatriz
M pela matriz A2 resultando na matriz M. A multiplicao das matrizes alterar apenas os valores da
primeira metade do vetor. Esta operao corresponde decomposio do subespao V1 em V2 e W2. A
matrizA2emostradaaseguir.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 14/21
20/03/2017 Captulo3

Finalmente,amatrizMdeversermultiplicadoporA3.Comoadecomposiobinria,podemoster,no
mximo , isto , 3 nveis de decomposio didica. Chamaremos de N o resultado do produto da
matrizdeentradapelasmatrizesA1,A2eA3,queconsisteemdecomporosubespaoV0emV3,W3,W2e
W1.AmatrizA3mostradaaseguir.

A seqncia final formada pelo vetor N corresponde ao sinal original transformado. O primeiro elemento
dessaseqnciachamadodecoeficientedeescala(ouaproximao)eosdemaiselementosdessaseqncia
sooscoeficientesdetalhe,oucoeficienteswavelets.

Esteprocessoaplicadoseqnciaoriginalparaaobtenodeversesdemaisbaixaresoluochamado
de anlise ou decomposio e o processo para a obteno dos coeficientes da transformada conhecido
comotransformadawavelet.

Chamaremos de W a matriz formada pela multiplicao das matrizes A1, A2 e A3, respectivamente. Uma
representaodamatrizWapresentadaaseguir.

ComoascolunasdasmatrizesAisoortogonais,cadaumadestasmatrizessoinversveis.Denotaremospor

atransformadawaveletinversadeHaar,onde = .Amatriz mostradaabaixo.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 15/21
20/03/2017 Captulo3

SejaMamatrizdeumaimagem2r2r,entoaequaoQ=MWeM=Q expressamarelaoentreM

easlinhasdaimagemtransformadaQ,ondeW=A1.A2.....Ar= .Paraefetuaratransformaonas
colunas da imagem, devemos repetir os passos acima com a matriz transposta. Teremos ento a seguinte
equao, os quais expressa a relao entre a imagem original M e a imagem transformada nas linhas e
colunasN:

N=((M.W)T)T=WT.M.W(3.44)

eaequaodecomposio,outransformadainversa,dadopor

(3.45)

AaplicaodatransformadabidimensionaldeHaarpodeservistacomoaaplicaodatransformadadeHaar
em uma das dimenses e em seguida na outra dimenso da imagem. Este fato resultante de uma das
propriedades da transformada de Haar, conhecida por separabilidade. Esta propriedade de separabilidade
uma caracterstica importante, o qual faz da transformada wavelet uma poderosa ferramenta em
processamento de sinais em vrias dimenses. Para um sinal com uma dimenso n maior do que 1, a
transformadawaveletrealizadaatravsdatransformaodecadadimensodosinalindependentemente.

AtransformadawaveletdeHaarnormalizada,mencionadaanterior,podeserimplementadasubstituindoas

constantesiguaisa etodososcoeficientesiguaisa2,dasmatrizesAi,por e ,respectivamente.As


colunasdecadamatrizAiformamentoumabaseortonormal.Consequentemente,omesmoverdadeparaa
matrizW.

3.8.1TransformadaWaveletBidimensional

Existem duas maneiras pelo qual podemos usar wavelets para decompor uma imagem bidimensional [57]:
decomposiopadroedecomposionopadro.

Para obter a decomposio padro de uma imagem, primeiro aplicamos a transformada wavelet
unidimensional em cada uma das linhas da imagem. Esta operao fornece um coeficiente de mdia e os
coeficientesdetalheparacadalinha.Emseguida,tratamosestaslinhastransformadascomoseelasfossem
umanovaimagemeaplicamosmaisumavezatransformadaunidimensionalparacadacolunadaimagem.O
resultado destas operaes sero todos coeficientes detalhe, exceto o primeiro pixel, que corresponde ao
nico coeficiente aproximao (mdia). Neste caso, estamos levando em considerao a aplicao da
transformadaatobteromenornvelderesoluopossvel.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 16/21
20/03/2017 Captulo3

Figura3.14Transformadadiscretawaveletbidimensional.

Dado uma imagem x(m, n), ela inicialmente filtrada na direo m (linhas da imagem), resultando numa
imagem passa baixa L e uma imagem passa alta H. Aps a subamostragem, teremos ambas as imagens
reduzidaspelametadeemrelaoaimagemoriginal.Emseguidarealizaseafiltragemnadireon(colunas
daimagem)resultandoemquatrosubimagens:

LL(passabaixapassabaixa)correspondendoabandapassabaixaemambasasdirees.

LH(passabaixapassaalta)correspondendoabandapassabaixanadireoverticalepassaalta
nadireohorizontal.

HL(passaaltapassabaixa)correspondendoabandapassaaltanadireoverticalepassabaixa
nadireohorizontal,e

HH(passaaltapassaalta)correspondendoabandapassaaltaemambasasdirees.

A aplicao da transformada wavelet na imagem resulta em uma imagem com o mesmo tamanho mas
composto de trs imagens detalhes (HL, LH e HH) e uma imagem aproximao (LL), sendo que todas
possuemametadedaresoluodaimageminicial.

Este processo pode ser repetido novamente na subimagem LL, resultando em mais quatro subimagens, e
assimpordianteatquetenhamosapenasumnicocoeficienteaproximao.Omenornvelderesoluo
possvelconterumnicocoeficienteosquaisamdiadetodasasamostrasdosinaloriginal,isto,eleo
coeficiente DC ou freqncia zero do sinal. O algoritmo da transformada wavelet inversa construdo de
maneirasemelhanteaplicandooprocessoinverso.

Figura3.15Estgiosdedecomposiowaveletbidimensionalpadrocom5nveisderesoluo.

Aseguirmostraremosaaplicaodatransformadawaveletpadro,usandoaimagemLenna.Inicialmentea
transformadaaplicadoapenasnaslinhasdaimagem,eemseguidaapenasnascolunas.

Linhas

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 17/21
20/03/2017 Captulo3

Colunas

Figura3.16DecomposiopadrodaimagemLenna.

O segundo tipo de transformada wavelet bidimensional, chamada decomposio no padro, alterna entre
operaes nas linhas e nas colunas. Primeiro, calculamos um passo de mdias e diferenas no valor dos
pixelsdecadalinhadaimagem.Emseguida,calculamosasmdiaseasdiferenasemcadacoluna.Aps
estaoperaoobteremosaimagemdafigura3.17(c),compostaporquatroimagensmenores.Aimagemdo
canto superior esquerdo contm os coeficientes de baixa resoluo, correspondente mdia dos pixels da
imagem original, enquanto que as trs demais imagens contm os coeficientes de alta resoluo, os
coeficientes wavelets, que iro permitir a reconstruo da imagem. Para completar a transformao,
repetimosesteprocessorecursivamente,somentenosquadrantescontendoasmdias,emambasdirees.

SeumaimagemfordecompostaemNnveisderesoluo(N>0eNZ),issoimplicarnaobtenaode3N
+1subimagens.

Figura3.17Estgiosdedecomposiowaveletbidimensionalnopadro.

Afigura3.17ilustraoscincoprimeirosnveisderesoluodeumaimagembidimensionalapsaaplicao
da transformada wavelet no padro. Em (a) temos a imagem original, (b) a imagem aps a aplicao da
transformadaemsuaslinhas,(c)aplicaodatransformadanaslinhasenascolunas,umnvelderesoluo,
(d)aimagemcomdoisnveisderesoluoefinalmenteem(e)aimagemapscinconveisderesoluo.

Aseguirmostraremosaaplicaodadecomposiowaveletnopadro,usandoaimagemLenna.

Figura3.18DecomposionopadrodaimagemLenna.

Adecomposiowaveletpadrodeumaimagemmaisatraentepelofatoderequerersomenteoperaesem
umadimenso,ouseja,primeiroaplicaseatransformadaapenasnaslinhaseemseguidaapenasnascolunas
daimagem.Poroutrolado,umpoucomaiseficienteacomputaodadecomposionopadro.Parauma
imagem m m, a decomposio padro requer o clculo de 4(m2 m) operaes, enquanto que a

decomposionopadrorequersomente (m21)operaes[57].

Podemos verificar que a transformada wavelet permite armazenar uma imagem em diversas resolues,
ilustradotambmnafigura3.19.Dessamaneira,podemostransmitirinicialmenteoscoeficientesdaimagem
com menor resoluo, permitindo assim a visualizao de uma aproximao da imagem. Com isso,
http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 18/21
20/03/2017 Captulo3

possvel efetuar a reconstruo gradual da imagem pelo receptor. Em seguida, somente a informao
necessriaparaderivarumaversomaisdetalhadadaimagem,apartirdaimagemdemaisbaixaresoluo,
transmitida. Aps a transmisso de todos os coeficientes detalhe, o receptor ter uma cpia completa da
imagem. Este tipo de transmisso conhecido como transmisso progressiva (progressive transmission).
Paraatransmissoprogressivaoscoeficienteswaveletprecisamserarranjadosemordemdeimportncia.A
decomposioemmultiresoluodatransformadatornaseidealparaisso.

Figura3.19ImagemLennaemvriasresolues.

Uma visualizao da reconstruo gradual da imagem Lenna apresentado na figura 3.20. Inicialmente a
imagemreconstrudaapartirdoscoeficientesaproximaodoquartonveldedecomposiodaimagem
(matriz 16 16), em seguida com os coeficientes detalhe do quarto nvel de decomposio possvel
visualizaraimagem(b).Naseqncia,imagem(c),temosaimagemreconstrudaapartirdoscoeficientes
detalhe do terceiro nvel de decomposio e na imagem (d) a reconstruo a partir do segundo nvel de
decomposio.Finalmente,naimagem(e),temosaimagemoriginalreconstruda.

(a) (b) (c) (d) (e)

Figura3.20Reconstruoprogressivaapartirdaimagemcommenorresoluo.

As imagens geralmente apresentam mais informaes de baixa freqncia (pouca variao) do que
informaes de alta freqncia (muita variao). Em virtude disso, muitos dos valores resultantes da
aplicao do filtro passa alta (coeficientes detalhe) so muito pequenos em magnitude, como pode ser
observado analisando o histograma da imagem Lenna aps a aplicao da transformada wavelet com oito
nveisdedecomposio(figura3.21).Atransformadawaveletconcentraasinformaesdaimagememum
nmerorelativamentepequenodecoeficientes.Ohistogramaapresentasomenteumgrandepiconaorigem.
Isto significa que muitos coeficientes wavelets so iguais a zero e que uma grande quantidade desses
coeficientessoprximosdezero.Estacaractersticaquefazatransformadawaveletidealparacompresso
deimagens.Ospoucoscoeficienteswaveletdiferentesdezeropermitemumaboaaproximaodaimagem.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 19/21
20/03/2017 Captulo3

Figura3.21HistogramadaimagemdaLennaapsaaplicaodatransformadawavelet.

Os mtodos de compresso de imagens baseados na transformada wavelet devem tirar vantagem dessa
caracterstica das imagens. Armazenando os coeficientes da transformada possibilitar uma reduo
significante das informaes da imagem, sendo que a imagem original no permitiria quase nenhuma
compresso.UmarepresentaogrficadohistogramadaimagemoriginaldaLennadetamanho256256e
8bitsporpixelemostradonafiguraabaixo.

Figura3.22HistogramadaimagemoriginaldaLenna.

Se fixarmos um limiar e substituir por zero todos os coeficientes wavelets da imagem transformada, os
quaisovalorabsolutomenorouiguala,teremosumamatrizesparsa.Quantomaiorforolimiarmaior
ser o fator de compresso, pois uma maior quantidade de valores sero zerados, porm com uma menor
qualidade da imagem reconstruda. Este processo chamado de compresso sem perdas quando nenhuma
informaoperdida,isto,=0.Casocontrriochamadodecompressocomperdas(>0).Paraos
casosemque>0somenteumaaproximaodaimagemoriginalserpossvelobterapsareconstruo.

Podemosobservarqueaquantidadedeinformaosemantmamesma.Paracomprimirestescoeficientes
devemosaplicartcnicasdecodificaosemperdas,taiscomo:RLE,codificaodeHuffmanoucodificao
aritmtica.

Recorrendo a outras tcnicas de codificao, tais como LZW, EZW e Predio, podemos ainda explorar a
redundnciaqueexisteentreoscoeficientesdasdiversassubimagens,podendoaumentaraindamaisofator
decompresso.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 20/21
20/03/2017 Captulo3

(a) (b)

Figura3.23(a)Imagemoriginal.(b)Representaowaveletcomumnvelderesoluo.

Como vimos anteriormente, a aplicao da transformada wavelet divide a imagem em quatro novas
subimagens,(LL,HL, LH e HH). As subimagens detalhes (HL, LH e HH) enfatizam,respectivamente,as
caractersticasvertical,horizontalediagonaldaimagem,conformepodeserobservadonafigura3.23.

Oprocessopadroparaarealizaodacompresso(figura2.1)constituinaaplicaodaDWT,quantizaros
coeficientes wavelets resultantes (para compresso sem perdas os coeficientes no so quantizados) e
codificao sem perdas dos coeficientes quantizados. O mtodo mais simples para codificar esses
coeficientespercorrercadaumadaslinhas(daimagembidimensional),partindodocantosuperioresquerdo
efinalizandonocantoinferiordireito.Estaordemconhecidacomorasterscan.Oproblemacomoraster
scanqueasinformaesrelativasascorrelaesnaverticalsoperdidaseapresentaumadescontinuidade
aopassardeumalinhaparaoutra.

Figura3.24CurvadeHilbertpercorrendoumespaodedimenso1616.

Umaoutratcnicadecodificao,quepodeseraplicadanaimagemtransformada,acurvadeHilbert[40,
58].ACurvadeHilbertpermitepercorreraimagemseguindoumatrajetriaalternativaetomarvantagemda
correlaodospixelsnahorizontalevertical,decadaumdosquadrantesdaimagemseparadamente.

AcurvadeHilbertquebraadirecionalidadedosmtodosconvencionaisparaocasobidimensional,conforme
ilustradonafigura3.24.Umapropriedadedestacurvaadivisodosespaosdentrodequadrantes.Somente
aps um dos quadrantes ter sido totalmente percorrido, que o prximo dever ser percorrido, e assim
sucessivamenteataimagemtersidocompletamentepercorrida.

Umesquemaalternativoparacodificaodoscoeficienteswaveletsfoi recentementeproposto por Shapiro


[55]eaprimoradoporSaidePearlman[50],conformeapresentadonaseo1.3.

3.8.2CompressodeImagensColoridas

Oprocessodecompressodeimagenscoloridasutilizandoatransformadawaveletsedivideemduasetapas
[40]:umasendoaconversodaimagemdosistemaRGBparaosistemaYCbCr(Yocanaldeluminnciae
CbCrsoosdoiscanaisdecrominnciacorrespondenteaoazuleaovermelhotambmchamadoYUV)e
outra associada as operaes de decomposio, enumerao, quantizao e codificao de cada um dos
canais.

Como neste trabalho estamos interessados na compresso de imagens com nveis de cinza no iremos
detalharastcnicasusadasparacompressodestetipodeimagem.

http://www.dainf.ct.utfpr.edu.br/~ionildo/wavelet/cap3.htm 21/21