Você está na página 1de 375

Ministrio das Cidades

Secretaria Nacional de Saneamento Ambiental


Programa de Modernizao do Setor Saneamento

SISTEMA CONDOMINIAL
8PDUHVSRVWDDRGHVDRGD
universalizao do saneamento
Caderno 1
Sistema Condominial:
Teoria e seu processo de construo
Caderno 2
Metodologia do Sistema Condominial de esgotos
Caderno 3
Empreendimentos condominiais de esgotos no Brasil
Caderno 4
O Sistema Condominial na distribuio de gua
Caderno 5
O Sistema Condominial e seus porqus

Jos Carlos Melo


Braslia - dezembro de 2008

Ministro das Cidades: Marcio Fortes de Almeida


Secretrio Executivo: Rodrigo Jos Pereira-Leite Figueiredo
Secretrio Nacional de Saneamento Ambiental - SNSA: Leodegar da Cunha Tiscoski
Diretor do Departamento de Articulao Institucional - SNSA: Sergio Antonio Gonalves
Diretor de Desenvolvimento e Cooperao Tcnica - SNSA: Manuel Renato Machado Filho
Diretor do Departamento de gua e Esgotos - SNSA: Mrcio Galvo Fonseca
Coordenador do Programa de Modernizao do Setor Saneamento: Ernani Ciraco de Miranda
Autor: Jos Carlos Rodrigues de Melo
Colaboraram para a construo dos Cadernos, em reunies sistemticas para discusso dos
contedos, e em debates distncia, as seguintes pessoas:
Ernani Ciraco de Miranda - Coordenador UGP/PMSS/SNSA/MCidades
Martin Gambrill - Banco Mundial
Juclia Cabral Mendona - Engenheira UGP/PMSS/SNSA/MCidades
Miguel Vargas-Ramirez - Banco Mundial
Duncan Mara - Departamento de Engenharia Civil da Universidade de Leeds, Reino Unido
Pery Nazareth - Consultor tcnico
Ivan Paiva Jnior - Consultor Tcnico
Klaus Dieter Neder - CAESB
Csar Augusto Rissolli - CAESB
Maria Martinele F. Martins - CAESB
Maria Geny Formiga de Farias - CAERN
Roberta Henriques - EMBASA
Ester Navarro Ferreira - EMBASA
Srgio Pinheiro - SEMARH/RN
SNSA - Bloco A - 3o andar - Esplanada dos Ministrios - CEP 70050-901
Fone: (61) 2108-1000
www.cidades.gov.br
Programa de Modernizao do Setor Saneamento (PMSS)
pmss@cidades.pmss.gov.br
www.cidades.pmss.gov.br

M528s

Melo, Jos Carlos.


6LVWHPD FRQGRPLQLDO  XPD UHVSRVWD DR GHVDR GD
universalizao do saneamento / Jos Carlos Melo. Braslia :
*UiFD4XDOLGDGH
376p.(Programa de Modernizao do Setor Saneamento)
Cadernos sobre Teoria, Metodologia, Empreendimentos,
distribuio de gua, o Sistema e seus porqus
ISBN: 978856013384-0
1. Sistema condominial: teoria e seu processo de construo.
2. Empreendimentos condominiais de esgotos no Brasil. I.
Ministrio das Cidades. II. Miranda, Ernani Ciraco de.
CDD 323.

Coordenao editorial: Rosana Lobo - Consultora UGP/PMSS/SNSA/MCidades


3URMHWRJUiFRH&DSD0XULORGH/LPD0HGHLURV
Reviso: Daniel Bandeira
Diagramao: Fernando Fagundes - Consultor de Comunicao
,PSUHVVmR*UiFD4XDOLGDGH
Fotos e ilustraes do acervo e imagens de satlite obtidas do Google Earth Tiragem: 3.000 exemplares

TM

: Jos Carlos Melo

$VLGpLDVHRSLQL}HVH[SUHVVDVQHVWDREUDVmRH[FOXVLYDVGRDXWRUHQmRUHHWHPQHFHVVDULDPHQWHDSRVLomRGR0LQLVWpULRGDV&LGDGHVGD
Secretaria Nacional de Saneamento Ambiental, ou do Programa de Modernizao do Setor Saneamento.
permitida a reproduo total ou parcial desta publicao, desde que citada a fonte.

APRESENTAO
As publicaes da Secretaria Nacional de Saneamento Ambiental do Ministrio das Cidades, desenvolvidas
no mbito do Programa de Modernizao do Setor Saneamento (PMSS), propem disponibilizar aos agentes do
setor saneamento brasileiro, estudos e pesquisas relativos a temas institucionais, tcnico-operacionais, econmicofinanceiros, regulatrios e legais, afeitos aos servios de saneamento no Pas. Com esse objetivo, destaca-se a srie
Saneamento para todos, divulgada por meio da edio de livros e de uma revista peridica.
Ao disseminar os resultados de importantes experincias, contribumos para a busca da eficincia e da
qualidade da prestao dos servios de saneamento, para o aperfeioamento da gesto e conseqente ampliao da
cobertura dos servios em todo o territrio brasileiro. Temas que contribuem para o planejamento tm recebido
especial ateno por serem fundamentais ao avano do setor, em consonncia com as diretrizes da poltica de
saneamento do Brasil, que na esfera do Governo Federal de responsabilidade do Ministrio das Cidades.
O alcance de bases tcnico-institucionais slidas e a busca da universalizao dos servios de saneamento
so de inquestionvel relevncia para a salubridade ambiental, o desenvolvimento econmico-social e a melhoria da
qualidade de vida de nosso povo. Os dficits no atendimento de gua potvel e, sobretudo, de coleta e tratamento de
esgotos sanitrios, representam uma das maiores dvidas sociais do Pas, principalmente, com as camadas mais pobres
da populao, normalmente no atendidas pelos servios. Esse enorme desafio exige que se acelere o crescimento do
atendimento de forma a se alcanar a universalizao no menor tempo possvel.
Ao dirigirmos nosso foco ao esgotamento sanitrio, os indicadores atuais sinalizam que o Brasil tem pela
frente um trabalho ainda maior. Seguramente, o ritmo de investimentos ter que ser intenso, no s na quantidade de
recursos disponibilizados como no cronograma de execuo dos empreendimentos necessrios. Vale lembrar que o
Brasil tem at o ano de 2015 para cumprir as Metas do Milnio, estabelecidas pelas Naes Unidas.
Nesse contexto, um privilgio para o nosso Pas ter criado e desenvolvido a tecnologia dos sistemas
condominiais, hoje adotada em diversos pases do mundo. Em suas caractersticas residem aspectos fundamentais
para que a to sonhada universalizao do atendimento salte do discurso para a prtica: baixos custos, maiores
facilidades na execuo e adequados padres de qualidade tcnica, que se juntam ao planejamento participativo, com
mobilizao e participao social. Nesse especial aspecto, o sistema tem o mrito de absorver esforos e energias da
populao existentes e normalmente dispersos em favor da construo de uma soluo definitiva e sustentvel.
Por essas razes, o Ministrio das Cidades e o Banco Mundial decidiram publicar a srie de cadernos sobre
o sistema condominial, cujos primeiros cinco volumes esto sistematizados na publicao denominada Sistema
Condominial uma resposta ao desafio da universalizao do saneamento. Trata-se de um registro histrico que
destaca a importncia dessa tecnologia inovadora, dissemina os aspectos tcnicos importantes de sua concepo e
apresenta resultados prticos de sua implementao em diversos empreendimentos no Brasil.
Esperamos que esses cadernos contribuam para o desenvolvimento dos trabalhos de profissionais e gestores
do setor saneamento; para a formao de tcnicos e engenheiros em nossas escolas tcnicas e universidades; e,
sobretudo, lancem uma luz aos dirigentes pblicos para a tomada de deciso em relao melhor concepo dos
sistemas de esgotamento sanitrio e de abastecimento de gua.
Desejamos que a presente publicao contribua tambm para a mudana de paradigmas na gesto dos
servios de saneamento no Brasil, permitindo que solues inovadoras e sustentveis, baseadas no planejamento
participativo, sejam conhecidas e adotadas.
Leodegar da Cunha Tiscoski
Secretrio Nacional de Saneamento Ambiental do Ministrio das Cidades

O PROGRAMA DE MODERNIZAO DO SETOR SANEAMENTO


Compete Secretaria Nacional de Saneamento Ambiental do Ministrio das Cidades (SNSA/MCidades), como parte de
suas atribuies, fomentar o desenvolvimento do setor saneamento brasileiro, aportando assistncia tcnica, realizando estudos
e pesquisas, participando da capacitao das cidades e estados brasileiros no campo do saneamento bsico, colaborando com
a elaborao de marcos legais e planos de saneamento locais e regionais, enfim, investindo na estruturao da gesto e na
revitalizao dos prestadores de servios.
Parte dessas iniciativas tem sido desenvolvidas pelo Programa de Modernizao do Setor Saneamento (PMSS), atuando como
rea tcnica de suporte da Secretaria em diversos projetos estratgicos para as polticas pblicas do setor. A trajetria histrica
do Programa certamente oferece elementos que justificam a execuo em carter permanente dos projetos estruturantes que
desenvolve, com significativo impacto nos avanos do setor, os quais envolvem articulaes com diversos parceiros, nacionais
e internacionais.
O Programa consolidou-se, ao longo de seus quinze anos, como um instrumento permanente de apoio instncia executiva
da poltica de saneamento do Governo Federal, tendo suas aes voltadas criao das condies propcias a um ambiente
de mudanas e de desenvolvimento do setor saneamento no Pas, realizando um conjunto extenso de projetos, cuja sntese
apresenta-se a seguir.
I. O Sistema Nacional de Informaes sobre Saneamento (SNIS), que em 13 anos de implementao, consolida importante
instrumento de formulao e execuo de polticas e programas, de avaliao do desempenho dos servios e orientao s
atividades regulatrias, de fiscalizao e controle social sobre o setor.
II. O programa continuado de Assistncia tcnica a estados e municpios brasileiros que alcana gestores, reguladores e
prestadores de servios de saneamento com propostas de novos modelos de gesto e qualificao a partir do debate tcnicoinstitucional.
III. A Rede Nacional de Capacitao e Extenso Tecnolgica em Saneamento Ambiental (ReCESA), que agrega inmeras
instituies em torno dos Ncleos Regionais, entre universidades, prestadores dos servios e entidades do setor, na proposio
e realizao de uma agenda nacional de capacitao e intercmbio tcnico, em que o PMSS participa desde o incio como
instncia executiva.
IV. O Projeto Com+gua, cuja metodologia inovadora, no campo da gesto das perdas de gua e do uso de energia eltrica,
adota os conceitos e prticas nas reas de gesto, mobilizao social, educao e cultura, e comunicao social, como estratgia
principal que, integrada s solues tcnico-operacionais de engenharia, possibilitam alcanar resultados satisfatrios e
sustentveis.
V. O Sistema Integrado de Gesto de Servios de Saneamento (GSAN), que inaugura uma plataforma indita para o setor no
campo da assistncia e do apoio tcnico aos prestadores de servios, mediante disponibilizao gratuita de softwares pblicos
e livres.
VI. O componente de Estudos e Pesquisas, que se aprofundam em temas tcnicos, econmico-financeiros, poltico-institucionais
e de gesto, explorando assuntos importantes ao desenvolvimento do setor, ampliando a anlise e reflexo, propiciando o
conhecimento de tendncias e perspectivas de evoluo, enfim, contribuindo para a implementao e, ao mesmo tempo, a
avaliao de polticas pblicas, dentre as quais vale ressaltar:
a. O dimensionamento das necessidades de investimentos para a universalizao dos servios de Abastecimento de
gua e de Coleta e Tratamento de Esgotos Sanitrios no Brasil;
b. O programa de incentivo eficincia e ao resultado em aes de Saneamento Ambiental financiadas pelo FGTS ;
c. A qualificao das deficincias de acesso aos Servios de Saneamento Bsico no Brasil e Avaliao das Metas do
Milnio em Saneamento;

d. A descentralizao da prestao dos servios de gua e esgotos: O Caso do Estado do Mato Grosso;
e. A avaliao do impacto da Participao do Setor Privado na Proviso dos Servios de Abastecimento de gua e de
Esgotamento Sanitrio no Brasil;
f. A avaliao do Controle e vigilncia da qualidade da gua para Consumo Humano no Brasil, nos Termos da
Portaria MS n 518/2004;
g. O Sistema de Avaliao da Satisfao do usurio de servios de Saneamento (SASS);
h. Cadernos: Sistema Condominial - Uma resposta ao desafio da universalizao do saneamento.
VII. O fomento ao Desenvolvimento de Consrcios Pblicos, cuja iniciativa inicial foi a criao do 1 Consrcio Pblico de
Saneamento do Brasil o CORESA SUL do PI , tendo por base a Lei no 11.107/2005, estimulando o desenvolvimento de um
modelo alternativo de organizao e gesto dos servios, e abrindo caminho para a discusso nacional, que hoje ocorre em torno
deste modelo como opo aos arranjos, muitas vezes esgotados, vigentes no Pas.
VIII. A integrao com outras iniciativas da SNSA/MCidades, atuando tcnica e financeiramente no desenvolvimento dos
trabalhos, tais como no esforo de formulao e debate nacional da poltica de saneamento, aprovada na Lei no 11.445/2007; no
Programa Nacional de Combate ao Desperdcio de gua (PNCDA); no Programa Nacional de Gesto Pblica e Desburocratizao
(GESPUBLICA); no Programa de Educao Ambiental e Mobilizao Social em Saneamento (PEAMSS); e nos projetos de
promoo da melhoria do gerenciamento de resduos slidos; dentre outras.
IX. A Cooperao tcnica nacional, por meio de parcerias com o Programa Nacional de Combate ao Desperdcio de gua
(PNCDA); o Programa de Conservao de Energia Eltrica (PROCEL); a Associao Nacional dos Servios Municipais de
Saneamento (ASSEMAE); a Associao Brasileira de Engenharia Sanitria e Ambiental (ABES); o Instituto Brasileiro de
Administrao Municipal (IBAM); o Grupo Brasileiro de Avaliao da Participao do Setor Privado no Saneamento (GT PSP
Brasil); dentre outros, promovendo o desenvolvimento de estudos, guias tcnico-operacionais, projetos demonstrativos, eventos
e capacitao em temas de interesse do desenvolvimento do setor saneamento.
X. A Cooperao tcnica internacional, que por meio do Protocolo de Cooperao Brasil-Itlia em Saneamento, desenvolve
atividades de capacitao e especializao de gestores pblicos, sobretudo municipais, alm de estudos e pesquisas tcnicocientficas, servindo de motivao para a articulao institucional com importantes parceiros brasileiros municpios e
universidades e tambm internacionais.
XI. O projeto Mecanismo de Desenvolvimento Limpo (MDL) aplicado a Resduos Slidos, em parceria com o BIRD, Governo
do Japo e PNUD, que apia municpios brasileiros no desenvolvimento de estudos de viabilidade e capacitao tcnica para
intervenes que possibilitem a reduo das emisses de gases e conseqente venda dos certificados destas redues. O projeto
na rea de resduos slidos representa o incio de uma atividade com potencial para se estender aos sistemas de abastecimento
de gua e de esgotamento sanitrio, representando uma prtica inovadora do ponto de vista da oportunidade de ingresso de
recursos no setor.
XII. A parceria com entidades do setor saneamento brasileiro em atividades de Divulgao e disseminao de experincias,
apoiando tcnica e financeiramente eventos de diversas entidades.
XIII. O Projeto editorial do PMSS, com publicaes regulares que fomentam a reflexo poltico-institucional, o intercmbio e
a difuso tcnica, tendo desenvolvido a srie Modernizao do Setor Saneamento e nos ltimos anos ganhado flego renovado
com a Srie de Publicaes e Revista Saneamento para todos.
XIV. Os stios na internet, do SNIS (www.snis.gov.br) e PMSS (www.pmss.gov.br), que divulgam os estudos, publicaes e
experincias do Programa, assim como a base de dados do SNIS.

Sergio Antonio Gonalves


Diretor de Articulao Institucional da SNSA/MCIDADES
Ernani Ciraco de Miranda
Coordenador da UGP/PMSS-SNSA/MCIDADES

INTRODUO GERAL AOS CADERNOS

sistema condominial, pelos seus menores custos, maiores facilidades de execuo e indiscutvel qualidade
, hoje, o mais potente instrumento posto disposio das cidades, nos seus variados segmentos, para
enfrentar a sua gravssima problemtica de saneamento. Na sua conceituao fsica, ele concentra a coleta
em cada quadra urbana, vista como um condomnio, e descentraliza o processamento final dentro de critrios que
busquem a maior rentabilidade social. Nisto, e na sua atitude institucional, ele busca a incorporao de energias
a favor das solues e que provm da explorao de idias-fora como as da adequao realidade, da integrao
de agentes e aes, do gradualismo e, sobretudo, da participao comunitria. A variao de resultados alcanados
de um para outro sistema, dentro deste conceito geral, relativamente grande e a experincia tem mostrado que
os investimentos, a efetividade do atendimento e a satisfao dos usurios melhoram com a justa intensidade e a
maior criatividade com que sejam exploradas essas energias (evidentemente que para mesmos padres de execuo
de obras, operao dos servios e nvel de renda dos usurios).

Nesse contexto, o Ministrio das Cidades, atravs do Programa de Modernizao do Setor Saneamento (PMSS),
decidiu fazer realizar, e em seguida publicar Sistema Condominial - Uma resposta ao desafio da universalizao
do saneamento, srie to completa quanto possvel de informaes sobre o tema. Como orientao para o referido
trabalho, o PMSS elaborou circunstanciados Termos de Referncia, cujos pontos principais devem ser aqui
apreciados:
Por suas virtudes e caractersticas, organismos como a ONU, o BIRD e a OMS o consideram uma das mais
importantes inovaes no campo do esgotamento sanitrio surgidas no mundo nas dcadas recentes.
Concebido com a finalidade de possibilitar o atendimento pleno da populao pelos servios de saneamento,
o Sistema Condominial combina um conjunto de tcnicas de engenharia, otimizadoras das estruturas
fsicas... com um modelo de participao social. Busca a viabilizao das solues por meio da reduo de
custos e simultaneamente da mobilizao de recursos e energias da comunidade....
Servios de saneamento baseados no Sistema Condominial esto presentes hoje em centenas de cidades,
sendo que a maior parte delas no Brasil, mas tambm em outros pases da Amrica Latina e em outras
regies, sobretudo no hemisfrio sul. Seus exemplos mais relevantes so os empreendimentos do Distrito
Federal e da cidade do Salvador no esgotamento sanitrio, e o da cidade paraense de Parauapebas, na
distribuio dgua.
A importncia do sistema condominial e o interesse que tem despertado decorrem, entre outros fatores, de
seu potencial para a construo de solues econmicas e sustentveis... da capacidade de atender aos mais
exigentes padres de eficincia e de qualidade... da sua adaptao s situaes mais diversas e da rapidez e
simplicidade com que os projetos condominiais bem conduzidos podem ser implantados. Tem sido utilizado
com sucesso tanto em reas de urbanizao regular quanto em regies de ocupao desordenada e em
favelas... onde as solues tradicionais no so tecnicamente viveis.
A despeito de todo seu potencial, esse sistema se ressente, para sua melhor e mais segura expanso, de
uma documentao mais consistente no somente alusiva sua teoria e sua experimentao, mas,
principalmente, voltada para a sua operacionalizao.
Apesar de sua fama, ele ainda pouco conhecido em seus aspectos essenciais, mesmo entre os tcnicos do
setor, o que acaba refletindo na qualidade e eficincia de muitos sistemas implantados.
H, portanto, uma grande lacuna a ser preenchida no campo da documentao e das referncias sobre o
assunto.

Assim calcado, ento, o PMSS contratou o engenheiro Jos Carlos Melo, criador do referido sistema e que acumulou
considervel experincia sobre ele, nas trs ltimas dcadas, para a elaborao daqueles cadernos, que vieram a ser
em nmero de 5 (cinco), com a composio a seguir indicada*.
No primeiro deles - Sistema Condominial: Teoria e seu processo de construo esto contempladas as razes
que levaram criao e ao desenvolvimento do modelo condominial, as etapas de seu desenvolvimento e a prpria
histria de sua evoluo e, principalmente, os elementos tericos que lhe do sustentao e que foram se atualizando
e se robustecendo ao ensejo das experincias vivenciadas pelas mais diferentes equipes, diferentes locais e diferentes
circunstncias. Um verdadeiro aprendizado no curso das aes. Para que se sinta o comprometimento do modelo
com a realidade a que dever servir, dedicou-se, neste Caderno, uma especial ateno s cidades brasileiras, em
particular s suas reas sub urbanizadas**, onde esto pelo menos a metade da sua populao.
O segundo caderno - Metodologia do Sistema Condominial de esgotos embora considerando que o referido
modelo tem como uma de suas principais caractersticas a integralidade de seus conceitos, instrumentos e
componentes na construo de um Pacto, se esfora para conseguir sua abordagem segundo metodologias
especficas, sem perda da viso do conjunto, o que didaticamente o mais interessante. Nesse sentido, ento esse
segundo caderno destaca os seus trs principais aspectos, todos, porm influenciados pelas peculiaridades fsicas,
sociais, econmico-financeiras, ambientais, polticas, etc de cada caso. O aspecto Institucional, quando so definidas
as regras que presidiro cada empreendimento, os direitos e os deveres das partes; o Social, calcado na mobilizao
da comunidade no espao fsico dos seus condomnios; e a Engenharia a estar presente no processo, e que busca
sempre a conciliao entre o o melhor das disponibilidades tcnicas e o mais adequado s realidades locais.
J Empreendimentos condominiais de esgotos no Brasil, que assegura srie um carter absolutamente prtico,
o objetivo do Caderno 3. Ele traz, por excelncia, desse lado prtico, menos a descrio meticulosa de casos
especficos, e mais a apreciao do como e do que dos aspectos tericos do modelo que foram e puderam ser
aplicados em diferentes situaes e circunstncias. Nesse intuito, procurou-se ouvir alguns participantes de tais
empreendimentos, como forma de absoro de fatores presentes em qualquer poca e ainda no percebidos e,
sobretudo, para obteno de vises crticas de cada processo (a busca, enfim, do outro lado...). Esto nesse rol os
sistemas de esgotamento sanitrio condominial de cidades do Estado Rio Grande do Norte onde foram realizados
os primeiros experimentos; Petrolina, em Pernambuco, tambm nos primrdios do novo sistema; da Cidade do
Recife, capital de Pernambuco; do Distrito Federal (Braslia e cidades satlites); e a cidade do Salvador, Capital do
Estado da Bahia. Nesse espao, ento, se contemplou uma grande diversidade de condies urbanas, sanitrias,
sociais, econmicas e institucionais, nas suas discrepncias e nas facilidades ou dificuldades que apresentaram em
razo da implantao de sistemas de esgotamento.
O Caderno 4, por sua vez, apresenta O Sistema Condominial na distribuio de gua, que compreende a
adequao daquela teoria apresentada no primeiro caderno e a apresentao crtica dos casos mais notveis. Destaca
de antemo que, a par de uma formidvel economia no investimento dos sistemas de distribuio dgua construdos
segundo esse modelo bastante superior quela oferecida no caso dos sistemas de esgotamento sanitrio esse
modelo ainda mais se justifica pela extraordinria contribuio aos procedimentos que se fazem necessrios de
controle de perdas nesses sistemas. Isto se torna ainda mais relevante quando se considera o elevado patamar dessas
perdas nos sistemas de abastecimento dgua no Brasil. Os casos prticos considerados so os de algumas favelas
da cidade do Rio de Janeiro e da cidade paraense de Parauapebas, com cerca de 150.000 habitantes, considerada a
capital do minrio de ferro do Brasil.
Por ltimo, o Caderno 5 procurou esclarecer mais sobre O Sistema Condominial e seus porqus, tentando
estimular a motivao sua continuidade como contribuies dos vrios parceiros que o tm adotado. Mas o seu
contedo principal correspondeu discusso dos questionamentos mais conhecidos sobre o modelo e o debate , por
certo que otimista, sobre o seu desenvolvimento e sua potencial extrapolao a outros setores de atividades.
Na elaborao do trabalho, no h como recusar, a base foi a experincia acumulada pelo autor na sucesso de
oportunidades que lhe foi dada nas duas ltimas dcadas, ora como consultor autnomo, ora como dirigente da
Condominium Empreendimentos Ambientais Ltda, em oito estados do Brasil e abrangendo meia centena de

localidades. E essa experincia contou, em cada oportunidade, com a mais que valiosa contribuio das equipes
locais, sem as quais o sistema condominial no teria sado do papel e muito pouco teria sido incorporado ao
que eram as idias iniciais que fizeram nascer o novel sistema. essa experincia vieram somar-se, decisivamente,
contribuies das seguintes naturezas: a consulta a dados disponveis nas empresas detentoras desses sistemas;
coleta de impresses e discusses com participantes desses empreendimentos nas companhias estaduais*** do Rio
Grande do Norte (CAERN), do Rio de Janeiro (CEDAE), de Pernambuco (COMPESA), de Braslia (CAESB) e da
Bahia (EMBASA); contribuies crticas advindas de interessante processo de acompanhamento do prprio trabalho
de produo dos cadernos promovidas pelo PMSS e Banco Mundial, frente os engenheiros Ernani Ciraco de
Miranda e Martin Gambrill, respectivamente, reunindo dirigentes e especialistas de matrias que foram alm do
esgotamento sanitrio; sob a coordenao da incansvel e competente engenheira Juclia Cabral Mendona, do
PMSS; e com a ostensiva participao, co-autoria em vrios segmentos e avaliao crtica da melhor espcie em
todos os momentos, do engenheiro Pery Nazareth, tambm Diretor do Sistema de Esgotos da CAESB no perodo
1996-99, fase urea da consolidao do modelo condominial no Distrito Federal; um sincero agradecimento pela
atenciosa contribuio diuturna, com depoimentos e fornecimento de informaes valiosas, aos engenheiros Maria
Geny Formiga de Farias, Natanael Alves Ramalho, Ivan Paiva Jnior, Csar Rissoli, Clvis Nascimento e Joo
Miranda Neto; e, finalmente, agradecimentos coordenao editorial desta obra, que contou com a perseverante
consultora do PMSS, Rosana Lobo, e o apoio do jornalista Fernando Fagundes.

Jos Carlos Melo

A bem da verdade, alis, esses cadernos seriam editados separadamente, medida que fossem sendo concludos; a publicao
conjunta agora adotada, sem dvida mais racional, foi possvel graas maior simultaneidade na elaborao, mas no perdeu
o carter de relativa independncia de cada caderno, que presidia aquela orientao inicial. Da porque o leitor ir constatar
certa repetio de assuntos de um para outro caderno, mais prpria para aquela primeira forma de edio, mas que no deixa de
melhor concatenar as diversas partes do trabalho, mesmo que reunidas num nico livro, como agora se faz.
**

Pede-se a compreenso do leitor para esse neologismo adotado em todo o livro: que ele procura destacar uma grande parte
de assentamentos nas cidades brasileiras que esto muito abaixo das condies mnimas de uma verdadeira urbanizao. No se
trata, pois, de algo suburbano, mas sub urbano, abaixo do urbano.
***

Interessante destacar que esse processo, direcionado objetivamente para a produo do trabalho, ocorreu aps a implantao
dos sistemas (de 3 a 25 anos), j na fase de operao em regime dos servios.
OBS.: Desde os primrdios do sistema condominial, a gramtica foi, involuntariamente, contrariada, quando se escrevia o
nome da sua segunda instncia: micro sistema, e no microssistema, como devido. Perdo, pois, aos leitores, porque assim foi
grafado no decorrer deste livro.

SUMRIO
PREFCIO
CADERNO 1
SISTEMA CONDOMINIAL: TEORIA E SEU PROCESSO DE
CONSTRUO
1. INTRODUO AO CADERNO 1 ........................................................... 17
2. AS RAZES DETERMINANTES DO MODELO .................................... 18
3. OS FUNDAMENTOS DO MODELO E SUA BASE DE
SUSTENTAO ..................................................................................... 29
4. O PROCESSO DE FORMAO DO SISTEMA CONDOMINIAL .......... 44
5. AS PRINCIPAIS VANTAGENS .............................................................. 60

CADERNO 2
METODOLOGIA DO SISTEMA CONDOMINIAL DE ESGOTOS
6. INTRODUO AO CADERNO 2 ........................................................... 69
7. A IMPLEMENTAO DO PROCESSO CONDOMINIAL (Sua viso por
inteiro numa experincia-piloto) ............................................................. 72
8. OS COMPONENTES DE ENGENHARIA DO SISTEMA
CONDOMINIAL ..................................................................................... 78
9. OS SEGMENTOS ESPECIFICAMENTE CONDOMINIAIS ................... 98
$3/,&$d2'202'(/25(48,6,726'(6(-9(,6($/*816
INDICADORES ................................................................................... 139

CADERNO 3
EMPREENDIMENTOS CONDOMINIAIS DE ESGOTOS NO BRASIL
11. INTRODUO AO CADERNO 3........................................................ 145
12. RIO GRANDE DO NORTE.................................................................. 148
13. PETROLINA........................................................................................ 164
14. BRASLIA............................................................................................ 191
15. RECIFE............................................................................................... 214
16. SALVADOR......................................................................................... 225
17. ANEXO NICO................................................................................... 249

CADERNO 4
O SISTEMA CONDOMINIAL NA DISTRIBUIO DE GUA
18. INTRODUO AO CADERNO 4 ...................................................... 257
19. ORIGENS E FUNDAMENTOS TERICOS DO SISTEMA
CONDOMINIAL DE DISTRIBUIO DE GUA ................................ 258
20. METODOLOGIAS APLICVEIS AOS SISTEMAS CONDOMINIAIS
DE DISTRIBUIO DE GUA .......................................................... 268
21. O CONDOMINIAL NAS FAVELAS DO RIO DE JANEIRO ................ 281
22. SISTEMA CONDOMINIAL DE DISTRIBUIO DE GUA EM
PARAUAPEBAS ................................................................................ 303
23. CONSIDERAES FINAIS ............................................................... 329

CADERNO 5
O SISTEMA CONDOMINIAL E SEUS PORQUS
24. INTRODUO AO CADERNO 5 ....................................................... 333
$6'(=0$,25(648(67(635(6(17(6126$1($0(172
BRASILEIRO (E que, por tabela, terminam afetando o Sistema
Condominial) ...................................................................................... 335
'(=&/66,&2648(67,21$0(172662%5(26,67(0$
CONDOMINIAL .................................................................................. 345
27. OUTRAS POSSVEIS APLICAES DO MODELO CONDOMINIAL,
ALM DOS SISTEMAS DE GUA E DE ESGOTOS ........................ 357
$60(','$648()$5,$0%(0$26,67(0$&21'20,1,$/ 362
5(63267$6((6&/$5(&,0(1726$48(67(6/(9$17$'$6
POR OCASIO DA ELABORAO DOS CADERNOS .................... 369

PREFCIO

uma grande honra escrever o prefcio do livro de um dos meus


maiores dolos profissionais e pessoais. Conheci Jos Carlos Melo
num escritrio apertado de uma empresa de consultoria, em Recife,
h mais de 20 anos. Passei horas encantado enquanto ele me falava de
um mtodo revolucionrio para alcanar um objetivo modesto, embora
grandioso, de oferecer s pessoas servios de saneamento to fundamentais
para sua dignidade e sade. A idia do Jos Carlos combinava vrios
elementos centrais nos setores de engenharia, economia, institucional, de
comunicao e poltica.
Em termos de engenharia, Jos Carlos compreendeu que o critrio
espao (somente a opo A no desenho abaixo) era muito esparso. Isso
se juntou ao seu entendimento econmico de que havia uma variabilidade
substancial nos recursos financeiros e de tempo disponveis para as
diferentes pessoas, e que as pessoas deveriam poder escolher a tecnologia
que combinasse com seus recursos (e preferncias). Os mtodos-padro
para a coleta de esgoto (A no desenho) haviam sido desenvolvidos para
pessoas com muitos recursos financeiros e que valorizavam muito seu
prprio tempo. As tecnologias eram limitadas ou indisponveis para as
pessoas com menos recursos financeiros, mas com muito tempo disponvel.
Assim sendo, Jos Carlos trabalhou no preenchimento do critrio espao
(B e C no desenho).

Em termos institucionais, Jos Carlos tambm se deu conta de que as


tecnologias e as instituies estavam intimamente relacionadas e, desta
forma, no poderiam ser tratadas separadamente. O funcionamento de uma
companhia de gua e esgoto moderna envolve operaes padronizadas,
baseadas em tecnologias padro. Jos Carlos entendeu que ao expandir
o critrio espao-tecnolgico haveria mudanas radicais nos arranjos
institucionais. A razo era que companhias de gua eram mal equipadas
para lidar com o quadrante baixo custo financeiro/alto custo transacional
do critrio espao, enquanto que as organizaes de bairros eram bem

equipadas para lidar com esses arranjos altamente customizados e fora de


padro. Isso significava a necessidade de uma organizao institucional
radicalmente nova. A rede de coleta de esgotos deixaria de ser apenas uma
responsabilidade do prestador do servio, mas haveria entidades bastante
distintas, e necessariamente vinculadas, responsveis pela rede principal e
seus ramais. Para a infra-estrutura dos ramais (que significava tubulao de
esgoto rasa, comumente localizada nos quintais de assentamentos informais)
seria melhor que fosse construda e operada pelas comunidades, e recebesse
assistncia tcnica do prestador de servios. Para a rede principal, o modelo
de servio industrial padronizado era apropriado. H uma exceo a parte
de comunicao ou assistncia social da companhia de gua, que prestaria
assistncia tcnica aos grupos de bairro, teria que ser necessariamente um
novo tipo de organizao, que fundiria a engenharia com as habilidades em
organizao comunitria.
Em termos de comunicao, Jos Carlos compreendeu que o sistema jamais
funcionaria se fosse um sistema apenas para os pobres. Ele olhava esta
questo em duas partes. Primeiro, teria que haver um bom nome. Na poca,
a televiso exibia uma novela, popular e glamourosa, que dava grande
destaque figura do condomnio - e, assim sendo, Jos Carlos apropriou-se
desse nome porque era chique, mas tambm porque ele considerava que as
organizaes de bairros eram condomnios horizontais. Segundo, ele insistiu
que todo o critrio espao tinha que ser apresentado para uma variedade de
comunidades. Certamente, as escolhas seriam diferentes entre os grupos de
renda e ao longo do tempo. Mas todos tanto pobres quanto ricos tinham
que ter as mesmas opes.
Jos Carlos, com seus olhos brilhantes, atraa importantes lderes polticos
para a defesa da sua causa em seu estado natal de Pernambuco. Eu me lembro
de trs a dinastia progressista dos Coelhos, em Petrolina (que acabou
servindo como local de testes para a idia de Jos Carlos em escala de cidade);
Jarbas Vasconcelos, o legendrio poltico pernambucano que era prefeito de
Recife na poca; e Cristvam Buarque, governador de Braslia. Descendo a
escada de hierarquia, ele tambm me atraiu, porque Jos Carlos, comunista
intrigante que era, se deu conta que o selo de aprovao do Banco Mundial
seria de valor inestimvel. Isso se tornou realmente inestimvel, mais
ainda no combate reao de vrios dirigentes de companhias de gua que
resistiram mudana em seu confortvel modus operandi. E da nasceu a
parceria de duas dcadas entre Jos Carlos e o Banco Mundial.
O restante, como dizem, histria. Estima-se que cerca de 5 milhes de
pessoas em mais de 200 vilas e cidades, tanto pobres como ricos, esto
servidos com sistemas de saneamento condominial em todo o Brasil. E alguns
dos prestadores de servios, incluindo a CAESB, que atende a capital do
Brasil e est entre os lderes do setor, usa o modelo condominial para todos
os seus clientes (dos quais eu me orgulho de ser um!). Ao longo das dcadas,
sempre inspirado pelo trabalho do Jos Carlos, mas com um grupo crescente
de seguidores e lderes, o Brasil desenvolveu padres e normas nacionais de
desenho tcnico e de construo que permitem que os sistemas sejam usados
em todo o Pas.

Na mesma poca em que Jos Carlos estava desenvolvendo suas idias e as


colocando em prtica, outro de meus heris, o grande desenvolvedor de
comunidades paquistans, Akhter Hameed Khan, e seu discpulo arquiteto,
Arif Hasan, estavam desenvolvendo um conceito semelhante nas favelas de
Karachi. E dessas experincias dspares, mas convergentes, muitos benefcios
foram gerados para diversos pases em desenvolvimento, que estudaram,
aprenderam e aplicaram esses princpios s suas prprias realidades.
Vinte anos depois do primeiro encontro, voltei ao Brasil, agora como Diretor
do Banco Mundial para o Pas. Marcos Montenegro, Martin Gambrill, Ernani
Miranda, Pery Nazareth e outros da gerao seguinte (os filhos e netos
intelectuais do Jos Carlos) propuseram que fosse pedido ao Jos Carlos
escrever um manual que refletisse sua sabedoria e experincia nos 30 anos de
uso dos sistemas condominiais de gua e esgotos no Brasil. Essa importante
publicao, que pretende servir como guia explicativo para os tomadores de
deciso, governos locais, companhias de gua, consultores de engenharia,
comunidades e estudantes tanto o produto quanto outro tijolo na
parede. Mas, como dizem, a luta continua, e isso no o fim. Os prximos
passos no desdobramento deste esforo so: (i) preparar um segundo volume
sobre a experincia internacional com os sistemas condominiais; (ii) preparar
documentos complementares para atender demandas especficas quanto
aplicao do modelo em diferentes situaes; (iii) traduzir os volumes
para outros idiomas com base na demanda; e (iv) ajudar as companhias de
gua e os centros de ensino mais atuantes neste campo a montar centros de
excelncia para treinar engenheiros e outros profissionais (do Brasil e do
exterior) sobre como preparar e implementar abordagens condominiais para
a prestao dos servios de gua e esgoto.
Amigo Jos Carlos, com um enorme agradecimento e um grande abrao!

John Briscoe
Diretor
Banco Mundial - Brasil

Sistema Condominial

1. INTRODUO AO CADERNO 1

este primeiro Caderno da Srie Condominial, abordar-se- o estado


atual do modelo em seus aspectos tericos, voltado inteiramente para
o setor do esgotamento sanitrio, j que o abastecimento d'gua ser o
objeto exclusivo do Caderno 4 da mesma Srie. A sua teoria, contudo, genrica o suficiente para que possa ser adaptada a este e a outros campos de atuao.
Para que melhor se contextualize, contudo, este tema central estar aqui precedido com consideraes sobre a conjuntura do saneamento no Pas e numa
parte do mundo que justificaram e estimularam a criao e o desenvolvimento do modelo, sendo complementado com um esforo de demonstrao das
vantagens por ele oferecidas.

Assim, no captulo que segue esta introduo, esto as consideraes,


desdobradas em quatro tpicos que lhes so pertinentes. O primeiro o que
procura realar a importncia do saneamento para a humanidade (e para
cada cidade e cada homem em particular), como justificativa bsica para que
se faa o possvel no sentido de oferec-lo a todos. O seguinte tpico o que
se dedica a uma apreciao sobre a cidade que foi sendo produzida a partir
da segunda metade do sculo passado. Em pases em desenvolvimento
como o Brasil, a realidade muito diferente daquela que h sculos moldou
as tecnologias voltadas para os servios urbanos, onde na sua desordem de
topografia, de urbanizao, de habitao e de tudo o mais vem constituindo,
vergonhosamente, o habitat de uma metade mais pobre da populao desses
pases, a qual, em unssono, vem clamando por melhores condies de vida.
para estas cidades, portanto, nas suas duas metades - a rica e organizada e
a carente de quase tudo - que foi criado e desenvolvido o sistema condominial. O terceiro tpico do captulo, por fim, o que discorre sobre o estado do
atendimento atual da populao por servios de esgotos, quando se evidencia uma situao de verdadeira calamidade pblica. O ltimo aspecto destacado procura levantar outras questes problemticas que tm constitudo
obstculos implantao de sistemas de esgotos, as quais mereceram uma
ateno especial na nova formulao aqui apresentada.
No captulo 3, apresentado o estado atual da teoria do modelo condominial, desde as suas referncias bsicas, s idias que constituram a sua inspirao, concluindo-se com a apresentao dos seus mbitos de resoluo e de
suas respectivas tcnicas. Lembra-se que as questes relacionadas ao mtodo
de execuo e suas variantes sero o objeto do Caderno 2 da Srie.
No captulo 4, procura-se oferecer uma viso do processo de construo do
novo modelo, resultado de uma continuada pesquisa-ao, que foi realizada
ao ensejo de sucessivas oportunidades de sua aplicao prtica sobre cidades
que representaram as mais diversas realidades urbanas e institucionais, num
perodo de 25 anos, iniciado no comeo dos anos 80. O captulo se encerra
com algumas consideraes sobre as dificuldades - enriquecedoras, quase
sempre - vivenciadas nesse processo.
O captulo 5 apresenta as vantagens do modelo condominial na perspectiva de motivar os decisores do saneamento sobre seus menores custos, suas
maiores facilidades construtivas e operacionais e a sua condio mpar de
atender s mais diversas condies urbanas.
17

Sistema Condominial: teoria e seu processo de construo

2. AS RAZES DETERMINANTES DO
MODELO
O esforo de criao de uma ferramenta como esta precisou de razes muito
fortes - expostas neste captulo - para que tenha tido um incio e venha sendo
desenvolvido em carter permanente h quase 30 anos. A primeira dessas
razes a essencialidade dos servios de esgotamento sanitrio, fator que
qualifica extraordinariamente a demanda; a seguinte, a prpria grandeza
dessa demanda, representada atualmente por um contingente de mais de 2
bilhes de pessoas por serem atendidas no mundo, dentre elas cerca de 100
milhes de brasileiros; e a terceira dentre essas fortes razes, a falta de um
modelo adequado para as cidades que compem essa demanda sobretudo nos
aspectos relativos reduo de investimentos e maior flexibilidade diante das
variadas situaes urbanas a presentes. Um extraordinrio mercado, portanto!
Nesse sentido, discorre-se, aqui, sobre estas razes, detendo-se um pouco
mais nas questes caractersticas da diversidade das cidades e da problemtica
de suas imensas reas perifricas - fenmeno emergente a partir da segunda
metade do sculo passado, considerando-se, por fim, os fatores presentes nesse
universo urbano que tm constitudo potenciais obstculos implementao
de sistemas de esgotos. O modelo condominial, portanto, como condio
para no ficar tambm restrito s reas plenamente urbanizadas, como
os modelos tradicionais, buscou embasamento o mais concreto possvel
no conhecimento das realidades a que tambm haveria de igualmente
servir: as comunidades de bairros suburbanizados1 e favelas, ou seja, o
atendimento da cidade por inteiro.

2.1 A ESSENCIALIDADE
Pode-se afirmar, com segurana, que o abastecimento d'gua e a destinao
adequada dos esgotos estariam situados no primeiro patamar das
necessidades do homem. Estamos nos referindo a uma instncia de
ordem biolgica, vital - o homem posto apenas na sua dimenso animal.
Sem gua no h vida, sem esgotamento sanitrio no h sade e bemestar humanos. Preceito bsico. Onde a oferta desses servios escassa ou
de inferior qualidade, a vida, a sade e o bem-estar escasseiam na mesma
proporo.
Uma simples demonstrao prtica dessa essencialidade vem, por exemplo,
com o fato de que esses servios sempre ho de existir, sejam eles promovidos
pelo Poder Pblico, ou por iniciativa do prprio homem, espcie de autoservio. Os primeiros, que so os visveis aos olhos tcnicos, so melhores
ou piores em funo do gestor (onde esto os recursos de todas as ordens
e a competncia); e os ltimos, quase sempre precrios e invisveis, so
variveis em funo do ambiente natural e da condio socioeconmica e
cultural dos seus provedores.
Ao nvel social ou socioambiental, melhor dizendo - o conjunto dos
homens na cidade - os servios de saneamento esto entre os principais e
18

Sistema Condominial

insubstituveis instrumentos capazes de garantir a construo saudvel


das cidades, ou a correta insero das intervenes urbanas e da populao
no meio fsico. facilmente observvel em exemplos espalhados pelo
mundo inteiro, que faltando o todo ou partes desses servios, ou sendo eles
insuficientes ou precrios, no se realiza na forma devida esta insero.
E assim padecem, de alguma forma, a cidade, os seres humanos e o meio
ambiente: tanto maiores e mais potencializados os prejuzos, quanto maior a
simultaneidade de faltas ou precariedade desses servios.
No caso dos esgotos, alm do mais, um grotesco paradoxo est sempre
presente quando faltam os seus servios regulares: a potencial riqueza
energtica de seus componentes - gua e matria orgnica - deixa de se
constituir em aprecivel insumo para o sistema produtivo para se tornar o
mais perigoso instrumento de disseminao de doenas e de mal-estar
populao.
Essa demanda por servios de esgotos, portanto, est no primeiro patamar
das necessidades humanas - alm de gigantesca, o seu atendimento
imprescindvel, insubstituvel.

2.2 AS CIDADES NOS LTIMOS TEMPOS

Figura 1
Os apertados e difceis sistemas virios

As cidades brasileiras, sobretudo, as suas capitais, incorporaram na sua


urbanizao, a partir da ltima metade do sculo passado, o fenmeno
do apartheid social, caracterstico do seu modelo de desenvolvimento, o
que alis se estendeu por grande parte do mundo. Nelas, uma metade vem
absorvendo uma urbanizao cada vez mais avanada, e a outra metade,
muito ao contrrio, vem sendo desfigurada, na medida em que os stios
ocupados se apresentam em diferentes estgios de uma verdadeira sub
urbanizao. O panorama urbano ento produzido veio a retratar, com
realismo, uma situao de misria que no se supunha possvel, caracterizada
no apenas pela pobreza das pessoas, mas pelas mais indignas condies
de sua residncia e de sua urbanizao. No demorou, inclusive, para que
um grande nmero dessas reas fosse apropriado pelo crime organizado,
tornando-se reduto das mais variadas formas de violncia. O modelo
condominial, comprometido com a universalizao do atendimento,
precisou voltar-se tambm para essas cidades, para os seus mais diferentes
estratos scio-urbanos e toda a sua complexidade topogrfica, urbanstica e
habitacional. Urge, portanto, um retrospecto sobre elas, sobretudo, com foco
na abordagem, numa reflexo sobre aqueles aspectos que mais tm a ver com
os servios de esgotamento sanitrio.
Trata-se da formao crescente e progressiva das favelas e tantos outros
assentamentos desarrumados que foram constitudos espontaneamente,
margem de qualquer propsito urbanstico, entremeando as reas
urbanizadas ou lhes sendo perifricas. Esto sujeitos s mais desfavorveis
situaes topogrficas (ora pelo excesso de declividades e altitudes, ora
pela falta absoluta desses fatores), a elevadssimas densidades habitacionais
e ausncia ou grande precariedade de servios urbanos. Esses fatores
desfavorveis, e em particular os seus rudimentares sistemas virios,
compostos por becos, vielas e escadarias estreitas e desconfortveis, no
19

Sistema Condominial: teoria e seu processo de construo

somente impem obstculos cotidianos ao bem-estar da populao, como


tambm tm chegado a justificar, em muitos casos, a ausncia de servios
urbanos, inclusive os de saneamento bsico. Tudo se passa como se as
tecnologias e tcnicas usuais para esses servios no coubessem em tais
assentamentos...
Uma considerao especial nesse contexto vai para as habitaes neles
existentes, em especial para caractersticas que constituem problemas
para os servios de saneamento: a exigidade de espaos de convivncia e
de circulao (internos e externos), que complica a posio das prprias
canalizaes; a insuficincia das instalaes sanitrias, tanta, s vezes, que
chega a ser impeditiva do servio de coleta dos esgotos; a condio sui generis
dos seus micrologradouros locais , que so incompatveis, quase sempre, com
os procedimentos usuais do cadastramento dos servios. E, principalmente,
a violncia reinante que se faz presente diuturnamente sob a inspirao da
conhecida lei do mais forte, a qual, face ao desempenho dos servios, se
constitui em obstculo e fator de risco para cada uma das tarefas necessrias
gesto dos servios de saneamento.
As origens do problema, ainda persistentes, so bastante conhecidas e j
no requerem explicaes. No o xodo rural movido pela racional atrao
caracterstica das cidades equilibradas, mas uma ostensiva expulso dos
trabalhadores do campo pela subtrao cabal de seus mais elementares meios
de vida, associada ao despreparo dessas cidades em face de tamanha migrao.
Diante desse quadro, o sistema institucional, em todos os seus mbitos,
tem se mantido impotente, quase imobilizado. Nada faz para impedir ou
controlar a questo maior da migrao, nem to pouco para organizar
minimamente o processo de ocupao nas cidades. E as iniciativas adotadas
pelo lado corretivo, portanto, com atraso, mesmo quando tm xito
apenas atacam o varejo dessa problemtica, sem jamais vislumbrar
a perspectiva de uma soluo universal. Variveis nos seus objetivos,
contedos e metodologias, essas solues trazem em comum, contudo,
entraves evidentes desejvel generalizao. Dentre outros, a concentrao
de aes e investimentos exclusivamente pelo Estado, olvidando-se as suas
exguas disponibilidades em face do tamanho das demandas e a inadequao
de muitos dos padres adotados nas solues de problemas setoriais - seja
pelo elevado valor dos seus investimentos, seja pela sua feio pronta e
acabada que sempre as restringe a poucos.
Assim, portanto, fica evidente que a problemtica dessas periferias, na
sua complexidade e na sua extenso, deve ser reconhecida como a mais
complicada das questes urbanas que o mundo j conheceu. E onde o
acervo do conhecimento cientfico e tecnolgico disponvel, embora deva ser
suficiente para a produo de um seguro caminho para a soluo, ainda no
o encontrou. Mas a fora dos vrios aspectos a envolvidos - humanos, ticos,
morais e at mesmo econmicos - torna imprescindvel o encontro desse
caminho capaz de (re)humanizar as cidades. O sistema condominial vem
sendo colocado como um instrumento nessa direo, desde a sua origem,
no incio dos anos oitenta, no que tem aprendido extraordinrias lies nos
processos de desenvolvimento urbano, que se colocam como insubstituveis,
dentre elas:

20

Sistema Condominial

t BJNQPSUODJBEBJODMVTPEBTDPNVOJEBEFTDPNPTFVTBHFOUFT
efetivos, em todas as suas fases;
t BEFTDFOUSBMJ[BPEBTEFDJTFTFEBTBFTEPTQSPDFTTPTEF
planejamento para o mbito local;
t BDSJBPEFVNBQFSTQFDUJWBEFQFSNBOODJBOPEFTFODBEFBNFOUP
das aes.
Por ltimo, destaca-se um fato altamente positivo nesse contexto de
dificuldades que influenciou o modelo condominial: a capacidade
realizadora da populao residente nas reas consideradas, responsvel
pela quase totalidade do que se construiu, com o agravante de que tudo foi
feito sob as mais limitadas disponibilidades tcnicas, financeiras, materiais
e legais. Uma energia que no dever ser desperdiada, portanto, sobretudo
porque poder ser mobilizada em prol da reabilitao desses assentamentos.

2.3 A SITUAO DO ATENDIMENTO, HOJE, POR


SERVIOS DE ESGOTOS
Os sistemas separadores absolutos so considerados, no Brasil e em todo
o mundo, a soluo mais adequada para o esgotamento sanitrio urbano,
justamente, porque ao segregarem os esgotos das guas pluviais, tornam
exeqvel o processamento final dos efluentes, assim entendida a combinao
mais adequada possvel entre tratamento e disposio final. A condio
tima de funcionamento desse tipo de sistema - sanitria e socioambiental
- aquela onde a coleta universalizada e o processamento final, a par de
atender aos requisitos ambientais quanto destinao dos efluentes, possa
ainda constituir insumo para o sistema produtivo local. Os afastamentos
dessa condio so naturalmente redutores dos benefcios alcanveis, e,
nesse sentido, tm sido freqentes as duas situaes seguintes:
Figura 2
A ausncia de servios e a precariedade das
instalaes domiciliares

t BVTODJBPVJOTVDJODJBEPUSBUBNFOUPEPTFVFOUFT RVBOEP
ento se ganha com o afastamento dos esgotos do contato direto das
pessoas no seu habitat, ao tempo em que se agrava seriamente o
meio ambiente pelo agora canalizado afluxo dos esgotos, in natura,
aos cursos dgua;
t EJTUBODJBNFOUPEBVOJWFSTBMJ[BPEPBUFOEJNFOUPFNEFDPSSODJB
da falta de empenho de prestadores de servio na busca da efetiva
adeso dos usurios ( como se os seus trabalhos parassem com a
implantao dos seus coletores).
Com mais limitaes que esse sistema separador, mas ainda com certo
potencial de resoluo do problema dos esgotos urbanos, existem os
sistemas unitrios, que renem guas servidas e pluviais, e as fossas
spticas com sumidouros. Nos primeiros, os maiores inconvenientes ficam
com o tratamento dos efluentes, por conta dos grandes caudais das pocas
de chuva, fator esse que tem sido o principal desestimulador da soluo. J
as fossas tm ficado cada vez mais restritas s menores comunidades, pois os
seus sumidouros, quando no so dificultados por formaes impermeveis,
podem ser fortemente poluidores dos aquferos subterrneos.Os excludos
dessas formas de servio enfrentam o problema com os seus esgotos

21

Sistema Condominial: teoria e seu processo de construo

atravs de solues que tm uma mesma gnese, na sua forma e no seu


contedo. A forma, de um modo geral, passa pela ausncia do prestador
do servio local e por uma combinao, bastante varivel, de esforos e de
recursos financeiros dos prprios usurios e das prefeituras; o contedo, por
seu turno, algum tipo de fossa, como responsabilidade de cada usurio, e
um sistema de drenagem por parte das prefeituras. As fossas so bastante
variveis na sua eficincia, em funo do nvel de renda dos usurios, e
todas elas tendem a um precrio funcionamento. A drenagem varia desde
as conhecidas valas negras (que em tempo seco transportam esgotos e
com as chuvas espalham contaminao nas ruas e quintais), at a formao
de grandes malhas de galerias e canais destinados oficialmente s guas
de chuvas, mas que na prtica terminam por funcionar como arremedos
daqueles sistemas unitrios, por reunirem tambm os esgotos.
O estgio que utiliza as mais que precrias valas negras, caracterstico
daquelas reas suburbanizadas das cidades, constitui o que de mais
precrio e nefasto se possa imaginar para a salubridade urbana. Est a a
mxima exposio das pessoas ao contato direto com os esgotos (e com o
lixo que sempre precariamente coletado nessas reas) e, por conseqncia,
com as doenas de veiculao hdrica e a generalizada contaminao do solo
e das guas. Nessa inferior condio esto situados os estratos mais pobres da
populao, sem direito a excees mencionveis.
A evoluo das valas negras , do ponto de vista prtico, a formao de um
sistema unitrio de coleta das guas pluviais e servidas, ao ensejo do objetivo
maior da soluo que a pavimentao das vias. A drenagem assim executada,
porque precisa se combinar coleta dos esgotos, casa por casa, perde sua
possvel simplificao e deixa de usar a superfcie da rua, tornando-se intensiva
em redes e acumulando vrios inconvenientes. Dentre estes, o maior custo,
a formao de ambientes favorveis aos vetores, o desgaste das canalizaes
pela presena de gs, o pior desempenho da manuteno, etc. Apesar disso, a
soluo que vem predominando nas cidades brasileiras, escondendo sob o asfalto
o problema antes exposto e agravando a poluio dos recursos hdricos. No
parece haver maiores sinais de alterao desta tendncia, mesmo onde alguma
restrio legal se faz presente, acreditando-se que a maior parte da populao
urbana brasileira estaria nesta situao. O seu ltimo malefcio ocorrer adiante,
quando da chegada da soluo adequada, representada pelo sistema separador.
Ento, ele ser rejeitado por uma grande parte dos seus usurios - movida pela
enganosa sensao de resoluo do problema - da porque no iro aceitar a
responsabilidade por novos investimentos para refazer a antiga ligao unitria
(que junta esgotos e guas pluviais) e nem tampouco por uma tarifa mensal, visto
que o servio j existente gratuito.
No Brasil, estima-se que apenas um contingente da ordem de um dcimo
da sua populao urbana (que superior a 150 milhes de habitantes)
seja atendido com sistemas de esgotamento que combinam coleta e
tratamento adequados. Outra parte dessa populao urbana servida por
algum tipo de rede coletora, mas que no dispe do tratamento adequado,
e portanto est lanando seus efluentes nos cursos dgua que cortam as
cidades; estima-se que estejam atendidas nessa modalidade nada menos
do que 70 milhes de pessoas, ou cerca de 45% daquele total urbano. Toda
a imensa populao restante dispe seus esgotos sob formas ainda mais
precrias ou depende de solues individuais que utilizam os mais diversos
22

Figura 3
Estgios da soluo espontnea:
a vala negra, a tubulao
precria e, por ltimo, o sistema
unitrio a cu aberto

Sistema Condominial

grande quantidade desses


sistemas sanitrios, no
Brasil, bem que poderia levar
a pesquisas e estudos que
visassem o seu aproveitamento
em contextos adequados a
cada caso: ora pela incluso do
tratamento conveniente, ora pela sua
adequao - certamente que parcial como sistema separador.
A Condominium, ao ensejo de
realizar alguns estudos dessa
natureza no Estado da Bahia, em
apoio a empresas construtoras,
WHYHDRSRUWXQLGDGHGHYHULFDU
a possibilidade daquela segunda
hiptese em pelo menos duas
cidades, Jacobina e Lenis. Nesta
ltima, inclusive, com algumas das
recomendaes alusivas sendo
efetivamente aplicadas.

Figura 4
Situao do saneamento
no mundo
Fonte: Global Water Supply and Sanitation
Assessment 2000 Report - World Health
Organization and UNICEF

tipos de fossas, usualmente ineficazes em reas urbanas, sobretudo, naquelas


de maior concentrao populacional.
Exatamente por essa impropriedade que nas maiores cidades a existncia
de redes coletoras, quaisquer que sejam, praticamente indispensvel. No
entanto, quando efetivamente adequadas e associadas a processos adequados
de tratamento, elas ainda so poucas se considerarmos as maiores cidades
do mundo. Com efeito, tomando-se emprestadas da OMS e UNICEF as figuras
4 e 5, se pode depreender o quanto ainda pequena a presena dessas redes e
o quanto ela proporcional riqueza do mundo: quase a universalizao na
Amrica do Norte e na Europa, a menos da metade ou insignificantes ndices
nos demais continentes. Ou seja, os mais ricos do mundo tm quatro vezes mais
chances de dispor de uma forma adequada de destinao para os seus esgotos.
Na America Latina, a situao varia de pas a pas, com pouco mais de 6 em
cada 10 habitantes dispondo de algum tipo de coleta de esgoto, segundo
estimativas desses organismos internacionais. No se sabe ao certo os ndices
de tratamento, mas a poluio quase onipresente nos corpos dgua urbanos
sugere que a maior parte dos esgotos no tratada.

Olhando para o planeta como um todo, em mdia, a situao ainda pior do


que na Amrica Latina. Apenas 4 em cada 10 habitantes das cidades do mundo
no desenvolvido dispem de algum tipo de coleta de esgoto, contrastando
com a sua parcela rica, onde o problema se encontra praticamente

23

Sistema Condominial: teoria e seu processo de construo

equacionado (80% de cobertura de coleta de esgoto nas reas urbanas - e


provavelmente com tratamento), conforme as estimativas da OMS.
Em resumo, a situao da populao no que se refere a servios de esgotos
perfeitamente visvel, quase dispensando mensurao. Com efeito, ela se
caracteriza pelo grande nmero de desatendidos de tudo, pelo extraordinrio
universo dos que so precariamente atendidos e pelo contingente reduzido
daqueles que contam efetivamente com uma soluo adequada na coleta e na
disposio dos efluentes.
No demais realar aquela constatao quanto determinao quase que
exclusivamente pela renda, no Brasil e no mundo, das condies do atendimento
por sevios de esgotamento sanitrio, do que decorre, por sua vez, o prprio
nvel de sade e bem-estar social, qualquer que seja o lugar do planeta.
Tanto o desatendimento direto da populao por sistemas de esgotos, como as
formas inadequadas e parciais que vm sendo utilizadas crescentemente, so
causadores de impactos ambientais extremamente nefastos sobre os recursos
naturais, sobre a prpria cidade e sobre as condies de vida de sua populao.
Para se faa uma idia desta situao, considere-se, por exemplo, o fato
de que nenhuma metrpole ou grande cidade brasileira consegue
esconder a degradao progressiva do seu meio ambiente, sobretudo
e principalmente, dos seus recursos hdricos, na decorrncia direta da
ausncia ou insuficincia de sistemas de esgotos sanitrios. De tal condio
24

Figura 5
Cobertura com saneamento,
segundo os nveis de renda
Fonte: Alcanzar los ODM em matria
de gua potable y saneamiento

Sistema Condominial

j no se pode mais excluir qualquer complexo de guas, sejam rios,


lagos, manguezais ou esturios, e at mesmo guas ocenicas, com as suas
excepcionais praias.
Com efeito, qualquer anlise que se faa do quadro sanitrio das cidades
que no possuem o adequado sistema de esgotamento traz consigo,
implicitamente, a ocorrncia de um regime permanente de poluio,
destruidor progressivo do meio ambiente natural e daquele que a cidade
produziu, impactando a sociedade em cada uma das suas fases. Quando no
coletados corretamente, os esgotos seguem os mesmos caminhos das guas
drenadas, tornando-se inevitveis agentes poluidores, sucessivamente ou
simultaneamente, dos aqferos subterrneos e dos cursos dgua superficiais.

2.4 AS OUTRAS DIFICULDADES QUE O NOVO


MODELO PROCUROU SUPERAR
Alm das questes problemticas j colocadas e que foram contempladas no
desenvolvimento do sistema condominial, h outras tantas que foram ensinadas
pelo modelo de esgotamento usualmente denominado convencional. Da a
importncia da sua crtica para a concepo e o desenvolvimento do novo
modelo. O modelo convencional ainda o mais utilizado para o esgotamento
sanitrio das cidades, sobretudo, pela fora da tradio. Ele comporta variaes
de um para outro executante, mas tem em comum, de uma maneira geral, duas
caractersticas importantes. A individualizao da coleta ao nvel de cada prdio
e que lhe determina uma rede coletora extensiva a todas as ruas, e a tendncia
concentrao do processamento final, desta feita, trazendo a necessidade
de pesadas estruturas de transporte. Na decorrncia dessa concepo, vm
os seus elevados custos de implantao, enormes dificuldades construtivas
e uma caracterstica inflexibilidade diante da realidade das cidades e de seus
concessionrios. Examinar cada um desses aspectos o propsito do que se segue.

Elevados investimentos
Os seus ramais prediais, alm de obrigarem aquela mxima extenso de
rede, determinam, tambm, as suas maiores profundidades, j que so elas
decorrentes das exigidas pelos ramais que tm a posio topogrfica mais
desfavorvel.
Maiores a extenso e as profundidades, maiores tambm, evidentemente, os
obstculos encontrados nas escavaes: a quebra e reposio de pavimentos,
os custos de escoramentos que asseguram a estabilidade das valas mais
profundas; a maior probabilidade de ocorrncia de lenol fretico a exigir
rebaixamento; o encontro de rochas que demandem maiores esforos de
desmonte ou at o uso de explosivos; ou ainda, interferncias com outras
obras de infra-estutura e que obrigam uma quase sempre desconfortvel e
cara conciliao. A centralizao do processamento final, por seu turno,
quando mais uma decorrncia de ordem ideolgica do que resultante
25

Sistema Condominial: teoria e seu processo de construo

de uma bem cuidada anlise pelo lado da rentabilidade social, termina


conduzindo a enormes estruturas de transporte e, novamente, grandes
escavaes e suas conseqncias. Tem-se, portanto, nesta concepo, a
tendncia a maximizao de custos.

'LFXOGDGHVFRQVWUXWLYDV
Alm daquelas profundidades, em si s responsveis por mais exigentes
requisitos construtivos - experincia, maquinrios, mo-de-obra
especializada - a construo de um sistema com essas caractersticas traz
ainda um extraordinrio transtorno cidade, representado, sobretudo,
pela interdio de vias: alm de uma rede em cada logradouro, tambm os
ramais, em sua totalidade, rasgando transversalmente as vias (tantos quantos
sejam os prdios da cidade). Como os sistemas de esgotos so quase sempre
os ltimos a chegar, quando chegam quase sempre encontram as ruas
pavimentadas, e a renovam-se os problemas.
As estruturas de transposio dos esgotos entre as bacias, por seu turno,
alm de pesadas como j se viu, esto sempre situadas onde mais difcil (e
s vezes quase impossvel) a execuo das obras em profundidade. que so
invariavelmente margens de canais, riachos e outros cursos dgua que, com
grande freqncia, esto ocupados com assentamentos irregulares ou favelas,
por conta do processo de deteriorao comum s cidades do mundo em
desenvolvimento.

Aplicao restrita
Uma certa inflexibilidade bastante visvel nas duas pontas do sistema
convencional, limitando as condies de sua aplicao. Do lado da coleta,
o padro nico em que se constitui seu ramal predial, se torna francamente
limitador do acesso ao servio apenas aos segmentos sociais situados em
reas de urbanizao regular. Com isso, boa parte da populao, sobretudo
aquela populao favelada estar margem do atendimento. Na outra
ponta, por seu turno, a eventual concentrao do processamento final tem
exigido investimentos iniciais to altos que freqentemente inviabilizam
o empreendimento, porque consomem todos os recursos disponveis,
impossibilitando a coleta que lhe garantiria o preenchimento de sua
capacidade, comprometendo, ento, a efetividade do atendimento 1.

Baixo apelo adeso


Uma outra caracterstica negativa dos chamados sistemas convencionais
de esgotos est na forma de proceder a sua implantao, decorrendo
dela, diretamente, um problema de excepcional relevncia: o menor nvel
alcanado no atendimento. a utilizao de um processo que esquece que o
incio do servio de esgotos est em cada uma das casas, de tal forma que ele
somente eficiente se conta com a adeso e instruo para o uso de cada uma
delas. Omitindo-se a participao da comunidade a atender, at mesmo a
26

No so poucas as cidades brasileiras,


sobretudo metrpoles, que tm estas
grandes unidades e que no estejam
ainda ociosas depois de muito tempo de
sua construo; ou que, nesta condio,
permaneceram durante muito tempo.

Sistema Condominial

sua informao mnima sobre necessidades, benefcios e custos, tende-se


a limitar bastante o ingresso de usurios. Ou leva ao que seria o seu mau
ingresso, trazendo consigo, por exemplo, as guas de chuva do interior das
residncias (prpria da cultura dos sistemas unitrios j referidos), ou
mesmo o lixo, resultando em mau funcionamento e deteriorao do sistema
e elevados custos operacionais.

E ainda...
A merecer um registro esto as dificuldades na histria e na cultura do
Brasil, bem como no seu sistema institucional, que sempre se interpem no
enfrentamento da problemtica de esgotos.
A primeira e mais importante delas a falta de prioridade atribuda ao
setor, a qual se alimenta de alguns argumentos visveis e explcitos, sempre
falaciosos, todavia, e outros menos ntidos aos olhos da populao. So eles,
por exemplo:
t BGBMUBEFTFSWJPEFFTHPUPJOEV[BRVFBMHPTFKBFNQSFFOEJEPQBSB
cumprir sua funo, mesmo que apenas mascarando, driblando,
adiando a correta soluo, e dessa forma agravando a sade pblica
e o meio ambiente: so aqueles sistemas unitrios largamente
citados anteriormente;
t PBCTVSEP OPTQMBOPTFDPONJDPFPSBNFOUSJPEPTHPWFSOPT EF
investimentos de carter social como estes, essenciais do ponto
de vista da populao, perderem sistematicamente a disputa
por recursos financeiros com os chamados investimentos de infraestrutura produtiva;
t FBJOEB BHPSBOPJOUFSJPSEPQSQSJPTFUPSJOTUJUVDJPOBMEP
saneamento, a inevitvel preferncia, quanto a investimentos,
pelo abastecimento dgua, j que a tendncia que estejam
potencialmente juntos os recursos financeiros para ambos. O
inegvel maior apelo da gua e a sua condio de insuficincia em
praticamente todas as cidades, sobretudo por conta das elevadssimas
perdas registradas nos sistemas, se mostra como fator decisivo para a
escolha das prioridades na aplicao dos recursos disponveis.
Uma outra seria a falta, insuficincia ou incorreo do sistema de
drenagem. Sem dvida se trata de um dos maiores problemas para o bom
funcionamento dos servios de esgotamento sanitrio, e as suas imperfeies
que prejudicam aqueles servios ocorrem ora no interior das casas, ora nas
ruas. No primeiro caso elas so efeito dos sistemas unitrios, que um dia
levaram a populao a juntar as duas guas em direo a eles e que, com o
advento de sistema separador, reluta em refazer as suas sadas para separar
as duas guas. Nas ruas, por seu turno, os problemas so decorrentes dos
alagamentos no resolvidos pelo sistema de drenagem e que terminam
penetrando nas tubulaes de esgotos que lhe so sempre adjacentes,
perturbando-lhe o desempenho regular.
27

Sistema Condominial: teoria e seu processo de construo

A dificuldade seguinte o potencial despreparo da populao para o


uso correto do servio de esgotos (o que pode e o que no pode ser nele
lanado), muito particularmente com relao prpria questo das guas
pluviais. Esta situao inevitavelmente agravada no seio da populao
mais pobre: instalaes sanitrias mais precrias, menor capacidade
financeira para as adequaes necessrias, mais baixo nvel de educao e
cultura.
E uma ltima dificuldade a registrar nesse sentido agora abordado: ela
est, francamente, no sistema institucional do saneamento, e que se pode
considerar, num grande nmero de casos, pouco propenso aos desafios
operacionais de um sistema de esgotos em reas degradadas. Nelas, com
efeito, as exigncias operacionais so infinitamente maiores, numa grande
desproporo em relao aos valores cobrados, geralmente proporcionais
aos volumes. Em determinadas situaes, este problema, que a rigor
no deveria existir, se torna insupervel. Mas esta condio de inferior
qualidade da operao no necessariamente ocorrente apenas nas reas
degradadas. Ela pode estar generalizada na cidade e tem duas razes
muito fortes a lhe determinarem: a insuficincia dos recursos de todas
as ordens alocadas pelo prestador de servios (em face daquela mesma
preferncia pelo abastecimento dgua) e a tradio de inferioridade de
status (e da conseqente motivao) daqueles que se dedicam a este lado do
saneamento.

28

Sistema Condominial

3. OS FUNDAMENTOS DO MODELO E
SUA BASE DE SUSTENTAO
Este captulo dedicado teoria dos sistemas condominiais, representada pelas
idias bsicas que lhe do sustentao e pelos seus mbitos ou nveis de resoluo,
cada um deles com os seus instrumentos e suas tcnicas de abordagem, nos
planos fsico e institucional. Isto precedido da definio dos objetivos do
novo modelo e seus requisitos, sobre o que se procura enfatizar o vigor, quase
obstinao, com que influenciaram o desenvolvimento do novo sistema.
importante observar que a fora do tal objetivo e das idias aqui postas,
e que estiveram presentes desde as suas origens, no deve omitir que a
sua construo obedeceu a um processo progressivo, formado pelas suas
sucessivas oportunidades de realizao - diversas cidades, diversos estados
do Brasil. Nesse sentido, inclusive, o captulo que lhe seguir - tratando
exatamente dessas oportunidades - deve ser visto sob um enfoque to
interativo quanto possvel.

3.1 O OBJETIVO E OS SEUS REQUISITOS


O sistema condominial foi concebido com a finalidade de viabilizar o
pleno atendimento das cidades pelos servios de esgotamento sanitrio.
Onde quer que esteja o usurio, qualquer que seja a sua cidade ou
condio econmica, para cumprir seus objetivos o sistema de esgoto
deve oferecer condies para seu atendimento. No plano social, h
que se entender esse objetivo como a universalizao do atendimento:
forte o suficiente para estar presente em cada passo do processo e
dessa forma influenci-lo; e como algo efetivamente possvel, vivel,
quando ento deve ser entendido como a abertura de uma perspectiva
do atendimento pleno em cada local onde seja aplicado e naquelas
sucessivas abrangncias que o envolvam - a sua cidade, o seu estado,
o seu pas. Nada se pense, se conceba ou se faa, portanto, fora dessa
perspectiva.
Alguns requisitos e exigncias ao novo modelo esto contidos em tal objetivo
ou lhe so complementares ou decorrentes. Como a capacidade de atender
com um nico sistema toda a populao, por mais diversificados que sejam
os seus estratos de renda, de forma a interromper-se o apartheid tambm
presente no saneamento com os sistemas de pobres e os sistemas de ricos
e, ainda pior, a operao de pobres e a operao de ricos...ou a exemplar
qualidade tcnica das solues, para que atendam aos mais exigentes
padres estabelecidos para a prestao dos servios de saneamento, fazendo
uso, para tanto, daquilo que de melhor e mais moderno exista na tecnologia,
na engenharia sanitria, na hidrulica e na indstria. E, evidentemente, que a
soluo oferea mnimos custos e o mximo de facilidades ao processo de
implementao.
29

Sistema Condominial: teoria e seu processo de construo

3.2 AS IDIAS QUE LHE DO FORA


A ousadia do objetivo imposto ao sistema condominial levou busca de
insumos capazes de viabiliz-lo e de garantir-lhe, simultaneamente, a
reduo dos investimentos, sem perder qualidade, alm de agregar
energias reais, plausveis - capazes de fazerem o papel do dinheiro, de
substitu-lo. Nesse contexto que foram sendo exploradas algumas idiasfora, ao ensejo das oportunidades de aplicao dos sistemas condominiais,
as quais conseguem potencializar, no processo das solues, as tais energias
que fazem, na prtica, o efeito do dinheiro, sempre para reduzir custos: ora
por agregar matrias ou esforos que lhes faam as vezes, ora por dispensar
insumos que precisariam ser comprados, como ocorre nos procedimentos
convencionais. Estas idias no so criao ou prerrogativas do modelo
condominial, ao contrrio, so antigas e genricas, mas facilmente relegadas
ou esquecidas em muitas intervenes.
O que isso e como tem sido possvel a sua utilizao o que se ver adiante,
neste captulo.

A participao comunitria
A implantao de um sistema de esgotamento sanitrio, pelo simples
fato de ser um servio pblico destinado ao atendimento permanente
e remunerado de cada prdio da cidade, j requereria a informao e
correspondente participao da sua populao, como um exerccio do
direito da cidadania. Mas, alm dessa condio, assim cidad, algumas
caractersticas e requisitos desse servio levam a questo da participao
comunitria a nveis de exigncia verdadeiramente pragmticos. A comear
do seu forte apelo universalizao, no apenas como direito de todos e
de cada um, mas tambm como requisito da salubridade ambiental, j que
cada eventual desatendido constitui uma efetiva fonte poluidora do meio
urbano; da, portanto, a importncia de cada habitante querer e aceitar o
servio e suas condies.
Segue-se, alm desse requisito de ingresso, uma curiosa caracterstica na
sua essncia, qual seja o fato de que ele tem incio obrigatrio em cada
casa - diferente dos seus congneres de gua, energia eltrica ou telefonia
- de quem se exige, como condio para uma regular operao, a presena
de equipamentos capazes de reunir os efluentes para a descarga na rede
de coleta, alm da ausncia, nela, de impropriedades, tais como as guas
de chuva ou detritos domsticos. Neste caso, portanto, a casa precisa ter
razoveis instalaes sanitrias, e os seus moradores, uma condio mnima
de educao para o correto uso. Mais uma importante razo, portanto, para a
participao.
E ainda estar presente, com certeza, na grande maioria das cidades que tem
carncia desse servio, uma desejvel contribuio financeira da populao
usuria aos investimentos requeridos (desde que numa forma justa e
equilibrada), o que condio de acelerao do atendimento em presena
de mesmos recursos do prestador de servio para investimentos. Neste caso,
30

Figura 6
A reunio com as lideranas (foto acima), no
incio do processo, desgua em sucessivas
reunies condominiais (abaixo)

Sistema Condominial

a participao mais exigente e requer maior processo de trocas entre as


partes.
A veracidade dessas demandas pode ser comprovada - lamentavelmente,
que seja - nas centenas de cidades com sistemas e imensos vazios no
atendimento, nos sistemas que alm desses vazios ainda trazem consigo
difceis condies operacionais decorrentes do mau uso, ou nas milhares
de cidades desprovidas dos servios pela falta de recursos financeiros para a
sua instalao. Em comum a todas essas situaes a ausncia da participao
comunitria.
Cenrios como esses, portanto, foram suficientes para que a teoria dos
sistemas condominiais incorporasse a idia de que a populao quem tem
o problema do esgotamento sanitrio por resolver e, portanto, deve ser
agente natural da sua soluo. Dessa forma, a participao da comunidade
nos empreendimentos de natureza condominial considerada como a mais
importante de suas idias-fora, a que mais facilmente se transforma em
insumo a favor da viabilidade econmica e social desses empreendimentos.
Na sua decorrncia, os mesmos investimentos podero representar maior rol
de atendidos e menores custos relativos.
Assim, esse problema de esgotos da cidade sem dvida problema de sua
populao: mais visvel e palpvel quando claramente exposto nas casas e
ruas, ocasies em que ele assume feio de problema pessoal e um natural
mobilizador da sociedade; e menos perceptvel quando est escondido na
drenagem, conforme se viu anteriormente, caso em que ele tem uma dimenso
de carter ambiental e que, portanto, est mais distante das casas e do sentimento
da populao. No primeiro caso a comunidade v e sente o problema,
objetivamente; no segundo, ela precisa ser levada a v-lo e assum-lo.
Em ambas as situaes, necessrio que se conceba uma forma que rena
os interesses da populao, do prestador do servio e do poder pblico capaz de viabilizar tal ingresso, certamente, na esteira de um pacto entre os
interessados, um bom negcio para todos.

A adequao realidade
A concepo e composio de sistemas fsicos, pelo lado da engenharia,
e os critrios que venham a ser estabelecidos para regular os servios,
quaisquer que sejam, so determinantes, sem dvida, de seus custos,
eficincia e operacionalidade. Cumpre, ento, que se esteja atento quanto a
estes quesitos, cuidando-se para que em cada um dos seus aspectos seja o
sistema de esgotamento sanitrio plenamente adequado sua realidade:
quela de ordem econmico-financeira, quando bem se deve respeitar
as disponibilidades de recursos pelos lados institucional e da populao;
realidade fsica e ambiental, quando as diversas unidades do sistema
se sintonizem da melhor forma com este meio, com as redes evitando as
dificuldades impostas pelas condies locais do terreno e do seu subsolo e
o processamento final bem explorando o que lhe possa servir de insumo; s
31

Sistema Condominial: teoria e seu processo de construo

reais condies da urbanizao e das habitaes, fazendo-se por onde sejam


exeqveis e atraentes as formas de coleta dos esgotos de cada bairro e de
cada casa.
Para tornar mais compreensvel esta preocupao que poder reduzir custos,
vale a pena lembrar algumas prticas comuns em projetos de sistemas de
esgotos e que atropelam esta preocupao. Primeiro e mais evidente, a
padronizao do ramal predial, que exclui do atendimento grande parte
da populao. Ou ainda, a preferncia irracional, embora muito comum,
por modelos de tratamento de esgotos que se sobrepem s caractersticas
do meio fsico, como a adoo de solues caras, complexas e de difcil
operao, onde as condies permitiriam o uso de processos naturais de
alta eficincia e muito mais econmicos e fceis de operar. Ou a preferncia
marcante pelo lanamento dos efluentes em rios, lagos e mares, onde a
escassez de gua sugere o reso, e o solo vido pela gua e pelos nutrientes
dos efluentes sanitrios para melhor produzir.

A integrao de agentes e de aes


comum que diversas instituies diferentes atuem em uma mesma
cidade ou rea, de modo independente, implementando aes que pela
sua natureza teriam muito a ver com aquelas que so de outro mbito
de gesto. O saneamento est perfeitamente contido nesta observao,
seja como agente, seja como paciente de tais aes. Isso quase sempre
conflitante, desperdia recursos e energias, dificulta e encarece a soluo
dos problemas. Chega muitas vezes a constituir verdadeiros absurdos (por
exemplo, a implantao de redes subterrneas, quebrando pavimentos que
acabaram de ser executados).
A todo momento, municipalidades premidas pela sua populao (que
tem e sente um problema), e sem assistncia dos prestadores de servio
dos sistemas separadores (muitas vezes vinculados a governos regionais
ou nacionais), investem em estruturas de drenagem que se transformam
rapidamente em receptoras de esgoto, na contramo do futuro sanitrio
das cidades. Haveria algo mais fcil que juntar esforos dessas duas
instncias em prol da soluo correta e de custos finais menores? H
ainda a considerar, no caso das municipalidades, que so elas as instncias
eminentemente locais, do dia-a-dia das cidades e de sua populao, e que por
isso mesmo melhor se oferecem para a prtica das decises e das aes que
devam levar em conta a populao; ou seja, esta integrao ajudaria ainda
mais a participao comunitria acima considerada.

Tambm so freqentes os casos em que a empresa privada, para o


desempenho de suas atividades produtivas e na falta de sistemas separadores
pblicos, premida pelos rgos controladores ambientais a implantar
e operar seu prprio sistema de tratamento individualizado de esgoto.
Eles so geralmente de elevado custo, em razo da deseconomia de escala
(caracterstica do pequeno tamanho) e da complexidade de solues
(decorrente da reduo dos espaos disponveis). Isso bastante ntido no
32

Sistema Condominial

setor imobilirio de algumas cidades desprovidas do servio de esgotos, onde


cada prdio que se construa traga consigo a obrigao, emanada da entidade
do controle ambiental, de ter o seu tratamento prprio - custoso, complicado
e que muitas vezes no funciona regularmente. Tambm no turismo, em que
todos so prejudicados pela insalubridade causada pela falta ou incorreo
do servio de esgotos. Seria to difcil se conceber uma forma de reunio
desses interesses em jogo a favor de uma soluo extensiva para os
esgotos?
A par da integrao de agentes, esses citados e tantos outros que as
oportunidades reais venham a oferecer, tambm se propugna pela integrao
de aes do sistema de esgotamento sanitrio com outros sistemas de infraestrutura urbana com os quais tenha afinidades. Os principais sistemas sob este
prisma so os de viao e de drenagem que ofereceriam extraordinrios ganhos
se fossem planejados em conjunto: eliminao dos sistemas unitrios com
menores custos (menores extenses) para a drenagem, minimizao das
quebras de pavimentao, menores custos para o sistema virio e, ao final,
maiores benefcios para a populao.

O gradualismo na perspectiva de um processo


permanente
A abertura de uma perspectiva para a universalizao do atendimento por
servios de saneamento traz consigo a idia de explorar o gradualismo
nas aes do setor. Ele pode ser o vetor capaz de assegurar o emprego
eficaz de qualquer montante de recursos financeiros que venham a estar
disponibilizados, numa forma que maximize o rol dos atendidos em
qualquer oportunidade. Os microssistemas adiante descritos so bons
exemplos de viabilizao dessa idia.
A esse gradualismo se deve associar, em qualquer contexto de aplicao
do modelo condominial para o saneamento urbano, a idia de que este
saneamento se faa segundo um processo permanente (e daquela forma
gradual); com pressa para se comear, associada, porm, certeza da
continuidade, mesmo que lenta, mas na direo da soluo integral. Aqui
tambm est a idia de que a prpria cidade segue um gradualismo.
Em todos os seus aspectos, a cidade um organismo dinmico, que evolui a
cada momento, da mesma maneira que as suas casas e a sua populao. Os
sistemas de esgotos, que por assim dizer, penetram na intimidade das cidades,
nos banheiros e cozinhas de cada casa, em todos os pontos mais vulnerveis de
seus bairros (sobretudo talvegues, riachos e cursos dgua locais), devero, em
conseqncia, ser sensveis s transformaes que se faam exigir. Chegando
a reas vulnerveis e sendo, no Brasil, o servio urbano que invariavelmente
o ltimo a chegar, os sistemas de esgoto se constituem, naturalmente,
numa oportunidade de renovao urbana caso sua implantao se integre s
correes necessrias aos outros sistemas locais.

33

Sistema Condominial: teoria e seu processo de construo

3.3 AS INSTNCIAS DO MODELO,


SEU CONTEDO E SUAS TCNICAS
O sistema condominial se organiza em instncias sucessivamente mais
abrangentes e que equivalem, na prtica, a unidades espaciais nas quais
ocorre a sua resoluo: so os Condomnios, os Micro sistemas (ou
Unidades de Coleta), o Sistema-Cidade e o Sistema-Universo, conforme
se procurou representar na figura 7. E todas elas contemplam aspectos
e respectivos instrumentos nos planos fsico e socioinstitucional que as
caracterizam. O primeiro plano abrange especificamente os componentes
materiais do sistema fsico (tubulaes, elevatrias, estaes de tratamento, etc),
e o segundo, a diviso de responsabilidades entre os agentes (municipalidade,
concessionrios, usurios, etc), as regras reguladoras do processo, os acertos
decorrentes de pactos e negcios efetuados no curso das aes. Cada uma delas e
seus instrumentos, nesses dois planos, so o objeto da abordagem a seguir.

Condomnio
o conjunto de casas ou lotes situados numa mesma quadra urbana,
formando uma espcie de ilha cercada de ruas por todos os lados,
e constituindo uma unidade de vizinhana que, vantajosamente para o
que se quer, tende a apresentar uma tendncia a certa homogeneidade
entre os vizinhos: na urbanizao, nas habitaes, nas suas condies
socioeconmicas e culturais, nos problemas e suas solues (inclusive
no setor do saneamento)... Nos assentamentos menos urbanizados e
regulares e nas favelas, os condomnios seguem o mesmo conceito e
a quadra d lugar ao aglomerado de casas, contguo, e que definido
(cercado) por becos, vielas, canais ou escadarias.
34

Figura 7
As instncias sucessivas do
modelo condominial

Sistema Condominial

inspirao que levou a essa


Unidade de Atendimento,
sem dvida, decorreu dos edifcios
de apartamentos, cada vez mais
dominantes nas cidades, em razo
de sua racionalidade e economia
de escalas. Um mesmo terreno e
mesmos pontos de oferta de infraestrutura e de servios atendem a
vrias unidades superpostas. As
maiores diferenas em relao aos
prdios esto na horizontalidade
das estruturas e na informalidade
das relaes nos condomnios.

Figura 8
O ramal condominial e suas
alternativas de localizao

Esse espao assim condominial se constituir, ento, para o novo modelo, na sua
Unidade de Atendimento (da populao) onde, sem prejuzo da considerao
individual do usurio, a sua ligao ao sistema tem formato coletivo, em
contraposio ao atendimento realizado lote a lote, conforme a tradio.
O sistema fsico de coleta de cada condomnio procura ser o mais
adequado s condies locais topogrficas, urbansticas, habitacionais
e tambm socioeconmicas (sobretudo as relacionadas com o poder
aquisitivo e a renda da sua populao), e se constitui nos chamados Ramais
Condominiais. Eles so tubulaes paralelas s ruas e situadas em posio
adequada coleta do conjunto das casas, associada vontade e deciso
dos usurios. Nas urbanizaes bem definidas, esses ramais podem ocupar
uma das posies indicadas na figura 8, quando foram sendo chamados,
por aluso s suas posies, respectivamente ramal de passeio, ramal de
jardim ou ramal de fundo de lote.

Nas reas urbanisticamente desarrumadas, ou nas favelas, sejam escarpadas


ou baixadas, o seu traado segue os mesmos princpios de racionalidade,
mas nem sempre corresponde a um desenho regular: na maioria das vezes,
alis, ele no tem mais que uma alternativa de caminhamento, em razo
da exigidade dos espaos disponveis e que atendam aos seus requisitos
de coletor de efluentes. Tal disposio, tanto quanto possvel, precisa
acompanhar a linha de maiores declividades do interior do condomnio
e, alm disso, passar em cada uma das propriedades para ofertar-lhes
a ligao. A figura 9 exemplifica essa situao com um condomnio da
cidade de Salvador, na Bahia.
35

Sistema Condominial: teoria e seu processo de construo

Os ramais de passeio so os preferenciais nas urbanizaes mais regulares,


conquanto tendam a ser os que demandam maiores investimentos e
maiores custos operacionais para o prestador de servio, pela sua integral
responsabilidade pela manuteno de componentes localizados em rea
pblica. Poderiam ser considerados os mais formalmente estabelecidos, da
urbanizao mais avanada e obrigatrios onde haja demandas especiais pelo
seu volume ou caractersticas (edifcios, restaurantes, indstrias, etc).
Os ramais de jardim e os de fundo de lote, mais adequados s
urbanizaes especiais na sua topografia e urbanizao, tendem
a apresentar menores investimentos e ainda podem reduzir o custo
operacional se um acerto entre as partes vier a definir alguma
responsabilidade dos usurios na futura manuteno. Esses ramais internos
podem vir a ser alternativas praticamente nicas em determinadas
situaes urbanas, tais como as favelas de altas densidades, as edificaes
com instalaes sanitrias abaixo do nvel das ruas, as casas conjugadas que
desaconselham a quebra de pavimentos para a transposio de tubulaes,
etc; ou francamente sugestivos, evidentes, quando se trata de imveis
residenciais com grandes reas verdes internas aos lotes. Deles se deve ainda
considerar que, quando aplicados (corretamente) em situaes urbanas
transitrias (reas pobres, pouco desenvolvidas), podero vir a exigir, no
futuro, com a transformao natural da urbanizao, a sua readequao
nova condio. Este risco ou inconvenincia no deve, contudo, afastar a
hiptese do ramal interno j que em muitas urbanizaes - ao menos em
determinada fase de seu desenvolvimento - uma tal alternativa pode se
apresentar como a nica capaz de viabilizar uma soluo.
Em qualquer dessas posies, os ramais condominiais, no novo sistema,
equivalem aos ramais prediais do sistema tradicional (realizam o mesmo
papel de ligao rede coletora pblica), da porque, seguindo a tradio,
devem ter os seus custos sob a responsabilidade dos usurios - salvo poltica
em contrrio adotada pelos prestadores de servio.
No seu dimensionamento, como j visto, devem seguir perfeitamente as leis
da hidrulica, o que tem garantido a presena de tubulao com o dimetro
mnimo de 100 mm no atendimento da maioria absoluta da populao. Na
execuo do projeto, as profundidades devem ser as mnimas, compatveis,
apenas, com a viabilizao da captao dos esgotos de cada prdio e com a
garantia de sua integridade em face aos pequenos impactos tpicos desse
espao condominial. A interligao de cada usurio aos ramais se far
sempre atravs de uma caixa de inspeo, de dimenso compatvel com a
sua funo de acesso manuteno manual do trecho a que corresponde;
nos ramais de passeio, e a depender do operador e seus equipamentos, essa
interligao poder ser realizada atravs de pea padronizada para esta
condio.
Quanto s questes que devero depender da participao e da deciso
da comunidade, nesse mbito condominial de resoluo, giram todas
elas em torno da adeso dos vizinhos ao servio e do cumprimento das
obrigaes estabelecidas nessa adeso: garantia de realizao da prpria
ligao com a adequada adaptao das instalaes prediais; escolha de uma
36

Figura 9
Os ramais condominiais so muitas
vezes obras artesanais

Sistema Condominial

Figura 10
Os ramais condominiais em rea
sub urbanizada

a Vila Moc, em Petrolina, e nos


bairros de Rocas e Santos Reis,
em Natal, os ramais condominiais
foram internos aos lotes, porque
assim sugeriam as condies locais
da poca de sua implantao, incio
dos anos oitenta. Em Petrolina,
porque alm de bastante sugestiva
esta localizao (ocorrncia de
espaos), ela se constitua numa
alternativa muito mais econmica
para a populao (responsvel
por este investimento); em Natal,
porque isto era uma decorrncia da
posio da maioria das suas casas,
abaixo do nvel das ruas. Hoje, em
ambas as localidades esses ramais
deveriam ser revistos, em funo da
mudana radical das suas condies
no decorrer de 25 anos. Na Vila
Moc, teriam de ser transferidos
para os passeios. Em Rocas e
Santos Reis, mereceriam uma
investigao mais atenta, porque
certamente resultaria em soluo
menos homognia.

das alternativas possveis para a localizao; cumprimento da respectiva


parcela de responsabilidade assumida com este ramal, na construo e na
futura operao; absoro das contas mensais correspondentes ao servio.
O prestador do servio, pelo lado institucional, compromete-se com o
outro lado das obrigaes pactuadas. Este negcio fechado quando os
condminos assinam a lista de adeso ao servio, aps a reunio do seu
condomnio, que a ocasio propcia para o fornecimento de informaes,
discusses e esclarecimentos necessrios deciso solidria do grupo.
As maiores dificuldades para a realizao das ligaes das casas aos ramais
podem provir de duas situaes seguintes, que exigem investimentos (e
certamente algum desconforto), quais sejam: insuficincia de instalaes
sanitrias mnimas compatveis com o escoamento e coleta dos esgotos; e
instalaes conjugadas s de drenagem das guas pluviais, j que o sistema
separador obriga a devida apartao. Afora isso, soma-se a incorporao da
tarifa mensal do novo servio, j que os sistemas unitrios extra-oficiais
no costumam ser tarifados.

Micro sistema
A este ttulo se considera o conjunto contguo de condomnios, que
preencha uma microbacia de drenagem, tal que a sua extremidade de
jusante desge na estrutura principal de coleta do sistema da cidade
(elevatria, coletor-tronco ou interceptor), e que constituir a Unidade de
Coleta da Cidade. Ele poder comportar um Processamento Final na sua
extremidade de jusante nas duas situaes seguintes:
37

Sistema Condominial: teoria e seu processo de construo

t RVBOEPPTSFDVSTPTOBODFJSPTEJTQPOWFJTQBSBPJOWFTUJNFOUPOP
forem suficientes para toda a cidade, caso em que esta condio um
artifcio estratgico para bem utilizar esses recursos parciais, com a
soluo podendo ser transitria;
t F QPSPVUSPMBEP FYJTUJOEPPTSFDVSTPTFNOWFMTVDJFOUFQBSBP
todo, seja esse processamento uma racionalidade tcnico-econmica
no contexto de uma descentralizao.
Observe-se que aquela primeira situao seria, na realidade, uma vlvula
capaz de dar efetividade a todo e qualquer volume de recursos que se
mostre disponvel para o sistema de esgotos, fugindo-se de situaes que
infelizmente tm sido comuns: a no utilizao da disponibilidade financeira,
ou o seu emprego em redes sem tratamento, ou ainda, em estaes de
tratamento sem a retaguarda de redes que lhe preencham a capacidade. As
experincias-piloto, de que se falar adiante, geralmente, coincidem com
um micro sistema.
O componente fsico desse microsistema a rede coletora, que denominada
Rede Bsica. Graas ao trabalho de coleta realizado pelos ramais
condominiais, esta rede precisa apenas tocar cada quadra em um ponto, o
de desge do seu ramal. Por isso ela tem uma extenso bastante pequena,
geralmente inferior metade daquela das redes tradicionais. Alm dessa
extenso mnima, apresenta tambm mnimas profundidades, j que passando
pelo ponto mais baixo de cada quadra, termina percorrendo o caminho das
mximas declividades do micro sistema a que corresponde. A Figura 6 ilustra o
que aqui se diz e reala este papel de racionalidade dos ramais condominiais em
relao a esta rede bsica. Todas as contribuies a ela so realizadas atravs
das caixas de sada dos ramais condominiais, de sorte que inexistiro,
nela, qualquer tipo de conexo (os chamados cachimbos ou similares) e
que so potenciais pontos crticos do sistema. Por estarem estas caixas nos
passeios, poder a prpria rede bsica fazer deles o seu bero, at que se possa
manter numa profundidade compatvel com tal localizao (via de regra esta
profundidade mxima da ordem de 1,00 m, salvo se os passeios so largos o
suficiente para profundidades um pouco maiores). Nesta posio, os poos de
visita caractersticos das redes coletoras pblicas podem ser substitudos pelas
mais econmicas caixas de inspeo.
Os dimensionamentos hidrulicos da rede bsica, assim como o seu projeto,
construo e operao, seguiro os preceitos da hidrulica e as recomendaes
convencionais da engenharia sanitria, conforme se ver em detalhes no
Caderno 2 desse livro.
As diretrizes e definies de carter institucional presentes no micro
sistema sero rigorosamente as mesmas que afetaro a cidade como
um todo - o Sistema-Cidade, j que embora sendo ele apenas uma parte
da cidade, traz consigo, todavia, todas as funes de servio presentes no
universo maior. Por esta razo, esse tpico ser tratado no item seguinte.

38

Sistema Condominial

Sistema-cidade
Aqui estar a cidade por inteiro, abrangendo, portanto, o conjunto de todos
os microssistemas acima conceituados e mais, evidentemente, o que exista de
construdo em sistemas de esgotos anteriores ao modelo condominial.
Enquanto componentes fsicos, alm dos anteriores ramais condominiais
e redes bsicas, aqui se dever acrescentar o processamento final dos
esgotos e a estrutura de transporte dos efluentes dos microssistemas, esta
ltima representada por interceptores, estaes elevatrias e emissrios.
A designao de processamento final parece adequada para representar
o conjunto das instalaes e processos que compreendam o tratamento
propriamente dito dos efluentes e a sua destinao final, seja por meio do
desejvel reaproveitamento, seja por sua direta disposio no meio ambiente.

Figura 11
Os espaos das guas pluviais, espaos
tambm da estrutura de transporte dos
HXHQWHVPXLWDVYH]HVHVWmRRFXSDGRV

O equacionamento desse sistema mais abrangente deve ser realizado com base
nos critrios usuais de otimizao econmica-financeira, a partir, porm, de
uma definio prvia sobre as diretrizes bsicas para o processamento final,
que tenha sintonia com a realidade local: em termos fsicos (como melhor
aproveitar as disponibilidades do meio ambiente); em termos institucionais
(como melhor adequar as tcnicas, a mo-de-obra disponvel e a conjuntura
poltica); e em termos socioeconmicos (como melhor oferecer ao sistema
produtivo os efluentes e subprodutos do tratamento). A despeito de dever
se manter sempre atualizado um desenho geral para o sistema-cidade,
no se deve abrir mo, contudo, da condio de sua reabertura quando da
oferta de recursos financeiros menores que o necessrio para o todo. Nesse
caso, um ou poucos micro sistemas voltam a ser o objeto do planejamento
parcial e respectiva implantao ( aquela idia de aproveitar-se todas as
oportunidades de investimento, independentemente do montante disponvel).
Esses estudos relativos ao sistema fsico devem formatar o aqui denominado
Plano de Ordenamento do Sistema Condominial de Esgotos semelhante aos
conhecidos planos diretores e deles se distinguindo, principalmente, por
aquela flexibilidade que lhe permite ajustar-se a qualquer disponibilidade de
recursos para investimentos. Focando-se mais particularmente na essncia
do processamento final, sua composio e filosofia que deveriam embas-lo,
defende-se algumas idias (nem sempre valorizadas na histria do setor) e que
podem ser dispostas como a seguir:
t WBMPSJ[BPEBJEJBEFRVFPTFTHPUPT BQBSEPTFVreconhecido
risco ambiental e ameaa para a sade pblica, trazem consigo
um formidvel potencial energtico, representado pelos seus
componentes gua e matria orgnica; a decorrncia desta
viso seria naturalmente o esforo no sentido da mais racional
transformao dessa energia em benefcio do homem e do seu
sistema produtivo;
t valorizao de processos naturais para o tratamento, e nisto, busca
de maior rentabilidade social na explorao dos recursos naturais
locais, como verdadeiras fontes de insumos para este tratamento;
t GBWPSFDJNFOUPQPTTWFMEFBMHVNBdescentralizao das unidades
de processamento final dos esgotos, particularmente nas maiores
39

Sistema Condominial: teoria e seu processo de construo

Figura 12
Alguns micro sistemas e suas
Redes Bsicas, em Santa Maria - Distrito
Federal
Fonte: CAESB

cidades, atravs da comtemplao, nos estudos econmicos que


os definam, de fatores at agora menos observados: objetiva
considerao dos custos com transporte entre bacias; minimizao de
riscos e sua justa distribuio; facilitao de escalonamento em etapas
na implementao dos sistemas, medida que melhor se ajusta, em
vrios casos, efetiva disponibilidade de recursos;
t QBSBPFOGSFOUBNFOUPEBFDBTTF[EFSFDVSTPTOBODFJSPTRVFUFN
sido marcante onde quer que haja o desatendimento por servios
de saneamento, que se busque o gradualismo no tratamento dos
efluentes, realizando-o em etapas sucessivas quanto intensidade,
em benefcio da maior abrangncia, desde o incio. No deve ser
omitida, aqui, uma certa crtica legislao ambiental brasileira a
respeito dessa matria: que ela, ao abrigar esse tratamento mximo
em quaquer circunstncia, estar certamente adiando a implantao
de algum tratamento mais de imediato. Estabelece-se, assim, na
prtica, o conhecido adgio nem oito, nem oitenta 2;
t CVTDBEBNFMIPSFNBJTSFOUWFMinsero do processamento
final dos esgotos no contexto urbano, no apenas para que possa
ser objeto de uma justa fiscalizao por parte da populao, mas
tambm para que algum partido se possa tirar das instalaes, como
componentes interessantes do paisagismo e do lazer das cidades,
sobretudo, quando as unidades adotadas estiverem livres de odores e
aspectos desagradveis como a maioria das lagoas de estabilizao.
40

Em contraposio a esta postura, a recente


Lei do Saneamento, PL no 11.445/07,
prope a implantao gradual de processos
GHWUDWDPHQWRGHHXHQWHVRTXHGHYH
ser saudado, no mnimo, como um ponto
de apoio para uma reviso mais justa da
matria.

Sistema Condominial

No que tange s estruturas do transporte de esgotos at o tratamento,


recomenda-se a perfeita observncia do que existir de mais avanado e adequado de tecnologia disponvel e de atendimento s normas de segurana
peculiares aos projetos, obras e operao. Reala-se, de novo, o fato de que
a localizao dessa estrutura estar quase toda ela superposta, s margens
dos diversos cursos dgua urbanos, menores e maiores, espaos esses que,
nas cidades aqui consideradas, tendem a ser aqueles mais degradados dentre
todos. Da porque seria recomendvel, ao ensejo das intervenes para a sua
construo, buscar-se uma possvel integrao dessas unidades a outros segmentos da infra-estrutura urbana, sobretudo a macro-drenagem, o sistema
virio e o paisagismo, com o intuito de reabilitar essas reas ao tempo em
que se garantiria a operacionalidade adequada a estes componentes importantes do sistema de esgotos.
Uma ltima observao sobre esta parcela do sistema diz respeito s
grandes profundidades que costumavam prevalecer, possivelmente como
uma herana da poca de escassez de energia eltrica e do correspondente
receio de maior emprego de estaes de recalque. Hoje, com a franca oferta
de energia e, alm disso, com uma ampla variedade de equipamentos de
automao que permitem o controle distncia dessas unidades, parece mais
interessante as menores profundidades dessa estrutura, que so asseguradas
com um maior nmero de elevatrias.
No plano das questes socioinstitucionais, por seu turno, estaro todos
os entendimentos e acertos que devero culminar em pactos com a devida
formalizao, elementos esses que sero os necessrios insero do novo
modelo no status quo vigente. Em princpio, so eles os seguintes:
t adequao do sistema tarifrio vigente aos menores nveis de
investimento e de custo operacional caractersticos do sistema
condominial; dos regulamentos tcnicos de projetos e obras
de sistemas de esgotos aos parmetros que se distingam daqueles
historicamente praticados; e dos procedimentos operacionais
que garantam a nova relao usurio-prestador de servio agora
pactuada, os quais dizem respeito, principalmente, aos novos direitos
e deveres das partes na implantao e manuteno dos ramais
condominiais, e que devem estar expressos nos Termos de Adeso
emitidos por cada condomnio;
t ajustamentos de gesto do servio, nos casos onde se tenha
estabelecido uma forma qualquer de parceria do prestador de servio
com eventuais outros agentes pblicos ou privados. No Brasil, por
exemplo, o mais freqente nesses casos tem sido a juno de esforos
entre municipalidades ou empresas pblicas de habitao popular
(que no operam os servios) e prestadores de servio, e que tenha
sido traduzida em aportes de recursos financeiros para as obras ou
na prpria implantao de sistemas para posterior implantao pelo
prestador de servio.

41

Sistema Condominial: teoria e seu processo de construo

A implementao desses novos instrumentos institucionais, que afinal de


contas ajustam o prestador de servio nova situao com o ingresso dos
sistemas condominiais, sempre iniciada pela experincia-piloto, aquela que
compreendeu as intervenes no primeiro microssistema a receber este novo
modelo. E ela ocorrer, desejavelmente, em carter tambm experimental,
como se fosse um processo de ajustamento e no uma interveno pronta e
acabada.
No contexto dessas novas formulaes - que em seu conjunto podem ser
consideradas o discurso institucional do empreendimento/empresa - h
que serem guardados determinados contornos relativamente ao passado e
coerncia intrnseca que lhe d credibilidade perante o pblico usurio.
necessrio ser bem construda a evoluo de uma para outra condio,
de forma que o novo no parea algo inexpressivo, provisrio ou
inconsistente, por menor que seja a dimenso fsica da prpria experinciapiloto. A melhor expresso para esta coerncia a preservao da unidade do
discurso em todos os seus pormenores e nas vrias instncias do universo:
diferentes bairros, diferentes categorias sociais, diferentes, que sejam,
algumas solues no plano fsico.

Sistema-Estado
O xito de uma experincia-piloto num Micro sistema pode levar ao
xito num Sistema-cidade. Se o gestor abrange universo mais amplo, por
exemplo, um Estado - como as empresas estaduais de saneamento, no
Brasil - o prximo passo seria levar o modelo ao conjunto das cidades desse
universo: quando ento se teria o Sistema-Estado. O Distrito Federal, no
Brasil, o nico caso dessa natureza, conforme se ver no Caderno nmero
03 desta Srie. No Rio Grande do Norte, nas origens do desenvolvimento do
modelo, tambm se chegou a uma formulao semelhante para o Estado, o
que tambm ser relatado naquele mesmo Caderno.
Neste caso, no seriam muito numerosos e nem mesmo to concretos
os componentes fsicos desse Sistema mais amplo. Seriam eles, se fosse o
caso, os que fariam parte do acervo e da experincia do concessionrio,
possivelmente, como seus padres ou normativas: especificaes tcnicas
para projetos e obras; sistemas operacionais, procedimentos e manuais
de operao e manuteno; prottipos, modelos e mdulos de elementos
dos sistemas fsicos (estaes elevatrias, acessrios das redes e ramais
condominiais, estaes de tratamento, etc). Em situaes mais avanadas,
quem sabe, incluiria-se aqui a implementao mais do que desejvel de
algo como um Sistema de Pesquisa e Desenvolvimento voltado para o
aperfeioamento do modelo condominial.
Pelo lado socioinstitucional, estaro os disciplinamentos estabelecidos
pelo Estado, regulando as parcerias admitidas no processo com os
municpios e seus usurios, e que, eventualmente, abranjam (no todo ou
parte do territrio) outras entidades pblicas ou privadas. Correspondero,
por certo, s questes da diviso de responsabilidades entre as partes e
42

Sistema Condominial

respectivos direitos e deveres, s diretrizes gerais que havero de orientar


e balizar o sistema tarifrio, alm dos mecanismos de acesso a fundos do
Estado para investimentos, desenvolvimento operacional e pesquisa e
desenvolvimento.

43

Sistema Condominial: teoria e seu processo de construo

4. O PROCESSO DE FORMAO DO
SISTEMA CONDOMINIAL
No captulo anterior, o esforo foi retratar o que nesse instante pode ser
considerado o estado da arte do sistema condominial de esgotamento
sanitrio; ou o estgio atual da sua teoria. Nesta abordagem de agora, por
seu turno, o que se pretende uma sumria descrio do processo atravs
do qual foi sendo desenvolvido e moldado esse novo sistema. E nisto
o caminho invariavelmente explorado foi o do aproveitamento, melhor
possvel, das oportunidades para potenciais experimentaes - fossem quais
fossem os aspectos favorveis e desfavorveis de suas conjunturas - j que
somente pelos exerccios em verdadeira grandeza por elas oferecidos seria
possvel a consolidao, como um modelo operativo, dos trs insumos
fundamentais presentes desde a origem do processo. Relembrando:
t Bcrtica contundente quela grave situao de desatendimento
e de lacuna, neste campo do saneamento, que est no incio
deste Caderno, como parte das razes que justificaram o modelo
condominial;
t a fora dos objetivos que se pretendia alcanar, abrindo-se uma
perspectiva de atendimento pleno pelos servios de esgotos, que hoje
funciona como o grande estimulante do processo, o seu puxador;
t FPSVEJNFOUPEBTJEJBTRVF IPKF KOVNBGPSNBNBJTOUJEB 
embasam o modelo condominial: a participao, a adequao, a
integrao, o gradualismo, os condomnios e os micro sistemas...
foroso reconhecer ainda que cada oportunidade vivenciada foi
realmente influenciadora do processo e da modelao alcanada - muitas
vezes contribuindo decisivamente para o seu aperfeioamento, outras
restringindo, de alguma forma, o espao da liberdade de criao. Essas
influncias, no geral, tiveram pelo menos duas origens distintas na sua
natureza, quais sejam: as vrias equipes tcnicas alocadas aos experimentos,
quase sempre, alis, selecionadas por se mostrarem mais sensveis s novas
idias, e que trouxeram suas experincias, sua criatividade e tambm a sua
crtica; e os rgos contratantes, naturais decisores dos processos, casos
em que os aportes foram de uma ordem mais especificamente cultural,
corporativa, porque foram quase sempre provenientes de concessionrias de
servios de saneamento e prefeituras municipais.
As caractersticas locais que foram sendo adquiridas pelo modelo
condominial referiam-se aos aspectos tcnicos (prottipos, padres,
especificaes, mtodos de dimensionamento hidrulico, etc), ao
estabelecimento das regras de acesso ao programa e diviso de
responsabilidades entre os agentes promotores e os usurios. Esses
fatores, alis, viriam a se mostrar fundamentais em todo o processo de
desenvolvimento do modelo.
Um caso importante dentre essas caractersticas locais diz respeito
operao dos servios condominiais, no que no tem sido confortvel o
44

Sistema Condominial

respaldo obtido. Isso decorre, muito naturalmente, de um encadeamento de


privilgios que relegam o novo modelo a uma desconfortvel condio: das
atividades relativas a obras sobre aquelas relativas a operao; dos servios
operacionais de gua sobre os de esgotos e nestes, do tradicional sobre a
novidade. Mas, sem dvida, o mais importante fator a determinar esses
menores cuidados com a operao est na origem de praticamente todos
os empreendimentos, que invariavelmente privilegiaram sua implantao,
onde estavam todas as novidades - na mobilizao social, nos projetos,
nas obras e muitas vezes nos palcos em que algumas experincias se
transformaram, atraindo a ateno de grande nmero de visitantes.
Ao final do captulo, julgou-se oportuna a discusso das dificuldades que se
fizeram mais presentes durante esse processo de criao - e algumas delas
ainda persistem -, cuja compreenso, certamente, parte importante no
conhecimento mais meticuloso do modelo condominial.

4.1 AS OPORTUNIDADES QUE FIZERAM O


PROCESSO
Deixando agora essas consideraes preliminares para se ir, objetivamente, ao
desenvolvimento do modelo condominial, tem-se como seu ponto de partida
o incio dos anos oitenta, no Brasil, em duas oportunidades simultneas,
mas bastante diferentes na sua essncia. Uma delas numa concessionria
de Saneamento, a CAERN, do Estado do Rio Grande do Norte, onde as
duas grandes questes eram a resistncia do corpo tcnico s novidades
e a entrada pioneira de um sistema de esgotos em reas pobres; nisto,
bom frisar, a CAERN representava, naquela ocasio, por inteiro, o universo
institucional do saneamento brasileiro. A outra oportunidade foi em
Petrolina, em Pernambuco, cuja prefeitura, no tendo qualquer atuao
no saneamento bsico (concedido empresa estadual, COMPESA), deixava
inteiramente livre o campo das experimentaes, mais ainda pelo irrestrito
apoio do seu Prefeito 3.

No seria justo deixar de nomear, aqui, as


pessoas que se mostraram fundamentais
no que seria o parto dos sistemas
condominiais: o engenheiro Josem de
$]HYHGRSUHVLGHQWHGD&$(51HDGRU
incondicional das experincias; o mdico,
prefeito de Petrolina, Augusto Coelho, que
alm de patrocinador teve o mrito de levar
a COMPESA a alterar seu sistema tarifrio
para comportar o novo e mais econmico
modelo; e o professor Duncan Mara, da
Universidade de Leeds, Inglaterra, que na
sua condio de consultor do Banco Mundial,
no Projeto Rocas e Santos Reis, em Natal,
HPSUHVWRXRVHXPDLVUPHDSRLRjTXHODV
experincias.

Na CAERN, os projetos marcantes foram o esgotamento sanitrio das


comunidades vizinhas de Rocas e Santos Reis, em Natal, capital do Estado,
com o financiamento e o apoio explcito do Banco Mundial; uma pesquisa
de solues alternativas no campo do esgotamento sanitrio, proporcionada
pelo Banco Nacional da Habitao e levada a cabo em trs cidades do interior Parnamirim, Goianinha e Currais Novos; e o sistema de esgotamento sanitrio
de uma vila popular na cidade de Santa Cruz. Em Petrolina, por seu turno, os
recursos provinham de programa de financiamento do Governo Federal e o
objetivo era a realizao de uma experincia-piloto de esgotamento sanitrio,
adequada s condies locais. Este universo, pela sua diversidade urbana
e socioeconmica e certa representatividade de parte do ambiente urbano
e do sistema institucional brasileiro, viria a ser fundamental na criao e na
consolidao do sistema condominial. Ou seja, esse novo sistema j nascia
habituando-se a urbanizaes ricas e pobres, planejadas e espontneas e a
sub urbanizaes e favelas...
Alm dessas oportunidades citadas, ajudaro na compreenso do
desenvolvimento e consolidao do modelo condominial, tambm, os
45

Sistema Condominial: teoria e seu processo de construo

aspectos interessantes das intervenes de mesma natureza realizadas


na dcada seguinte na cidade de Recife, capital de Pernambuco, e
em um grande nmero de favelas da cidade do Rio de Janeiro, com a
concessionria estadual, a CEDAE. Para finalmente melhor deter-se nos
empreendimentos que constituram, sem dvida, a fase mais expressiva
do novo sistema no que diz respeito sua consolidao: vrias cidades do
Distrito Federal, inclusive Braslia; Salvador, capital do Estado da Bahia;
e Parauapebas, no norte do Par, com o seu pioneiro sistema condominial
de distribuio de gua.
Nos seus aspectos mais substantivos - ou mais especificamente quantitativos
- esses empreendimentos sero melhor focalizados no Caderno 3 deste
livro. Aqui a apreciao deles se far mais pelo lado da aplicao das idias e
conceitos do modelo s diferentes realidades, buscando-se avaliar o quanto
e o como cada uma delas impregnou a sua construo, para que da se
pudesse inferir correes para as prximas etapas de sua utilizao. Interessa
mais, portanto, o conhecimento do contexto de cada uma das realizaes,
o comportamento de seus agentes promotores e suas interrelaes e os
aspectos dominantes nas vrias experimentaes.

O nascimento do Sistema Condominial, no Rio


Grande do Norte, com a CAERN
Essas experincias, verdadeiramente pioneiras, foram decisivas na modelao
do sistema condominial, mais ainda porque abrangeram trs campos de
ao bastante diferentes entre si, e que, dessa forma, permitiram mais
incurses naquelas idias at ento pensadas para o sistema.
Em Rocas e Santos Reis, bairros pobres vizinhos da cidade de Natal, com
3.000 habitantes, os testes praticados exausto foram, por excelncia, na
confirmao da figura do condomnio com os seus ramais condominiais
e, nele, a participao comunitria e a adequao realidade. Isso porque
a caracterstica marcante do local era a elevada densidade das casas, sua
pobreza e desarrumao e, principalmente, o fato de que grande parte delas
estar situada abaixo do nvel das ruas. A chegada do novo modelo a esta
rea decorreu da constatao, poca, de que a rede coletora clssica no seria
capaz de garantir, com os seus ramais tambm clssicos, sequer o atendimento
de uma quinta parte da populao, pela mais evidente impossibilidade
fsica. Iniciou-se, ento, o que seria o pioneiro trabalho de mobilizao
comunitria para implantao de sistema coletor de esgotos, onde a essncia
das discusses e decises seria a busca da concordncia dos moradores com
a passagem dos ramais condominiais pelo interior de seus lotes e, no raras
vezes, pelo prprio interior das residncias. Um trabalho verdadeiramente
artesanal e que era a condio obrigatria para o alcance da universalizao do
atendimento, afinal efetivado.
Em Santa Cruz, na regio do Agreste do Rio Grande do Norte, por sua
vez, a experincia realizada foi num bairro recm construdo (estilo vila de
COHAB), para uma populao da ordem de 4.000 habitantes. Pelas suas
46

uanto ao posicionamento da
CAERN nesse programa, foram
GXDVDVVXDVFRQJXUDo}HV8PD
primeira etapa no perodo 1980/87,
TXDQGRXPDHTXLSHHVSHFtFD
constituiu-se numa gerncia voltada
para o programa (Pesquisa e
Desenvolvimento) e foi capaz de fazer
RUHVFHUFUHVFHUHVHGHVHQYROYHU
o novo sistema, nada cuidando,
contudo, da sua institucionilizao.
A partir de 1987, uma nova condio
veio a prevalecer na empresa,
ainda hoje remanescente, onde
o modelo condominial apenas
cresceu, mantendo-se, todavia,
aprisionado nos conceitos e tcnicas
estabelecidos na etapa inicial, ou at
mesmo retrocedendo. Das 137.000
economias atendidas por servio de
esgotamento sanitrio no Estado, em
2007, 74.000, representando mais da
metade, so pelo modelo condominial,
sendo de salientar-se que em todas
elas prevaleceu, de forma at certo
ponto inexplicvel, a alternativa nica
de ramal condominial interno. Esta
condio chegou a alguns extremos,
tais como a implantao de sistemas
com esta modalidade de ramal e sem
qualquer mobilizao sistematizada
GDSRSXODomREHQHFLDGDHD
preservao do ramal que fora
adequado h vinte anos passados
para as comunidades de Rocas e
Santos Reis, sendo que a condio
atual destas reas inteiramente
distinta daquela inicial. O que antes
era um exemplo de adequao,
hoje deu lugar a uma grande
inconvenincia ainda no reparada.

Sistema Condominial

circunstncias, essa experincia permitiu a explorao da racionalidade


implcita no desenho do modelo condominial. Embora com a formao
rochosa aflorante, mas favorecidos pela topografia ondulada, pela
regularidade da urbanizao e pela relativa disponibilidade de terrenos, os seus
ramais condominiais e a sua rede minimizaram extenses e profundidades, ao
passo que o seu processamento final, descentralizado em trs locais, evitou as
estruturas de transporte. A experincia, portanto, limitou-se engenharia,
dada a ausncia de moradores por ocasio do planejamento e obras, oferecendo
dois resultados principais: a universalizao do atendimento e a minimizao
dos investimentos. O sistema condominial assim construdo veio a apresentar
um oramento menor do que a quarta parte daquele correspondente a uma
soluo convencional, com tratamento nico, rede em todas as ruas e um
extravagante volume de escavaes na rocha.

Figura 13
Dois condomnios, dois sistemas
distintos. A segunda foto do local
do primeiro ramal de passeio do modelo
condominial, em Petrolina, nos anos 80

J nas cidades do interior do Estado, na mesma poca (incio dos anos


oitenta), Goianinha (Zona da Mata, 5.000 habitantes), Parnamirim (regio
metropolitana de Natal, 15.000 habitantes) e Currais Novos (Serto, 20.000
habitantes) os trabalhos foram sempre iniciados por microssistemas - que
se constituram em experincias-piloto e confirmaram os condomnios,
os ramais condominiais (internos aos lotes), a participao comunitria,
a descentralizao do tratamento e inauguraram a integrao de aes,
reunindo pioneiramente, no Brasil, esforos de uma prestadora de servios,
a CAERN, e das prefeituras envolvidas, para a construo dos sistemas de
esgotamento sanitrio e sua futura operao.

Cidade de Petrolina, em Pernambuco

Na ocasio, como at hoje, o sistema


WUDGLFLRQDOWHPRVHXSUHoR[DGRHP
daquele do abastecimento de gua, ao
passo que nos sistemas condominiais esses
SHUFHQWXDLVVHUHGX]HPSDUDH
nos casos de ramais externos e internos,
respectivamente.

Em Petrolina, onde o programa foi inteiramente realizado pela prefeitura (outra


novidade na poca), a experincia-piloto, alm de reafirmar a participao
comunitria (inclusive na integral construo dos ramais condominiais) e
a descentralizao do tratamento, evidenciou que o novo sistema viria para
o atendimento da cidade como um todo, uma vez que j nesse incio as suas
duas reas beneficiadas foram representativas dos extremos de renda e
de urbanizao da cidade. No bairro rico, inaugurou-se a modalidade de
ramal condominial situada nos passeios, com seus investimentos bancados
pelos usurios e sujeitos a uma maior tarifa que aquela dos ramais internos
para levar em conta o custeio de sua operao pelo prestador de servio. O
xito dessa experincia-piloto, somado ao entusiasmo e ao poder poltico de
sua municipalidade, operou com grande desenvoltura a captao de sucessivos
recursos financeiros para novos investimentos da mesma natureza. Neste caso,
j ento com a participao da COMPESA, na operao do novo sistema,
e com alterao de seu sistema tarifrio, para contemplar o novo modelo e
seus menores custos 4. Estas facilidades, ento, terminaram por dispensar
a participao da comunidade, mediante a adoo do desenho condominial
que dispe os ramais apenas pelas caladas e da sistemtica de absoro dos
seus investimentos pelo poder pblico. A cidade hoje ultrapassa os 250.000
habitantes, e tem esse sistema atendendo a cerca de 80% desse contingente, com
tratamento se realizando em onze lagoas de estabilizao, todas elas situadas
na rea urbana, alcanando 60% dos efluentes coletados. questionvel se no
estaria a cidade plenamente atendida, hoje, caso os mesmos recursos financeiros
tivessem sido utilizados segundo o processo participativo inicial.
47

Sistema Condominial: teoria e seu processo de construo

No Recife, capital do Estado de Pernambuco


No Recife, ocorreu o primeiro planejamento de um sistema condominial
de uma grande cidade, com 1.500.000 habitantes poca, e que veio a se
denominar Plano de Ordenamento dos Esgotos. A contribuio ao processo,
neste caso, foi a consolidao do conceito de micro sistema, quando ele
recebeu, ento, a designao de Unidade de Coleta. O plano terminou por
dividir a cidade em cerca de cem dessas unidades, cujo processamento final
seria definido agregando tantas dessas unidades quanto melhor fosse a
conciliao entre a anlise econmica e a efetiva disponibilidade de recursos
em cada ocasio de investimento. A implantao de vrias Unidades de
Coleta, algumas com o seu prprio tratamento, outras aproveitando
unidades existentes, bem como a expanso do mesmo ordenamento a
toda a regio metropolitana, constituram indicativos bastante concretos
da validade dessa iniciativa. Tudo se passou, portanto, como se o novo
equacionamento tivesse destrancado o processo de dotao de sistemas de
esgotos na cidade, permitindo que a soluo flusse para qualquer que seja a
disponibilidade ocasional de recursos para investimentos.
O sucesso dessa idia junto ao Programa de Modernizao do Setor
Saneamento (PMSS), vinculado Secretaria Nacional de Saneamento
Ambiental do Ministrio das Cidades e junto ao Banco Mundial levou
ao desenvolvimento de uma outra idia que lhe complementaria: a
de descentralizao dos investimentos e da gesto dos servios, com a
participao da iniciativa privada, utilizando tambm aquelas mesmas
unidades. O inusitado da idia, apesar de no haver encontrado qualquer
reao explcita, imobilizou, contudo, o sistema institucional no que seria a
sua implementao.

Favelas do Rio de Janeiro


O programa de saneamento das favelas do Rio de Janeiro beneficiou
uma populao de cerca de 500.000 habitantes situada em trinta dessas
comunidades, dentre as quais as maiores e mais famosas: Rocinha,
Mangueira e Complexo do Alemo. O programa teve incio em 1992, como
um esforo do Governo do Estado no sentido da reparao da mais que
precria condio de atendimento desta populao marginalizada. Com
efeito, situadas nas vizinhanas de bairros prsperos da cidade, muito
bem servidos de gua e de servios de esgotos, estas favelas dispunham de
fornecimento de gua apenas algumas poucas horas por semana. Os seus
cenrios, alm de tudo, so extremamente desfavorveis para os servios,
especialmente o abastecimento de gua: elevadas densidades, topografia
fortemente acidentada, exigidade de espaos de circulao, habitaes
superpostas e violncia extrema, inclusive com a presena ostensiva do
narcotrfico. A oportunidade que se ofereceu ao enriquecimento do modelo
condominial, alm da confirmao de fatores e aspectos j vivenciados
noutros empreendimentos, abrangeu duas importantes questes. A
primeira delas foi a da legitimao do programa no seio das comunidades,
ultrapassando os difceis obstculos caractersticos da condio
48

Sistema Condominial

Figura 14
O Sistema Condominial nos bairros
nobres de Braslia (acima, vista area de um
condomnio; abaixo, um ramal interno)

sociopoltica dessas reas; a isto se seguiu, na mais perfeita normalidade,


a sua mobilizao em busca da adeso aos programas e da permisso
para o ingresso dos tcnicos na sua intimidade, para os levantamentos
cadastrais requeridos pelos meticulosos projetos de abastecimento de gua
e de esgotamento sanitrio. A outra questo disse respeito exatamente ao
artesanato desses projetos de distribuio de gua, em cada uma delas, com
a sua subdiviso em condomnios, agrupando-se estes segundo diferentes
zonas de presso, independentes entre si, onde a gua haveria de ficar
presa como condio do abastecimento equilibrado. Cada condomnio com
sua entrada nica de gua, potencial ponto de medio e com o seu ramal
condominial para suprimento de cada casa. Os obstculos interpostos ao
sucesso de tais empreendimentos permaneceram, contudo, quase intocados.
Em primeiro lugar, a insuficincia de recursos de todas as ordens para a
operao dos servios (h casos, por exemplo, da presena de um nico
funcionrio para o atendimento de at 4.000 ligaes). Depois, o descaso com
a cobrana e arrecadao dos servios, com a justificativa da desorganizao
cadastral e da violncia (real, mas que haveria de ser suplantada pela fora
e vontade institucionais). Isso que realimenta um terrvel ciclo vicioso: a
inadimplncia justificando a insuficiente operao, que, por sua vez, inibe o
poder de presso da comunidade, que tem o sentimento da inadimplncia...
E por ltimo, ainda, as dificuldades para o suprimento, em cada caso, das
parcelas de gua correspondentes s demandas, o que implicaria, sempre, na
subtrao de volumes ao asfalto (designao dos habitantes das favelas para
as reas urbanas prximas, de maior poder aquisitivo e urbanizao regular).
Os trs empreendimentos que so considerados a seguir, situados em
Braslia, Salvador e Parauapebas, esta ltima no sul do Estado do Par,
devem ser atentamente observados, justamente, porque cada um com as
suas caractersticas representou grandes saltos e novos horizontes para o
modelo condominial.

Braslia

Esse processo de absoro do sistema


condominial foi conduzido pelo jornalista
Washington Novaes, ento respeitado
Secretrio do Meio Ambiente do Governo do
Distrito Federal, a partir de um processo de
DGHVmRjVQRYDVLGpLDVQDSUySULD&$(6%
HQD$GPLQLVWUDomR'LVWULWDO$GHFLVmRQDO
importante dizer, foi assumida pelo governo,
acima, portanto, da CAESB.

O Distrito Federal do Brasil tem, hoje, cerca de 2,3 milhes de habitantes


distribudos na cidade de Braslia e em mais de duas dezenas de cidades,
alm de alguns aglomerados urbanos menores. A partir de 1991, a CAESB,
concessionria distrital dos servios de saneamento, passou a adotar o
modelo condominial para realizar o esgotamento sanitrio sob a sua alada,
como forma de garantir a universalizao do atendimento, depois de
comprovar os menores custos e a elevada qualidade desse modelo 5. Como
resultado, essa universalizao est hoje praticamente alcanada, com o novo
sistema atendendo mais de 1 milho de pessoas. Foi excelente exemplo do
uso em larga escala do sistema condominial para atendimento em massa: 200
mil ligaes, 3 mil km de coletores condominiais implantados e operando,
7 mil reunies condominiais realizadas para a implantao do sistema
abrangendo, diretamente cerca de 70 mil pessoas.
Esses resultados alcanados, a grande economia proporcionada e alguns
outros fatores e caractersticas do programa alimentam o sucesso do Sistema
49

Sistema Condominial: teoria e seu processo de construo

Condominial no Distrito Federal, o qual pode ser representado por fatos tais
como:
t a eficincia e objetividade com que o modelo condominial vem
sendo aplicado, focado na viabilizao do atendimento, com regras
claras, condies de adeso atrativas populao, uso de tcnicas
modernas, procedimentos de implantao muito rpidos e diretos e
concepes operacionais adequadas;
t Bqualidade dos sistemas implantados, da sua operao e dos
servios (entre os melhores do Brasil) - fundamentais para a
credibilidade do novo modelo aos olhos da populao e refletindo a
capacidade tcnica e gerencial da CAESB;
t Badoo do sistema condominial como modalidade de
esgotamento nica, fazendo com que os mais diferenciados
estratos sociais fossem atendidos com o mesmo modelo, desde os
assentamentos mais pobres aos luxuosos Lagos Norte e Sul com
suas famosas manses, conforme ilustrao em foto, significando
segurana populao quanto qualidade do que lhe oferecido;
t Bperfeita condio em que se processou, no interior da CAESB, a
institucionalizao do novo sistema, desde os momentos iniciais de
sua aplicao, perpassando os projetos, as obras e at a operao.

ma idia dos nmeros obtidos


nesse programa de sistemas
condominiais em Braslia pode ser
tirada da cidade de Santa Maria,
cuja rede bsica est parcialmente
representada na Figura 6 do
captulo anterior. Esta cidade,
de 200.000 habitantes na sua
VDWXUDomRFRQUPDDEDL[tVVLPD
densidade da Rede Bsica,
2,92 m/lig, menos da metade da
H[WHQVmRGDVUXDVHLQXHQFLDGDV
pelas pequenas profundidades,
forneceu um custo mdio de
construo de apenas US$19,00/m
(referido no ano de 1998), um
verdadeiro recorde. interessante
destacar, ainda, a signifcativa
representatividade do investimento
privado nos ramais condominiais
do seu sistema de coleta: os 192
km de seus ramais condominiais, o
dobro da rede bsica, teve um custo
de 2,85 milhes de dlares, que
representou nada menos do que
GRFXVWRWRWDOGDFROHWD

Em resumo, as grandes contribuies de Braslia ao sistema condominial


de esgotamento vieram com a sua utilizao, como alternativa, em 1992;
com a diversificao dos segmentos sociais atendidos; com a coerncia
no estabelecimento das regras do jogo e o rigor na sua aplicao; com
o elevado nvel de sua institucionalizao no interior da concessionria; e
com a satisfao dos usurios. Esses fatos, sem qualquer dvida, tornam o
empreendimento em Braslia um dos mais interessantes dentre todos que
adotaram o modelo condominial.

Salvador
Salvador, capital da Bahia, tem cerca de 2,5 milhes de pessoas, sendo
que a sua metade mais pobre vive em reas altamente crticas. Topografia
acidentada, elevadssima densidade, ocupao espontnea, presena de um
histrico sistema unitrio para as suas duas guas e precrias habitaes
(muitas delas superpostas em trs ou quatro pisos, conjugadas de ambos os
lados e com insuficientes instalaes sanitrias prediais). Esse gigantesco
complexo urbano, portanto, no deve ter concorrentes no que tange
s dificuldades que oferece implantao de um sistema separador
de esgotos, qualquer que seja sua tipologia: pela ocupao dos espaos
caractersticos da coleta, pela grande disperso das instalaes sanitrias
residenciais e pelos obstculos separao das guas pluviais dos esgotos
dentro de cada casa. Para estas reas que abrangem populao da ordem
de 1 milho de pessoas, o projeto Bahia Azul, da concessionria estatal
EMBASA, destinado ao esgotamento sanitrio da cidade e implementado
nos ltimos dez anos, apenas sinalizava por hachuras nas plantas, que
50

Figura 15
O Sistema Condominial nas reas
sub urbanizadas de Salvador

Sistema Condominial

sucesso da implantao
do sistema condominial no
esgotamento de Salvador no pode
esconder dois graves problemas
que vm sendo enfrentados,
mas ainda no esto resolvidos.
O primeiro deles a luta pela
conquista da universalizao do
DWHQGLPHQWR KRMHLQIHULRUD
ainda que seja esta marca uma
GDVPDLRUHVGR%UDVLO GLFXOWDGD
por aquela prtica historicamente
aculturada da reunio das guas
pluviais e esgotos, desde o interior
das residncias, e que obriga
a novos investimentos para as
ligaes a um separador, alm do
pagamento da tarifa. O outro a
observao da EMBASA, ainda no
mensurada por pesquisa objetiva,
de que haveria uma tendncia
VLVWHPiWLFDjWUDQVIHUrQFLDGDV
obstrues nos ramais para a
concessionria, ao contrrio dos
compromissos expressos nos
termos de adeso que antecederam
as obras. Essa ltima questo h de
contar com o esforo da EMBASA
para bem compreender a questo.
E em seguida, racionalmente,
PHOKRUUHGHQLUSDSpLVOHYDQGR
HPFRQWDDVHVSHFLFLGDGHV
locais, j que o emaranhado de
canalizaes nesses ramais tornam
difcil estabelecer-se o que seria
mais prprio e adequado para cada
uma das partes no processo de
manuteno.

adotaria o modelo condominial. Pode-se afirmar que isso j demonstrava a


certeza da inaplicabilidade do sistema convencional e tambm um flagrante
desconhecimento do que seria a essncia desse novo modelo. Esse foi o incio
do processo.
Hoje os dados do conta de que nos 10.000 condomnios delimitados
nessas reas foi realizado o mesmo nmero de reunies, colhido o mesmo
nmero de termos de adeso e implantados nada menos que 2.500 km (!)
de ramais condominiais (daqueles sem mais que uma alternativa para o
percurso), nos mais exguos espaos privados, driblando incrveis obstculos
e penetrando na intimidade das residncias. Com um nmero irrisrio de
conflitos, praticamente nenhuma proibio a tais passagens, mobilizando
duas dezenas de grandes empresas (entre elas as maiores do Pas) que
apreenderam o processo no curso das aes e mobilizaram o trabalho
exclusivamente manual de milhares de operrios. Salvador e a EMBASA
ofereceriam, portanto, o ingresso e o teste do novo sistema numa regio
metropolitana, em grandeza e complexidade inexcedveis at ento.
Das redes bsicas destas reas somente h a acrescentar, alm de sua
obedincia teoria, a ocorrncia de algumas situaes curiosas e criativas
que foram enfrentadas nos difceis caminhos de Salvador. So os casos, por
exemplo, dos coletores areos ou dispostos sobre o terreno, tubos de queda
de 20 m de altura ou interceptores pressurizados, situaes que estaro
melhor descritas no Caderno 3 desta Srie.
J a coleta diretamente das residncias teria sido impossvel, no fosse o
papel facilitador da delimitao dos condomnios, ao subdividir o complexo
universo em pequenas reas quase individualizadas e somente assim
desvendveis pelos ramais condominiais. Com efeito, a delimitao foi
um fator determinante para desvendar a complexa urbanizao, e assim
chegar-se a cada uma das casas onde se deveria oferecer um ponto de coleta.
Seguiu-se o cadastramento de cada casa com a indicao das instalaes
sanitrias (de quem os ramais deveriam se aproximar para diminuir o
custo das interligaes). Depois, a elaborao dos projetos dos ramais
condominiais, que nunca puderam contemplar mais do que uma nica
alternativa de traado, sempre exercitando a mxima mobilidade no drible
dos incrveis obstculos. As fotos da Figura 8 so ilustrativas dessa condio
aqui referida, desse verdadeiro artesanato.
Nas reas regularmente urbanizadas de Salvador que receberam o sistema
condominial, nada foi diferente do que se viu anteriormente ao descrever-se
o programa de Braslia, dispensando-se, portanto, novos comentrios.

Parauapebas, no Par
Parauapebas est situada ao sul do Estado do Par, onde se localizam
as formidveis jazidas de ferro da Serra dos Carajs, exploradas
intensivamente pela Companhia Vale do Rio Doce (hoje, apenas, Vale).

51

Sistema Condominial: teoria e seu processo de construo

Nesse contexto, ela se tornou uma cidade especial, um eldorado, com


um gigantesco crescimento urbano e um forte dinamismo econmico,
de tal sorte que tendo apenas 20 anos de idade j detm, hoje, uma
populao superior a 150.000 habitantes. A cidade est bem situada na sua
urbanizao, apresentando uma ampla malha de sistemas de infra-estrutura
fsica e social e se distinguindo na regio por no ter favelas - a despeito do
grande nmero de casas pobres.
O seu sistema condominial de distribuio dgua, construdo em 1994
quando a cidade tinha 60.000 habitantes foi fundamental na insero
do novo modelo neste novo campo de atuao, mas ser objeto de uma
meticulosa abordagem no Caderno 4 desta Srie Condominial. Aqui
apenas se destacar algumas marcas alcanadas nessa nova incurso que,
sem dvida, se mostra altamente promissora para os pases com grande
deficincia de abastecimento urbano de gua e para as ampliaes ou
substituies de redes nas cidades que j contam com abastecimento.
Apesar da grande reduo dos investimentos em redes e ramais nesse
sistema (vide o box ao lado e a Figura 16 ), no este ainda o elemento
mais vantajoso da metodologia, mas a sua extraordinria contribuio ao
controle da distribuio de gua, com repercusso direta na reduo das
perdas, tendo em vista:
t BQPTTJCJMJEBEFPGFSFDJEBQBSBBinstalao, em cada ramal
condominial, de um micromedidor (fiscal das medies
individualizadas no seu interior) e um registro de parada, facilitador
de operao de manuteno no conjunto das instalaes situadas no
condomnio;
t OPTTJTUFNBTDPOWFODJPOBJT DBEBMJHBPQSFEJBMTFSFBMJ[BBQBSUJS
de um furo no distribuidor da rua, o que tende a se transformar
em ponto crtico pelo que ele oferece potencial fuga de gua, tantas
quanto forem as ligaes. No sistema condominial, por seu turno, a
abordagem dos distribuidores mnima (uma, apenas, por quadra
e, alm disso, sempre realizada atravs de conexes padronizadas,
assim como nas ligaes das casas aos ramais condominiais; nenhum
furo, portanto no sistema);
t o dimensionamento do ramal condominial sendo realizado
especificamente para a suposta demanda da sua quadra um fator
de potencial reduo de perdas e desperdcios (em Parauapebas, por
exemplo, os dimetros de todos os seus ramais condominiais foram
de 25 mm e 32 mm).

4.2 E AS PRINCIPAIS DIFICULDADES...


Nos seus quase 30 anos de existncia, o sistema condominial atingiu uma
populao de cerca de 5 milhes de pessoas, em pelo menos 8 estados
do Brasil e alguns outros pases do mundo. No Rio Grande do Norte
e em Braslia, ele vem sendo utilizado com exclusividade desde as suas
experincias iniciais, em 1982 e 1992, respectivamente, e neles j detm
52

comparao dos custos do


sistema originalmente projetado
e do sistema condominial, em
Parauapebas, na Par, foi decisiva
para a deciso por este ltimo.
Em nmeros da poca, em reais,
as duas redes numa mesma rea
forneceram valores que pareciam
um disparate: R$ 179,91/lote no
convencional contra R$ 47,22/lote
no condominial, ou seja, a quarta
parte. Ao se considerar os ramais,
a vantagem ainda foi maior para
o sistema condominial: R$ 43,43/
lote para os ramais individuais e R$
17,00/lote para os condominiais. No
conjunto R$ 223,14 contra apenas
R$ 64,22/lote o que equivale a dizer
que o sistema condominial com
mesmos recursos de investimentos,
ser capaz de atender 3.500
pessoas para cada 1.000 atendidas
pelo sistema tradicional.
Mas alm da mudana no projeto
da distribuio, a universalizao
do atendimento no teria sido
possvel se a construo dos ramais
condominiais no tivesse ocorrido
pela prpria populao, sob rigorosa
orientao tcnica. Na ocasio,
60.000 pessoas, mobilizadas em
seus 700 condomnios, sendo
capazes da construo de 150
km (!) de tubulao - a partir de
uma inusitada idia, nunca vista
anteriormente.

Sistema Condominial

Figura 16
Sistema Condominial de
distribuio de gua

a maioria dos atendidos por sistemas regulares de esgotos. Tambm


verdade que uma grande parte dos sistemas de esgotos construdos mais
recentemente ainda sob a inspirao mais tradicional, j tem apresentado,
contudo, alguns traos caractersticos do novo modelo, o que sugere a sua
influncia nessa direo.
Quando sabido, por outro lado, que no tem sido intensa a dotao de
servios de esgotos - quaisquer que sejam - nesses mesmos pases, ficase sem saber ao certo o que representam estas conquistas em termos de
aceitao e propagao do novo sistema: poderia ter sido maior a sua
aplicao? Ou j teria sido alm do espervel? De qualquer maneira, que
dificuldades, por certo, so encontradas para a sua expanso e como
poderiam elas ser enfrentadas? Um esforo de enveredar-se pelas possveis
respostas a essa ltima questo o que ser visto a seguir.
Nesse sentido, e embora no exista uma pesquisa voltada para esse assunto,
tem-se, contudo, o sentimento, de que as dificuldades interpostas ao
desenvolvimento dos sistemas condominiais so distintas na forma como
aparecem, mas podem ter uma certa interao em suas origens. So elas,
principalmente, as seguintes.

'LFXOGDGHVGHIXQGRFXOWXUDO
Essas dificuldades de natureza cultural ganham terreno num certo
conservadorismo reinante no ambiente do saneamento bsico. Com
efeito, se bem que sejam verdadeiros seus avanos nos campos da tecnologia
53

Sistema Condominial: teoria e seu processo de construo

especfica (evoluo de materiais, equipamentos, unidades de tratamento,


sistemas operacionais, etc), so visveis, por outro lado, as suas dificuldades
para algum afastamento das normas e costumes muitas vezes seculares,
e mais ainda para mudanas comportamentais como as que esto presentes
nos sistemas condominiais. Dentre estas se pode admitir como mais
significativas a proposta de uma nova relao com a comunidade de usurios
(informativa e participativa, tendente parceria); a busca de integrao
de aes entre agentes institucionais (concessionrios, municipalidades,
iniciativa privada); a abertura de caminhos viveis para a decidida entrada
dos servios de saneamento nas suburbanizaes; e algumas alteraes de
padro que eventualmente contrariem as normas, embora que valorizando
a hidrulica. Ou seja, a corporao do saneamento prefere no mudar
deste ponto de vista comportamental. Bons exemplos desse fenmeno, nas
prprias organizaes, que de alguma forma tenham aderido ao sistema
condominial, so tendncias tais como as seguintes:
t GPSNBPEFequipes especficas, apartadas dos sistemas
organizacionais regulares dos prestadores de servios, para a execuo
de projetos de natureza condominial (o que adiante ir dificultar a
disseminao das novas idias no conjunto das estruturas);
t permanncia dos procedimentos tradicionais na operao dos
servios sobre os sistemas construdos sob a inspirao condominial, o
que representa um corte na forma do relacionamento vivenciado por
ocasio da implantao dos sistemas, ou seja, quem vai operar (e h de
constituir uma relao definitiva com os usurios) pouco ou nada sabe
do que teria ocorrido nas fases iniciais do processo;
t as duas questes problemticas acima, s vezes, se complicam ainda
mais quando o construtor dos sistemas um orgo que no ter
nenhum compromisso com a futura operao (por exemplo, uma
empresa estatal de habitao popular, como foi muito freqente); ou
ainda, quando as equipes de uma ou outra das fases do processo so
simplesmente terceirizadas e, portanto, provisrias (levando consigo o
treinamento obtido em servio, em detrimento da continuidade) como
o caso, por exemplo, de Lima, no Peru, no Projeto de Ampliao da
Cobertura, que abrange mais de 200.000 pessoas.

)DOWDGHFLrQFLDHDWpGHWXUSDomRGHLQIRUPDo}HV
Esta dificuldade de carter eminentemente logstico ou estratgico. Diz
respeito insuficincia de documentao sobre o novo modelo (que agora
se pretende eliminar com a publicao desta Srie) e tem propiciado a
ocorrncia de uma gama de problemas, conforme se relaciona a seguir:
t diversidade na forma de entender e interpretar o modelo, o
que, com freqncia, tem levado a equvocos na transmisso de
informaes ou na prpria produo de experimentos. bastante
comum, por exemplo, a ocorrncia de opinies firmadas sobre o
sistema - geralmente desfavorveis- vindas de pessoas que jamais
leram alguma coisa de consistente sobre ele;
54

Sistema Condominial

m exemplo interessante
de adaptao de sistema
LQVWLWXFLRQDOjVFRQGLo}HV
urbanstico-scio-culturais das
comunidades aqui abordadas
vem com o Sistema de Sade no
Brasil, que h vrios anos adota um
procedimento vitorioso, ao que tudo
indica, representado pelos Agentes
Comunitrios de Sade. Trata-se
de uma forma de aproximao da
instituio com a populao que
WHPGLFXOGDGHVGHDEVRUYHUDVXD
prxis tcnico-burocrtica. No
deveria deixar de ser cogitado, a
esse respeito, alguma forma de
convnio do concessionrio com
o Sistema de Sade, capaz de
tornar possvel uma colaborao
desses agentes com o saneamento,
TXHDQDOGHFRQWDVpIDWRU
preponderante de sade. Vale
ressaltar que aes como estas
precisariam ser pactuadas por
sobre os prestadores de servio ou pelo menos que no os onerem porque efetivamente esto situadas
acima dos seus limites e devem
constituir, francamente, obrigaes
HVSHFtFDVGRVJRYHUQRV

t difuso da nefasta idia de que se trata de um sistema simplificado


destinado s populaes pobres, deixando-se subjacente a idia de
deficiente qualidade. Esta questo ainda mais nefasta quando ela se
estende a uma prtica efetiva de atribuir os sistemas convencionais
aos setores plenamente urbanizados da cidade e o condominial, s
favelas e similares;
t Bdoo do modelo apenas na sua engenharia - os ramais condominiais
de passeio estendidos a toda a cidade, por exemplo, sem que se
tire o devido proveito da participao da comunidade na adeso
universalizada, na sua informao para o uso e na sua participao no
prprio investimento.

Um caso particular: sistema para pobres?


Essa verso difundida, com boa e com m f, e pode ser facilmente
explicada... que o sistema institucional do saneamento tem uma grande
dificuldade de entrar com os seus servios nas favelas e reas degradadas
urbanas, e, durante muito tempo, inclusive, deixou de entrar nelas com
o prprio servio de abastecimento de gua, alegando razes tcnicas.
At que a situao do desabastecimento tornou-se um escndalo e, de
alguma forma, a gua teve que comear a chegar nessas reas e no
parou mais de chegar, mesmo que sob formas nem sempre adequadas.
que, de fato, tudo l muito difcil para o prestador de servio, em
funo das j referidas precariedades urbanas de todas as ordens e mais a
pobreza.
Do ponto de vista do prestador de servio pode ser resumido no seguinte:
extrema dificuldade para individualizar cliente, consumo, conta,
arrecadao e, principalmente, cobrana e seus mecanismos;
descontrole absoluto da distribuio dgua, inclusive pela agresso
s canalizaes; fraqussima arrecadao (mdia e total na rea); e da a
franca, mas velada, desmotivao. No exagero dizer que uma eficiente
operao de abastecimento de gua nessas reas teria um custo fixo por
ligao (desconsiderado os consumos) algumas vezes maior que o de um
bairro urbanizado, ao passo que ocorre o inverso com o faturamento e a
arrecadao. Esta problemtica, salvo melhor juzo, ainda uma questo
no resolvida no Brasil, e muito pouco estudada como, alis, tambm
a questo maior da prpria favela em seu todo altamente complexo. H
indcios muito fortes de que este no um quadro apenas brasileiro, mas o
que existiria onde quer que ocorra um assentamento populacional assim sub
urbanizado.
Se com os sistemas de gua - mais essenciais, mais desejados e mais fceis de
operar - as suas circunstncias so dessa ordem de dificuldades, imagine-se a
situao com sistemas de esgotos sanitrios.
E os sistemas condominiais, com variaes no processo de sua dotao e que
acompanham as prprias diferenas entre seus patrocinadores, de uma forma
55

Sistema Condominial: teoria e seu processo de construo

ou de outra foram sendo introduzidos em reas com tais caractersticas,


justamente porque so nicos na sua condio de adaptabilidade e de
mobilidade dentro delas. Os ramais condominiais utilizados, quase que
invariavelmente localizados nas reas mais internas, seno mais ntimas
desses assentamentos, como nica alternativa para a coleta universalizada
teriam que ser submetidos, como de fato o so, simultaneamente, s mais
complicadas condies operacionais pelo lado da demanda e pelo lado da
oferta. Pela demanda, e repetindo, as mais que precrias condies de stio,
de habitao, de renda e de cultura face aos requisitos de um sistema de
esgotamento; e pelo lado da oferta, a par daquela desmotivao potencial
dos prestadores de servio (justificada em face da menor ateno do
sistema institucional como um todo), a insuficincia de recursos alocados a
esta operao, o que parece ser uma ocorrncia generalizada.
Esse contexto, portanto, rene tudo que nocivo a um sistema separador
de esgotos fosse qual fosse a sua modalidade: precrias instalaes sanitrias
domiciliares, inclusive com a usual presena de guas pluviais; freqentes
descuidos no uso do servio a partir das casas; e deficiente assistncia
do prestador do servio na manuteno e, mais ainda, no que seria um
necessrio e continuado processo de educao sanitria. Em muitas
situaes os sistemas operam deficientemente, atingem elevados nveis
de degradao ou at mesmo o colapso, e como as responsabilidades no
so reconhecidas, usual atribuir os problemas, imagine, aos sistemas
condominiais, sendo assim penalizados, paradoxalmente, pelo fato
exclusivo de terem sido os nicos a enfrentar a situao...
Em cada local onde esteja instalado este tipo de problema se faz necessrio
um esforo de adaptao de cada concessionrio envolvido, no sentido
de apreenderem a realidade e em seguida adequarem seus procedimentos
operacionais a essas condies altamente especiais. Isto haveria de comportar
trs aes de grande peso e certa complexidade, a saber:
t realizao de uma pesquisa em profundidade em cada rea, no
sentido de bem conhecer o seu sistema (desde os ramais aos desges
no sistema geral) e, por amostragem, tambm as condies do
lanamento dos efluentes das casas, o que permitiria a compreenso
da problemtica;
t adequao da sua operao-manuteno s condies acima
compreendidas, o que passa, necessariamente, pelo resgate dos
compromissos recprocos assumidos durante o processo de
implantao das obras, agora corrigidos em funo dos novos dados
da realidade; implcita nessa adequao uma maior aproximao do
prestador do servio e sua operao em relao comunidade uma
desejvel descentralizao;
t correo e reparao do que esteja incorreto no sistema de coleta,
sejam falhas oriundas do projeto ou da construo (no raras, e
que produzem continuados defeitos amplamente desgastantes
para a relao prestador-comunidade), sejam impropriedades que
tenham sido geradas pelo processo continuado de transformao do
56

Sistema Condominial

assentamento, de tal sorte que aquilo que era o razovel por ocasio
das obras, agora requerendo adaptaes na continuidade (ou seja, a
mobilidade dessas reas obriga, necessariamente, uma mobilidade
nas partes menores dos seus sistemas de infra-estrutura).

Restries normativas
Em vrias ocasies, a teoria aqui exposta destacou a importncia de
valorizao do melhor da engenharia sanitria e da hidrulica, em
particular, nas aplicaes do sistema condominial, em projetos, construo
e operao. E, em consonncia com essa inspirao, o modelo condominial
conquistou alguns avanos significativos no dimensionamento dos seus
sistemas, particularmente quanto reduo do limite mnimo para os
dimetros, quanto aplicao de caixas de inspeo como alternativas dos
poos de visita, em algumas situaes, e quanto possvel descentralizao
das unidades de tratamento ou ao aumento de estaes elevatrias para
reduo das profundidades. Sempre com reduo de custos e preservao
da melhor qualidade. Da que se sugere aos atuais e futuros concessionrios
adeptos do sistema condominial, que realizem uma criteriosa investigao
sobre o seu acervo tcnico norteador dos projetos - regulamentos,
especificaes, modelos, etc - no sentido de moderniz-los em benefcio
do maior atendimento da populao, e sempre em conformidade com os
preceitos daquelas duas inesgotveis fontes.

Questes de direito
Plano Diretor da Cidade de Recife
Lei n 15.547/91- Art. 77 - O padro
de coleta na Cidade do Recife
ser aquele em que a rede pblica
atende coletivamente a cada
quadra, entendida essa como a
unidade de parcelamento do solo,
delimitada por logradouros pblicos.
1- A responsabilidade do
Poder Executivo restringe-se
jLPSODQWDomRGDUHGHS~EOLFD
que viabilize o acesso de todas
as quadras e das estaes de
tratamento e outras unidades
necessrias ao funcionamento da
parte pblica do sistema.
2- A canalizao que rene
os esgotos de todos os lotes
da quadra, para lan-los na
rede pblica, constitui o ramalcondomnio, cujas implantao,
operao e manuteno so
responsabilidade dos proprietrios
dos imveis integrantes das
quadras.

Nos sistemas condominiais, o condomnio tem sido considerado, em


todas as suas circunstncias, como uma figura informal, tendo sua atuao
concentrada, na prtica, na ocasio da implantao das obras. a que ele
mobilizado e chamado a aderir ao sistema com a sua assinatura (em carter
simblico) em uma lista com propsitos recprocos, o que tomado como
um pacto informal entre o prestador do servio e os usurios.
Nos condomnios onde a deciso sobre os ramais foi localiz-los nos
passeios, aquele pacto, na prtica, fica limitado a esta deciso, j que a futura
operao se consolidar naturalmente sob a responsabilidade do prestador
do servio, segundo a tarifa em vigor e que considerou esta condio. Ou
seja, neste caso, o papel do condomnio est praticamente esgotado.
Onde os ramais condominiais esto dentro da propriedade privada - por
escolha dos condminos informais ou por falta de uma outra opo - o
documento que autoriza uma tal condio aquele mesmo da situao
acima, portanto informal e sem valor legal, s que, aqui, a operao futura
ser sempre dependente de um regime de cordialidade e colaborao entre
o concessionrio e os usurios e, de certo modo, desses ltimos entre si.
Com certeza no h registros estatsticos sobre ocorrncias que teriam
ultrapassado os limites daquela cordialidade, da mesma forma que ao que
tudo indica, no sejam elas em nmero significativo. Mas o fato que alguns
prestadores de servio tm pelo menos comentado a possvel convenincia de

57

Sistema Condominial: teoria e seu processo de construo

uma legalizao dessas situaes, tornando-as mais confortveis para o seu


desempenho, e tambm mais consentneas com a sua postura tradicional.
Numa perspectiva de ampliao da utilizao dos sistemas condominiais,
pode vir a ser interessante uma considerao mais objetiva sobre essa questo
- mais em atendimento a incertezas de concessionrios do que como uma
demanda efetiva da populao. Nesse sentido, se torna bastante conveniente
que sejam levados em conta os trs componentes seguintes, concorrentes
para eventuais situaes problemticas e que haveriam de ser conciliados:
t FNQSJNFJSPMVHBS a realizao de pesquisa amostral que pudesse
caracterizar a natureza da questo e a freqncia na sua ocorrncia,
esclarecendo a prpria necessidade e a convenincia da iniciativa;
t OBFWFOUVBMGPSNVMBPEFVNBTPMVP BDPOTJEFSBPEFRVFPT
pactos informais esto generalizados nos assentamentos sub urbanos
e favelas, vm determinando seu desenvolvimento e se constituem,
inclusive, em potencial energia favorvel ao estabelecimento de
um processo de revitalizao efetivo dessas reas, quando vier a ser
isso uma deciso insofismvel dos diversos nveis de governo;
t OBCVTDBEFQPTUVMBEPTKVSEJDPMFHBJTRVFSFHVMFNEFGPSNB
mais veemente os acertos condominiais, que se busque fugir da
abordagem quadra a quadra - que alm de improdutiva, seria
burocraticamente interminvel - ficando-se no plano da legislao
que enfoque o problema de forma mais globalizada (veja, por
exemplo, no destaque deste item, o que trata a respeito da questo o
Plano Diretor de Desenvolvimento da cidade do Recife).

(QDOPHQWH
No Brasil e noutros pases em desenvolvimento, possivelmente, as
intervenes institucionais nos assentamentos pobres, todas elas inclusive
as de saneamento, costumam ser menos atentas qualidade do que so as
recomendaes tcnicas usuais. Isto vale para a construo e, sobretudo,
para a operao e manuteno. Em muitos casos, inclusive, no exagero
afirmar-se que elas comeam a definhar na data da sua inaugurao. E
so, inegavelmente, essas reas, as mais exigentes de uma eficaz operao,
em conseqncia de suas conhecidas complicaes e limites. Os sistemas
condominiais do Brasil, os menos e os mais afinados com a teoria aqui
exposta, mas sempre ditos condominiais, so mais numerosos nas reas
crticas de que se falou neste documento do que em reas de urbanizao
plena. Se poderia at afirmar que em todos as cidades onde esto presentes, o
seu incio, sua experincia-piloto, foi sempre em reas pobres e em algumas,
inclusive, permaneceram sempre restritos a essas reas.
Em se aplicando a tais sistemas aquelas assertivas relativas qualidade,
resulta evidente o prejuzo que comum constatar-se nessas circunstncias:
o fraco desempenho dos servios, o desgaste das instalaes e o desagrado
58

Sistema Condominial

da populao. Fatos injustamente atribudos ao modelo condominial


para esconder as dificuldades locais especficas e, sobretudo, a menor ou
inexistente assistncia operacional.

59

Sistema Condominial: teoria e seu processo de construo

5. AS PRINCIPAIS VANTAGENS
5.1 CONSIDERAES PRELIMINARES
Neste captulo, se pretende destacar e discutir as vantagens que esto
presentes nos sistemas condominiais de esgotamento sanitrio, o que
uma decorrncia direta dos fundamentos do modelo e de suas inmeras
aplicaes. A par disso, tambm se procurou apresentar, aqui, as principais
dificuldades que so usualmente encontradas nos momentos de deciso sobre
sua aplicao e no prprio curso de realizao dos empreendimentos sob
sua inspirao. A referncia que permitir as comparaes desejveis ser,
evidentemente, o modelo convencional de esgotamento sanitrio, tambm
do gnero separador absoluto. Ressalva-se, todavia, que nas reas pouco
ou nada urbanizadas onde este modelo tradicional no tem competncia, a
avaliao do novo modelo ser colocada em termos absolutos.
Em se tratando de sistemas de saneamento, a observao da qualidade e da
condio de universalizao se mostra fundamental numa anlise dessa
natureza. E, em se tratando da dimenso do dficit desse atendimento hoje
registrado, no apenas no Brasil, mas em todo o mundo em desenvolvimento,
o fator primordial da anlise o custo, a minimizao do custo; e sendo a
maior parte desse dficit oriundo das populaes que sub-habitam, apenas,
o requisito essencial a ser demonstrado o da versatilidade do sistema
frente s diversas urbanizaes.
O estudo comparativo no se far com base em valores absolutos, porque
nem eles so prprios para comparaes entre modelos diversos quanto aos
que se propem e universos sempre distintos de aplicao (e nem tampouco
estariam disponveis dados mnimos nesse sentido). A esse respeito, fiquese apenas com algumas indicaes espordicas como as j citadas ou
aquelas que o sero no Caderno 03 que apreciar alguns empreendimentos
especficos; ou com referncias to vagas como as de que no Brasil, por
exemplo, os custos de implantao de um sistema separador convencional
de esgotos, completo, incluindo tratamento, variam em uma faixa to ampla
quanto a que se estende de US$ 1.000 a US$ 2.000 por famlia atendida.
Nesse sentido, ento, os propsitos do que agora ser focalizado sero
cumpridos tomando-se por base a certeza de que alguns conceitos
emanados da teoria do sistema condominial de esgotamento sanitrio
so suficientes para, exercitando a sua racionalidade intrnseca, apenas,
demonstrar que este sistema suplanta os que seguem o modelo mais
convencional nos aspectos que parecem importantes para um servio
pblico com essa essencialidade, quais sejam:
t
t
t
t
t

60

UFNNFOPSFTJOWFTUJNFOUPT
NFOPSEFNBOEBQPSPQFSBPFNBOVUFOP
NBJPSFTGBDJMJEBEFTDPOTUSVUJWBT
DBQBDJEBEFEFiFOUSBSwFBUFOEFSBRVBMRVFSVSCBOJ[BP
FRVJWBMODJB OPNOJNP OBRVBMJEBEFEPTTFWJPT

Sistema Condominial

5.2 AS VANTAGENS EVIDENTES


A demonstrao dessas vantagens ocorre em termos fsicos, onde as diferenas
so irrefutveis e se mostram em carter absoluto. Nele, os conceitos que
garantem as afirmaes so os obtidos da teoria aqui apresentada e que esto
presentes ou decorrem da figura do condomnio. So eles, assim, a rede bsica,
os ramais condominiais e a participao comunitria. A figura 17, conhecida
de todos os iniciados no sistema condominial, pode ajudar na leitura do que
se segue, j que ela uma representao dos dois modelos em discusso,
hipoteticamente aplicados a uma mesma rea.
A rede bsica, por exemplo, porque apenas tangencia cada quadra ou lhe
toca em um ponto (o de reunio de seus esgotos) - ao invs de circundla por inteiro - se faz, naturalmente, com uma extenso mnima, que
dificilmente supera a metade da extenso total de ruas da rea atendida.
E, como esse ponto de reunio dos esgotos da quadra , evidentemente, o
mais baixo do seu permetro, essa rede bsica tem tambm as menores
profundidades j que acompanha, quase, a linha das maiores declividades
da mesma rea. Esses dois fatores minimizados - canalizaes e escavaes
- trazem consigo, por conseqncia, a minimizao de todos aqueles outros
fatores que lhes esto associados e que redundam na prpria minimizao
dos investimentos e das dificuldades construtivas, a saber:
tEBquebra e reposio de pavimentao de ruas e, muito importante,
minimizao dos transtornos do trnsito durante a execuo das obras;
tEFrebaixamento de lenol dgua subterrneo e de escoramento de
valas;
tEFinterferncias com outras obras de infra-estrutura localizadas
no sub-solo e de escavaes em rocha e que demandam explosivos;
tEFpoos de visita, pois, alm da menor extenso das redes que
lhe determinam, as menores profundidades ensejam a localizao de
parcelas da rede bsica sob os passeios, onde podem ser utilizadas ao
menos caixas de inspeo, ao invs dos custosos poos.
A menor extenso de rede , certamente, tambm elemento redutor da
demanda potencial por servios de manuteno, mais ainda quando se
considera que numa extenso de rede assim menor maior a densidade do
fluxo (vazo por unidade de comprimento) e a correspondente capacidade de
arraste em cada ponto, o que fator de reduo de ocorrncias de obstruo.
No que tange qualidade dos servios, mantidos os preceitos da hidrulica e
do saneamento, como mais uma premissa do mtodo condominial, ela est
absolutamente assegurada ao nvel das exigncias regulamentares.
No caso dos ramais condominiais, as suas posies (percursos e cotas) so
definidas como as mais convenientes para a integral coleta de cada casa
da quadra. Conceito este que se mostra suficiente para garantir a coleta
integral em toda e qualquer urbanizao - potencial universalizao do
atendimento! - e, alm disso, pelos menores custos (mesmos predicados
alegados para a rede bsica, agora, sendo as casas que com os seus pontos de
reunio de esgotos, definem os ramais).

61

Sistema Condominial: teoria e seu processo de construo

Figura 17
Os Sistemas e sua comparao

62

Sistema Condominial

Nas favelas e urbanizaes irregulares, a sua extenso e profundidade


so sempre as menores, por hiptese, se o requisito o de tocar cada casa
naquele seu ponto especial, e no h termo de comparao pela falta de
alternativas de soluo que realizem o mesmo papel (ou seja, nesses casos o
ramal no o melhor ou o pior, ele simplesmente o tecnicamente indicado
e muitas vezes o nico possvel).
Nas quadras regulares no seu traado, os seus ramais condominiais,
quaisquer que sejam suas posies, considerados pela sua extenso,
profundidade e quebra e reposio de obstculos tendem, com certeza, a
apresentar custos muito menores do que aqueles que teriam os ramais
individuais, que so os seus equivalentes no modelo convencional. Mesmo
que no sejam raras as situaes de maiores extenses para os condominiais,
as suas valas mais rasas e as menores quebras de pavimentao certamente
compensariam qualquer desvantagem pelo lado da extenso. E at mesmo
na condio extrema de ruas muito estreitas em presena de testadas dos
lotes bastante largas (o que no uma situao comum), a garantia do menor
custo seria alcanada com o deslocamento do ramal condominial para o leito
da rua, onde atenderia os seus dois lados, segundo a prpria premissa de
que suas posies (deles, ramais condominiais) so definidas como as mais
convenientes para a integral coleta de cada casa da quadra...
vista do exposto, portanto, se deve concluir que os ramais condominiais
superam os seus equivalentes dos sistemas convencionais em custo e
facilidades construtivas (pelas suas menores escavaes e, sobretudo,
inexistncia das complicadas tubulaes transversais), e se equivalem em
qualidade do servio (mesma hidrulica, mesma engenharia sanitria). J
nas urbanizaes irregulares e favelas eles se mostram insubstituveis, pois
so os nicos a apresentar a mobilidade que torna possvel a coleta de cada
casa, condio que capaz de assegurar o alcance do atendimento pleno. No
que tange operao, e do ponto de vista do que aqui se examina, os ramais
condominiais, todos, tm dois pontos altamente favorveis em relao aos
seus equivalentes: a eliminao dos complicados cachimbos requisitados
para a interligao dos ramais rede pblica, nos sistemas convencionais
(eternos pontos crticos para a operao); e aquele maior fluxo de esgotos
por unidade de comprimento de canalizao, potencial redutor de
obstrues. Nos ramais condominiais de urbanizaes regulares, sobretudo
quando esto situados nos passeios, no resta dvida que as suas vantagens
so indiscutveis. Nas favelas e sub urbanizaes, por seu turno, bem como
em reas urbanizadas com ramais internos, em condies menos favorveis
de espaos - que so situaes onde apenas eles so capazes de entrar -
natural que a racionalidade do mtodo enfrente situaes inevitveis,
porque caractersticas desse meio urbano, e que so bastante desfavorveis
manuteno (pobreza e deseducao da populao, ausncia de espaos
adequados, violncia, deficincia da operao, etc), conforme foi comentado
em maior detalhe em captulo anterior.
O ltimo fator presente na teoria condominial e que tem seus resultados
fisicamente evidenciados (a despeito de no ser ele algo fsico como
os ramais ou a rede bsica), a participao comunitria, assegurada
63

Sistema Condominial: teoria e seu processo de construo

atravs da mobilizao dos condomnios. Os benefcios produzidos so


variveis em funo da intensidade da mobilizao e tm tambm certa
dependncia do tamanho do problema dos esgotos aos olhos da populao,
no momento da chegada do novo servio. Mas eles so muito importantes
desde o seu primeiro estgio, que a simples conquista da adeso (que
leva universalizao); concordncia com o pagamento dos ramais
condominiais que efetivamente constituem a parte privada do sistema e
cujos custos representam mais de 50% do sistema de coleta; a eventuais
compromissos com a manuteno dos seus ramais; e at mesmo absoro
da sua prpria construo (sob orientao tcnica do prestador do servio).

5.3 E AS VANTAGENS MENOS TANGVEIS


A teoria dos sistemas condominiais ainda exibe outras vantagens.
verdade que menos matemticas que as acima vistas, porque decorrem de
fatores ou aspectos abstratos e que por isso podem variar com a intensidade
e tambm com a criatividade, a competncia e outros atributos dos
executantes. So eles o processamento final dos esgotos tal como posto na
fundamentao do modelo condominial, e as idias que podem ajud-lo e
que decorrem de esforos de adequao realidade, integrao de agentes e de
aes e gradualismo. Eles no seguem regras ou procedimentos pr-definidos
e devem ser vistos como energias que ora reduzem custos, ora representam
aportes objetivos; ou ainda, tm efeito estratgico em face do melhor
benefcio/custo diante de qualquer disponibilidade de recursos financeiros
para investimentos, e que sejam inferiores ao montante total previsto para o
universo a atender.
A figura 18 , adiante, procura esboar, num grfico meramente ilustrativo pelo
seu formato, a influncia dessas idias nos sistemas condominiais: quanto
mais intensas a sua aplicao, melhores os resultados alcanados em termos
de custos, de efetividade do atendimento, de satisfao dos usurios. A
mais importante dessas idias, sem dvida, a participao comunitria. E
melhor do que mais teorizar sobre eles para evidenciar suas vantagens, ser a
apreciao de alguns exemplos reais entre os que sero abordados no Caderno
3 dessa Srie, ou que j foram tocados nesse prprio caderno.
Nas cidades do serto do Rio Grande do Norte que dispem de sistemas
construdos nos ltimos 25 anos, cerca de trinta, o processamento final
realizado atravs de lagoas de estabilizao (que amenizam o clima,
compem a paisagem e fornecem um efluente til a atividades agrcolas
rudimentares); e os terrenos que lhes servem foram cedidos pela suas
prefeituras, muitas vezes decorrentes de simples entendimentos com
seus proprietrios (troca do terreno pelos efluentes para irrigao). No
que tange operao desses servios em cidades do interior, h uma
repartio de atividades, com os ramais ficando a cargo dos condomnios
com (algum) apoio das municipalidades, e os componentes pblicos sob a
responsabilidade da concessionria estadual, a CAERN.
Em Petrolina, serto de Pernambuco, tambm so lagoas, onze, que tratam
seus esgotos de uma forma descentralizada, dispensando interceptores e
64

Sistema Condominial

Figura 18
Relao entre custos e mobilizao

utilizando terrenos pblicos na rea urbana, onde ajudam a compor a sua


paisagem. A mais central delas na cidade, natural e que recebia anteriormente
as guas da lavagem dos filtros da ETA, foi adaptada para a recepo exclusiva
de esgotos, mediante dois interessantes arranjos: o desvio das guas pluviais
por meio de um canal que a circunda; e a utilizao das guas provenientes
daquela ETA para a irrigao do maior parque da cidade, inteiramente verde
em pleno serto. Alm disso, a gesto de seus sistemas, todos construdos pela
municipalidade, se realiza atravs de uma parceria com a COMPESA, que
adota uma tarifa diferenciada para o atendimento condominial.
Em Braslia, no atendimento universalizado de mais de 600.000 habitantes,
as opes de localizao dos ramais condominiais e seus respectivos preos
foram absolutamente adequadas s variaes na urbanizao, nas casas e no
nvel de renda da populao.
O Plano de Ordenamento dos Esgotos do Recife, que previu a diviso da
cidade em 100 unidades de coleta, vem permitindo a criao de sistemas
descentralizados que melhor tm aproveitado as sucessivas (e limitadas)
disponibilidades de recursos financeiros que se tm apresentado.
Na favela do Morro do Estado, em Niteri, Rio de Janeiro, o seu reservatrio
principal de distribuio de gua est construdo em terreno negociado de
uma forma mpar: a Igreja Evanglica nele existente, simplria, foi demolida
cedendo seu espao quela unidade, em troca de sua reconstruo, em
melhores condies, sobre a sua laje superior.

65

Sistema Condominial: teoria e seu processo de construo

5.4 EM RESUMO, PORTANTO...


O sistema condominial chega a custar metade do que custaria um sistema
convencional de esgotos nas mesmas circunstncias, e atende aos mais
exigentes padres de qualidade e eficincia requeridos aos sistemas de
saneamento. Ele oferece, por outro lado, instrumentos para que o servio
possa ser prestado a toda a populao e com os mesmos padres gerais de
qualidade e eficincia. Para pobres e para ricos, indistintamente, e mesmo
nas situaes mais complicadas.
Admite-se, hoje, que a falta de participao social um dos fatores do
insucesso de inmeros projetos e programas de saneamento no mundo
todo. O modelo condominial incorpora a participao comunitria ao
processo de equacionamento dos problemas de saneamento, empregando
um mtodo de mobilizao social bastante objetivo e prtico. Ele se volta
para a viabilizao da implantao e operao do empreendimento, o
desenvolvimento da cidadania e a educao sanitria.
As menores profundidades, o traado mais enxuto e os componentes
otimizados da rede condominial facilitam a construo e posterior
operao dos sistemas. E, muito importante, permitem a incluso
dos usurios e das municipalidades nos processos de construo. A
descentralizao proposta no modelo condominial, no limite da viabilidade
tcnica e econmica dessa subdiviso, confere grande flexibilidade de
implantao da soluo, tornando possvel o atendimento gradual e
progressivo da cidade, de acordo com as prioridades locais e na medida da
disponibilidade de recursos.
Ele tem grande adaptabilidade. Aplica-se em praticamente qualquer
situao em que um sistema coletivo de saneamento tenha que ser utilizado,
com vantagens. Nesse sentido, quanto maiores as dificuldades econmicas
(escassez de recursos), urbansticas, topogrficas e culturais, maiores as
vantagens do sistema condominial.
Ao contrrio de outras solues alternativas de saneamento, que se aplicam
apenas em pequena escala e em situaes especficas, o sistema condominial
pode ser aplicado tambm em grande escala e para atendimento de massa
(Braslia, Salvador, etc).
A baixa adeso aos servios pode ser um problema srio no caso do
esgotamento sanitrio. Principalmente quando o problema de esgoto
est equacionado do ponto de vista das pessoas (mesmo que do ponto de
vista ambiental e da cidade eventualmente no esteja). A participao
comunitria fator da mais absoluta importncia para a conquista da
efetiva adeso da populao ao servio de esgotos.

66

Sistema Condominial

6. INTRODUO AO CADERNO 2

Introduo Geral dos Cadernos relembra que o Caderno 1 do Sistema Condominial tratou das razes, do desenvolvimento e da teoria
desse Sistema, ou seja, a sua abordagem abrange o que e o porqu
do Modelo Condominial de Esgotamento Sanitrio. Neste Caderno, por sua
vez, os objetivos so os de ensinar, da melhor forma possvel, como fazer
um empreendimento de sistema de esgotamento sanitrio segundo esse novo
modelo. Nesse sentido, ele um esforo de bem apresentar as metodologias
geral e especficas que permitiro alcanar esse objetivo, e a sua boa compreenso depende naturalmente do conhecimento daquele primeiro Caderno.
No esforo de uma tal produo foram vrias as preocupaes que a
permearam clareza, completeza, simplicidade mas duas delas, com
certeza, foram dominantes:
t BEFgarantir que os ensinamentos aqui postos possam conduzir
os seus leitores tcnicos, efetivamente, consecuo de seus
empreendimentos condominiais;
t FBEFevidenciar que o processo de implementao de tais
empreendimentos pode ser mais fcil e simples do que aquele
das obras tradicionais, e alm disso seus prazos de execuo que,
ao contrrio do que se possa imaginar, so ditados pelas tarefas
da engenharia, desde que sejam devidamente equacionados os
processos de mobilizao social.
Feitas essas consideraes iniciais, passa-se, ento, aos esclarecimentos sobre
o sistema de organizao adotado para este caderno, a partir do fato de que
o modelo condominial tem como uma de suas principais caractersticas
a integralidade de seus conceitos, instrumentos e componentes, na
construo de um pacto que paire sobre seus empreendimentos e que
envolva o prestador do servio e seus possveis parceiros, a municipalidade
e a populao usuria. Um pacto que seja um bom negcio para todos,
onde os aportes de cada um (custos, dispndios, esforos, tolerncias) sejam
traduzidos em sade e bem-estar das pessoas e em salubridade do meio
urbano, asseguradas essas condies pela construo do empreendimento
melhor possvel. Aquela integralidade no impede, ao contrrio, estimula a
que seus componentes bsicos, merc de suas diferenas, sejam abordados
segundo metodologias especficas, sem perda da viso do conjunto. Para
garantir essa condio, lanou-se mo de dois diagramas que serviro de
orientao a todo este Caderno.
O primeiro deles, o da figura 19, o que retrata o Sistema Condominial
e o seu processo, de tal forma que ao conhec-lo e compreend-lo se ter
uma viso geral do modelo do ponto de vista do desenvolvimento dos
empreendimentos que o adotem, observados atravs de uma experinciapiloto. Se o compararmos mais tradicional imagem da engenharia uma
69

Metodologia do Sistema Condominial de esgotos

casa como se estivera ela representada pelo seu desenho em perspectiva,


que fornece uma perfeita viso do todo, mas no ensina a constru-la. Isto
ser, ento, o objeto do captulo 07 deste Caderno, o qual procura oferecer a
viso condominial em verdadeira grandeza e em universo restrito, realizado
nos moldes de uma pesquisa-ao e favorecendo o aprendizado em marcha
que envolve as duas partes em jogo: o prestador do servio e a comunidade
usuria - o primeiro, aprendendo a fazer; o segundo, aprendendo a
participar, a decidir e a usar.
Uma tal experincia-piloto no apenas se constitui em ponto de partida
mais do que recomendvel para todos os iniciantes na prtica desse novo
modelo, como tambm sua filosofia deve estar presente em todos os
empreendimentos condominiais que sigam este primeiro, num mesmo
prestador de servio. Quem bem a execute, certamente, no sentir qualquer
dificuldade quando venham a ser grandes as propores do empreendimento,
e esta regra no tem encontrado excees significativas.
O outro diagrama, figura 20, sucede aquele primeiro e o do Sistema
Condominial e seus grandes segmentos, suas partes componentes, e a relao
de dependncia entre elas. Quando se retoma quela imagem da casa, como
se se estivesse agora no seu interior, podendo apreciar e compreender a sua
70

Figura 19
O Sistema Condominial e seu processo

Sistema Condominial

Figura 20
O Sistema condominial e seus
grandes segmentos

composio. Para caracterizar ainda melhor essa composio do modelo,


observe-se sua subdiviso pelas duas cores que formam seu pano de fundo.
Os segmentos contidos no fundo verde fazem parte, em sua maioria, da
engenharia universal, e por isso esto considerados num captulo especfico,
o 8. Eles so usados no modelo condominial, mas no so, em seu todo,
exclusividade deste modelo. O Plano de Ordenamento, por exemplo, um
desenho geral do sistema fsico e que pode assemelhar-se a um Plano Diretor do
tipo convencional. Ele tem, contudo, alguns toques que lhes so emprestados
pela teoria condominial: a sua subdiviso em Unidades de Coleta, que lhe
facilita a viabilidade de implantao frente a qualquer investimento; a tendncia
descentralizao do seu processamento final; e uma grande flexibilidade
no seu processo de implantao - no gradualismo das intervenes e na
potencial associao de investidores e prestadores de servio 6. O Planejamento
do empreendimento definido segundo seus oramentos, programao,
contratao de obras, servios e materiais, etc. J a Rede Bsica foge do
tradicional apenas na otimizao de seu traado e nas suas profundidades,
justamente porque apenas toca em cada quadra seguindo a teoria condominial,
para o recolhimento dos efluentes de seus ramais condominiais.
Os outros segmentos, sobre o fundo cinza, constituem a essncia do sistema
condominial, a sua alma por excelncia, e a sua abordagem o tema do
captulo 9 do Caderno. A esto os Condomnios, as Regras de acesso ao
Sistema, a Mobilizao Social e os Ramais Condominiais. Aquilo, afinal,
que somente os sistemas condominiais contemplam.

Essa tal associao entre investidores e


prestadores de servio, a bem da verdade,
at agora apenas uma idia, posta para a
cidade de Recife, mas ainda no executada
(atentar para maiores informaes a respeito
no Caderno 03).

No captulo 10, finalmente, esto postos os requisitos que devem ser


assegurados aos empreendimentos que sigam a metodologia condominial
e bem assim alguns indicadores que podem ser tomados como suas
referncias mais interessantes. Sempre sendo colocado o alcance do sucesso
do empreendimento como objetivo principal.
71

Metodologia do Sistema Condominial de esgotos

7. A IMPLEMENTAO DO PROCESSO
CONDOMINIAL
(Sua viso por inteiro numa experincia-piloto)
O interesse, neste captulo, o de oferecer uma viso do processo de
implantao de um sistema condominial de esgotamento sanitrio, aqui
chamado empreendimento, na sua forma mais geral, ou seja, observandose o trabalho por inteiro, numa escala reduzida a ponto de permitir a
sua viso integral, de ponta a ponta. Sem nenhuma dvida, a forma mais
adequada para uma tal iniciao por parte de qualquer agente institucional
na realizao de uma experincia-piloto, com a sua aplicao ocorrendo
em verdadeira grandeza e num universo restrito. uma pequena rea,
pelo menos um micro sistema, e que mais que representatividade, mostre
facilidades para o processamento final (se possvel o aproveitamento de
unidades preexistentes) e motivao por parte da populao que ser
atendida (recorde-se aquela mxima repetida no Caderno 1: quem tem e
sente um problema agente natural de sua soluo).
Observe-se, afinal de contas, que o que est em jogo, a enquanto aprendizado
- tem muito mais a ver com a coleta e, nela, a adeso da populao, do que
com a destinao final, que, enquanto construo, uma obra tpica da
engenharia sanitria. Isto constituir o evento propcio para que todos os
agentes envolvidos no processo possam conhecer, avaliar e decidir sobre o
novo modelo: os seus promotores concessionrios, prestadores de servio,
municipalidades ou entidades particulares treinando em servio como se fora
uma pesquisa-ao, e assim aprendendo; os usurios experimentando-o na sua
plenitude, e dessa forma podendo julg-lo; e, alm disso, ainda se utilizar o
seu efeito-demonstrao relativamente aos usurios potenciais que viro com a
expanso do sistema.
A estratgia de mostrar-se o processo numa tal experincia conveniente,
porque alm de ter ela tudo (do processo) que teria um empreendimento
integral, traz tambm consigo, ainda, a viso do aprendizado que est presente
sempre que se faz alguma coisa pela primeira vez. Empreendimentos maiores,
portanto, inteiros que sejam, apenas requerem, alm do aprendizado na
experincia inicial, a gesto proporcional ao tamanho do empreendimento, que
deve ser uma caracterstica do prprio prestador do servio.
Antes de se entrar nos temas especficos aqui previstos, convm afirmar (ou
reafirmar) que um empreendimento como este, o qual com certeza um fato
novo para a cidade e, eventualmente, tambm para o seu promotor, tem
dois pr-requisitos essenciais: o conhecimento (mnimo) sobre o sistema
condominial - que inclusive fator de aceitao de suas idias bsicas - e a
(maior possvel) vontade poltica a favor da novidade.
Depois dessas preliminares se vai, agora, viso do processo de
implementao de um sistema condominial atravs de uma experinciapiloto, para o que se toma como referncia o diagrama da figura 19, mostrado
na Introduo.
72

Sistema Condominial

Veja-se, no mesmo, que o seu ponto de partida uma Oportunidade


para a Ao (criao das condies propcias ao empreendimento),
seguindo-se as Concepes das linhas de ao nos campos da Soluo
fsica (o Plano de Ordenamento, o Projeto), das Diretrizes Polticas
(parcerias institucionais, participao desejada da populao, mobilizao
de recursos e sobretudo o estabelecimento das regras) e da Estratgia de
Implementao (programao de etapas, definio de responsabilidades,
alocao de recursos). Importante observar que na Implantao da Obra a
Experincia-piloto, por excelncia esto no apenas resultados a serem
apreciados, mas a prpria vivncia do novo processo (seu aprendizado e sua
crtica) e, em conseqncia, a sua condio de aperfeio-lo e corrigi-lo, da a
atividade ali indicada Acumulao de experincia e correo do processo. O
contedo dessas etapas do diagrama e algumas indicaes da metodologia de
sua realizao o que se trata a seguir.

Oportunidade para a ao
Esta oportunidade aparece quando o prestador do servio ou a
municipalidade, ou ambos, consciente(s) da necessidade de enfrentar o
problema do esgotamento sanitrio por uma via diferente da tradicional,
decide que o modelo condominial deveria ser experimentado como uma
possvel soluo. A partir da, ento, o principal agente interessado o lder
do empreendimento vai se estabelecendo, fermentando um contexto
para a realizao de uma experincia-piloto, o qual contempla, pelo menos,
os seguintes aspectos:
t WJBCJMJ[BP TFEFTFKWFMFQPTTWFM EFVNBjuno de esforos entre
agentes institucionais, com uma primeira idia sobre os potenciais
papis na gesto, no financiamento e na futura operao - o mais
comum a esse respeito o entendimento entre o prestador do servio
e a municipalidade;
t WFSJDBPEPTrecursos financeiros alocveis a este experimento,
por pequenos que sejam, e o seu respectivo cronograma de
desembolsos;
t criao de uma equipe coordenadora para os trabalhos
naturalmente simptica idia qual se h de agregar uma
orientao tcnica adequada nesses primeiros passos e garantir o
necessrio apoio logstico; quanto mais prxima do prestador do
servio estiver essa equipe desejvel, inclusive, que faa parte do seu
quadro melhor para o futuro do empreendimento;

Isto foi particularmente grave no Rio Grande


do Norte, quando o desenvolvimento dos
sistemas condominiais, mesmo preenchendo
uma fortalecida Gerncia de Pesquisa,
no foi capaz de contagiar a estrutura
da CAERN, sobretudo seus setores
operacionais.

t EFTFOWPMWJNFOUP OBGPSNBQPTTWFM EFVNprocesso de legitimao


do empreendimento na estrutura organizacional do prestador do
servio, ocasio em que dever ser estabelecida a forma atravs da
qual os seus diversos setores operacionais havero de acompanhar a
implementao da experincia-piloto; ateno para o fato do quo
pouco tem sido observada esta recomendao, e dos conseqentes
prejuzos para a regularidade da futura operao 7.
Esta etapa, portanto, alm de compreender a deciso pelo empreendimento,
alcana tambm todas as providncias de carter administrativo e logstico
necessrias consecuo do experimento.
73

Metodologia do Sistema Condominial de esgotos

Formulao da soluo fsica


Aqui esto as atividades que ensejariam a perfeita definio da soluo
fsica do(s) micro sistema(s) que far(o) parte da experincia-piloto 8,
desde a escolha da sua rea segundo aqueles requisitos acima postos, ao
equacionamento do processamento final e delineamento do sistema de
coleta, culminando com a elaborao dos projetos dessas unidades no
nvel necessrio execuo das suas obras. Na escolha dessa rea-piloto
precisa se ter em conta que ela deve ser uma representao do que se poder
e querer levar para a cidade como um todo. Ficam de fora desse rol de
projetos os ramais condominiais que somente sero cuidados por ocasio da
implantao das obras, salvo uma primeira idia sobre o seu oramento.
Com esses elementos mo, possvel a tomada de deciso sobre as formas
de realizao das obras e servios e da aquisio dos materiais, bem como
a sua implementao, de sorte que estejam esses recursos disponveis na
etapa da implantao do empreendimento. As desapropriaes de terrenos
necessrios experincia e a eliminao de outros eventuais empecilhos s
obras tambm so cuidadas nesta etapa.
Importante destacar que esses trabalhos se realizem na perspectiva
de um intenso contato com a realidade local (mais do que seria um
reconhecimento de campo), percorrendo-se casas e quadras na busca das
potencialmente melhores indicaes tcnicas para os ramais condominiais
e para o percurso da rede bsica uma perfeita percepo, portanto, das
caractersticas locais e, em correspondncia, dos requisitos que elas impem
aos projetos e obras.

Formulao das diretrizes polticas


Esse o projeto poltico do empreendimento, o que disciplina e regula
as participaes e responsabilidades das partes envolvidas prestador de
servio, municipalidade e comunidades... Mais ainda que nos aspectos
fsicos, este projeto poltico a ser assumido em forma de um discurso dever situar-se na perspectiva que o(s) decisor(es) haja(m) idealizado para
a cidade e nesse sentido ser generalizado. Uma tal formulao transitar,
inicialmente, numa condio experimental, mas em seguida haver de ser
confirmada e legitimada no prprio processo piloto.
Ele compreender todas as novas relaes entre o sistema institucional e a
comunidade de usurios, mas, no mnimo, as seguintes:
t direitos e deveres do prestador de servio e dos usurios no acesso ao
servio e na escolha dos ramais condominiais e nas suas atribuies
na construo e na operao so as regras bsicas do sistema
condominial;
t o sistema tarifrio, adaptado ao modelo condominial e em sintonia
com as diferenas que ele represente em relao ao passado da cidade
nesse setor do esgotamento sanitrio;
74

Esta soluo fsica ter uma forte


dependncia de um Plano de Ordenamento,
como ser adiante conceituado, crescendo
esta dependncia com as dimenses da
experincia-piloto ou dos empreendimentos
que lhe venham a dar seqncia.

Sistema Condominial

t ajustamento da estrutura organizacional do prestador de servio


s novas condies reguladoras do servio condominial, atravs de
informaes, discusses e esclarecimentos, alm de treinamento
especfico para as equipes que ficaro em contato direto com esse
novo servio; esta atividade, diga-se de passagem, tem sido muito
pouco observada;
t legitimao do discurso e o seu aperfeioamento - na fase inicial
do processo de mobilizao social, junto s lideranas sociais locais
(em maior ou menor mbito, conforme seja a dimenso potencial
mais imediata que se espere do empreendimento final) e em amostra
da rea tomada para a experincia-piloto.

Formulao da estratgia de implementao


Esta etapa bastante importante para o xito da experincia-piloto e
abrange o conjunto dos preparativos e programaes que dem efetividade
s diretrizes emanadas das etapas anteriores, por ocasio da implantao
propriamente dita do empreendimento. Suas atividades principais so as
seguintes:
t a programao das obras, tentando-se fazer por onde a execuo dos
ramais condominiais possa ser seguida de imediato da prpria ligao
ao sistema (desejvel processo construtivo de jusante para montante).
Nesta programao se dever atentar para o fato de que o prazo de
realizao do empreendimento dever ser ditado pela execuo
das obras da rede bsica, estrutura e tratamento, com as atividades
de natureza social sendo inseridas paralelamente (com seus prazos
dependentes do grau de dificuldade enfrentado para as adeses);
t preparao do processo de mobilizao social nos condomnios,
incluindo a elaborao dos instrumentos que possam apoi-lo em
termos de uniformidade do discurso e clareza das informaes (lbum
seriado, maquetes ilustrativas das solues, termo de adeso, cartilha,
etc);
t seleo e treinamento das equipes encarregadas dos trabalhos
de natureza condominial, quais sejam a mobilizao comunitria
centrada nos condomnios e os estudos e ordens de servio para
implantao dos ramais condominiais;
t DBTPFTTFTSBNBJTWFOIBNBTFSFYFDVUBEPTQPSFNQSFTBTDPOTUSVUPSBT
ainda no iniciadas no processo condominial, as suas equipes
precisam ser informadas das caractersticas bsicas da obra e das
relaes que ao seu ensejo se processam com os usurios;
t a contratao das obras, servios, consultoria e materiais.

75

Metodologia do Sistema Condominial de esgotos

Implantao do sistema
Aqui esto as atividades de implantao do empreendimento que foram
planejadas, decididas e projetadas nas etapas anteriores: a execuo das
obras de engenharia (rede bsica, estrutura de transporte e processamento
final), a implementao do processo condominial (a mobilizao social
e a implantao dos ramais condominiais) e a operao experimental do
empreendimento. Todas essas atividades devem ser vistas e realizadas
segundo uma dupla perspectiva: a da produo propriamente dita e
respectiva obteno de resultados, e a do aprendizado por parte da equipe
especfica (e tanto quanto possvel do concessionrio como um todo). As
fases dessa experincia-piloto sero, sucessivamente:
t BFNJTTPEBTPSEFOTEFTFSWJPQBSBBFYFDVPEBrede bsica e
seus acessrios, seguindo-se a sua construo propriamente dita;
t PTQSPKFUPTFYFDVUJWPTFSFTQFDUJWBJNQMBOUBPEBTPCSBT
componentes da estrutura de transporte e do processamento final;
t Bmobilizao social, representada pelas reunies dos condomnios
e conquista dos respectivos termos de adeso (compromisso
escrito e assinado pelos moradores, com a definio da opo de
cada condomnio, mas que no chega a ser um compromisso
expressamente formal);
t PTFTUVEPTEFDBNQP BFMBCPSBPEBTPSEFOTEFTFSWJPFB
implantao dos ramais condominiais;
t Boperao experimental do sistema, correo de eventuais falhas e
a oportuna assistncia aos usurios dentro do que haja sido pactuado
(aqui se inclui, naturalmente, a cobrana usual das contas do servio).
Os condomnios devero ter uma abordagem integrada, envolvendo o
conjunto das atividades voltadas para a sua mobilizao, informao, busca
da adeso e a cabvel educao sanitria, e aquelas afeitas diretamente aos
ramais condominiais, desde os levantamentos cadastrais sua implantao.
Um tal processo, contudo, dever garantir que a sua intensidade e o rol
de informaes trabalhadas sejam os adequados s necessidades efetivas
dos usurios frente ao servio (seu nvel socioeconmico e cultural
principalmente).
Com relao operao experimental, interessa considerar atentamente o
fato de que nesta etapa que se realiza a importante transio no interior
do prestador do servio em face da implementao da novidade que o
sistema condominial. No Brasil, muitos dos seus empreendimentos cometem
a falha de envolver os setores de operao dos prestadores do servio com
os sistemas condominiais somente no momento do incio de sua operao.

Acumulao de experincia e correo do


processo
de se supor que o empreendimento, no caso de ter sido ele uma
experincia-piloto, tenha sido conduzido at este momento segundo
76

Sistema Condominial

a orientao caracterstica do modelo condominial, o que h de ter


representado uma novidade para o seu condutor, o prestador do servio. De
agora por diante, ento, ser importante que este ltimo faa a sua avaliao
de todo o processo vivenciado, critique-o e o adqe sua realidade,
desejavelmente, sem perder de vista a filosofia que preside o novo modelo.
Alm das possveis correes de curso, o momento tambm de
institucionalizao da operao do servio, em moldes que por certo no iro
repetir por completo as tarefas tradicionais do prestador de servio nessa
rea. E por ltimo a preocupao ser com o conjunto da experincia-piloto,
em todo o seu desempenho, objetivando a tomada de deciso sobre a possvel
continuidade.
Comporta, ento, uma meticulosa anlise de todo o processo, buscando-se
o seu aperfeioamento: na sua engenharia projetos, obras, manuteno,
operao; e no seu projeto poltico - os direitos e deveres, as opes, os
preos, as regras bsicas, enfim.
A deciso pela continuidade do empreendimento, a re-ratificao de acertos e
procedimentos da experincia-piloto e a viabilizao de recursos financeiros
em maior escala ensejaro agora a elaborao do programa de expanso do
sistema, j ento se amoldando os procedimentos mais formais cultura do
concessionrio na gesto de suas obras.
Urge, portanto, que se faa uma consistente transio e a correspondente
formulao e implantao dos procedimentos operacionais adequados,
sobretudo a cobrana e a arrecadao das contas do novo servio, conforme
as tarifas ento ajustadas.
De um outro ngulo, ainda, aqui tambm se dever cuidar da observao
mais ampla do comportamento do servio e das reaes do seu pblico
usurio, na perspectiva no apenas de produzir as correes necessrias,
de imediato (na prpria experincia-piloto), mas principalmente para a
formao de acervo que venha a aperfeioar a expanso do empreendimento.

77

Metodologia do Sistema Condominial de esgotos

8. OS COMPONENTES DE ENGENHARIA
DO SISTEMA CONDOMINIAL
Voltando-se ao diagrama da figura 20, ali esto diferenciadas por cores,
como j se disse, as duas naturezas de componentes presentes num sistema
de esgotamento sanitrio condominial: os que esto na engenharia sanitria
clssica e apenas recebem um toque condominial; e aqueles caractersticos,
por excelncia, do mais recente modelo. Os componentes da engenharia so
os que sero agora abordados, a saber: a Programao do Empreendimento,
o Plano de Ordenamento e a Rede Bsica.

8.1 A PROGRAMAO DO EMPREENDIMENTO


Trata-se da mais convencional programao fsica, financeira e, neste caso,
tambm social, do empreendimento e da definio das formas de realizao
de cada uma das atividades de sua execuo.
Nisto, o que interessa distinguir no modelo condominial diz respeito a alguns
cuidados com o cronograma da implantao do empreendimento e com os
requisitos e respectivas formas de execuo das diferentes tarefas previstas
neste cronograma.

Cronograma de implantao
De forma at certo ponto generalizada, h uma impresso de que os trabalhos
sociais, no sistema condominial, so extremamente demorados e custosos, o
que no verdadeiro, em absoluto, a julgar pelas experincias brasileiras nos
mais diversos Estados. Se devidamente programados, esses trabalhos nunca
representaram qualquer atraso para o cronograma de seus empreendimentos,
sempre determinados pelas obras fsicas. Dentre outros foram desenvolvidos
nessa condio, por exemplo, os trabalhos sociais nas cidades do Rio Grande
do Norte e Petrolina (enquanto foram eles adotados), no Distrito Federal, em
Salvador e em Belm e Parauapebas, no Par.
A nica exceo desta condio teve justificativas mais que aceitveis: foi o
caso dos bairros de Rocas e Santos Reis, em Natal, Rio Grande do Norte, onde
alm das extremas dificuldades locais para sistemas de esgotamento sanitrio
(vide texto alusivo no Caderno 3 da Srie Condominial), foi a o primeiro
dos primeiros trabalhos desse gnero, no Brasil, e que se constituiu
num seu verdadeiro laboratrio, sem maiores preocupaes com o prazo,
evidentemente.
Algumas outras condies que podem exigir maiores demandas por trabalhos
dessa natureza situam-se alm das exigncias caractersticas do sistema
condominial. So situaes especiais de natureza scio-cultural, presente em
comunidades muito distantes do que se pode considerar um status urbano, e
onde tambm prevalece uma viso tcnica mais crente na educao sanitria,
78

Sistema Condominial

como so os casos de sistemas condominiais em comunidades de origem


indgena residentes em El Alto, na Bolvia, e em reas perifricas de Lima que
ainda no desfrutavam, antes da interveno condominial, sequer do benefcio
da gua encanada.
Assim, portanto, os cronogramas de execuo de sistemas condominiais
devero ser determinados, exclusivamente, pelos prazos parciais e
racionalmente equacionados de suas obras fsicas, inclusive as dos ramais
condominiais. As atividades relativas mobilizao social, sejam aquelas
do incio do programa e voltadas para a legitimao do processo ao nvel
das lideranas, sejam as que se processam nos condomnios no devero
provocar qualquer acrscimo de prazo alm dos que sejam os requisitos das
obras: as primeiras so realizadas nos prembulos do projeto; e as reunies e
atividades condominiais correlatas, simultaneamente com os levantamentos
e projetos dos ramais condominiais (defasadas da execuo das suas obras de
no mais que 15 a 20 dias).
Ainda um detalhe a ser observado por esses cronogramas o de que os
ramais condominiais tenham sua execuo realizada em sintonia com a
concluso da rede bsica, de tal sorte que o seu funcionamento possa ocorrer
no final da sua implantao. Isto um desejvel requisito, de um modo geral,
e uma exigncia no caso dos ramais internos, como condio de minimizar
os transtornos de obras interiores aos lotes.

Requisitos e alternativas de contratao de obras


e servios
No que tange s especificidades exigidas dos executores, h que considerar
que apenas os ramais condominiais, no rol das obras de engenharia,
requereriam alguns cuidados, j que estando nas proximidades de
construes frgeis como muros e paredes, e muitas vezes no interior dos
lotes, dependero de escavaes manuais e de um tratamento obsequioso
com os beneficirios. Nada, porm, que traga consigo maiores exigncias
quanto a habilidades. Dessa forma, a sua execuo poder estar, como alis
o usual, no mesmo grupo que realizar as obras da rede bsica, por exemplo,
ou at de todas as demais unidades, desde que, evidentemente, se destaque
uma equipe com aquelas habilidades para os ramais condominiais. Em
grandes empreendimentos, com grandes requisitos quanto a equipamentos
e mo-de-obra especializada para as obras pblicas, aumenta naturalmente
a distncia nos requisitos entre os dois tipos de obras, da que poder ser
recomendvel a considerao de lotes distintos, para as grandes e para
as pequenas obras.
Para os trabalhos tcnicos e sociais relativos aos condomnios, interessa
relembrar, de pronto, que eles gravitam em torno do discurso do programa,
e que, portanto, esto no setor de maior intimidade do empreendimento e
do prestador de servio a essncia, portanto e so eles de trs naturezas
diferentes, a exigirem habilitaes tambm diferentes:
79

Metodologia do Sistema Condominial de esgotos

t Pdesenvolvimento da rede bsica, com meticulosas observaes e


medidas topogrficas em campo e clculos e desenhos no escritrio,
um tpico trabalho tcnico de engenharia sanitria, realizvel por
tcnicos habilitados, serventes e segura coordenao por especialista;
t PT estudos voltados para a definio e a ordem de servio dos
ramais condominiais, embora tenham a mesma natureza do anterior
e os mesmos requisitos das equipes, demandam observaes mais
meticulosas, medies mais exigentes e uma razovel habilidade no
trato com os condminos;
t PTtrabalhos especificamente sociais, por seu turno, aqueles de
abordagem dos condminos, so de natureza inteiramente distinta,
exigem uma superviso por tcnico habilitado e uma execuo por
pessoas que, mesmo com menor formao, tenham habilidades
requeridas pelo trato social e pela conduo das reunies e tarefas
correlatas no interior dos condomnios. Alm de estudantes de reas
sociais, so particularmente interessantes para esse trabalho os que
tragam alguma experincia semelhante: lideranas sociais (estudantis,
sindicais, comunitrias), agentes comunitrios de sade, agentes
pastorais, etc.
vista do exposto, ento, as recomendaes quanto execuo desses
trabalhos so: em primeiro lugar, a de que sejam eles assistidos to de perto
quanto possvel (por questes de absoro e desenvolvimento de mtodos)
por uma equipe, mnima que seja, do prestador de servios permanente e
entusiasmada com a tarefa; e, em segundo lugar, a de que, embora possam
provir de uma ou mais empresas selecionadas conforme a convenincia dos
casos especficos -, se distingam, internamente, segundo cada uma daquelas
linhas de trabalho. Esta ltima sugesto tem sido a mais comumente adotada,
com variaes na autonomia conferida aos contratados -, sobretudo se
tiverem uma coordenao prpria, mais distante do prestador do servio
ou se, ao contrrio, so mais terceirizados, a servio do prestador. Uma
hiptese que no deve ser cogitada a de alocao dessas tarefas ao(s)
prprio(s) executor(es) das obras, pelos potenciais conflitos que essa
alternativa poderia apresentar entre o que bom para o sistema e para a
comunidade e o que mais interessante para o contratado.

8.2 O PLANO DE ORDENAMENTO


A implementao do servio de esgotamento sanitrio de uma cidade,
segundo qualquer modelo, pressupe a existncia de um planejamento geral
do sistema fsico, e que varivel em complexidade com o tamanho e com a
prpria complexidade da cidade. Um tal instrumento delineia a concepo do
sistema fsico do esgotamento, incluindo o processamento final dos efluentes,
segundo critrios de viabilizao socioeconmica que so os caractersticos
do prestador do servio. Na metodologia convencional, esse instrumento
usualmente chamado Plano Diretor, o qual traz consigo, quase sempre,
uma certa marca de pronto e acabado, como se os recursos financeiros
80

Sistema Condominial

dos investimentos por ele previstos estivessem, j, disponveis. Como tais


recursos so comumente escalonados, inclusive numa forma imprevisvel,
o tal plano termina dificultando a implantao que deveria acompanhar o
escalonamento dos recursos e muitas vezes produz a imobilizao de uma
soluo 9.
Nos casos de aplicao do modelo condominial ao esgotamento sanitrio
permanece a necessidade do planejamento, inclusive com os critrios
caractersticos do prestador do servio, mas outra a base sobre a qual
se realizam os estudos e outra, tambm, a forma de sua conduo. Os
resultados assim obtidos compem um chamado Plano de Ordenamento
dos Esgotos, e a sua conceituao tem a ver, sobretudo, com o que prope a
teoria do modelo condominial conforme as diretrizes gerais para a concepo
do sistema fsico de esgotos das cidades. Recorda-se, ento, resumidamente, o
que j se props a esse respeito:
t flexibilidade na implantao em etapas, cuidando-se de
garantir a efetividade de solues parciais em correspondncia s
disponibilidades de recursos tambm parciais;
t uma possvel e economicamente interessante - descentralizao
do processamento final dos esgotos, no apenas para facilitar
o prevalecimento do item anterior, mas tambm para reduzir
as estruturas de transporte e evitar as grandes concentraes de
efluentes e os riscos delas decorrentes;
t estmulo ao reaproveitamento dos efluentes, particularmente, no
seu uso como fertilizante agrcola;
t a integrao, possvel, de elementos da estrutura do sistema e do
processamento final a outros elementos da infra-estrutura urbana,
principalmente, os sistemas virio e de drenagem, o paisagismo e o
lazer 10.

No so raros no Brasil os exemplos de


esmerados planos diretores elaborados
conforme essa premissa de disponibilidade
QDQFHLUDHTXHMDPDLVVDtUDPGRSDSHO
ou que geraram estaes depuradoras
grandiosas para as quais no houve
recursos para as redes que as alimentariam
e que, portanto, esto ociosas ou por muito
WHPSRFDUDPQHVVDFRQGLomR

10

Com efeito, a construo de coletores


e interceptores em margens degradadas
de cursos dgua pode integrar-se
despoluio e reurbanizao desses locais;
ou as unidades de tratamento, sobretudo
quando so lagoas de estabilizao, podem
incorporar o paisagismo e o lazer que
contribuem para a urbanizao, etc.

Na elaborao desse plano, uma primeira etapa, sempre, consiste na pesquisa


e coleta de informaes disponveis e de interesse para a realizao do
servio. So particularmente relevantes nesse sentido, quando disponveis,
as plantas urbansticas da regio do projeto, os estudos de ocupao e de
crescimento demogrfico, o plano diretor do desenvolvimento urbano e os
estudos e cadastros dos sistemas existentes de saneamento bsico. Para servir
de base a esses estudos de concepo geral, uma planta em escala 1:10.000,
com curvas de nvel a cada 5 metros (que dificilmente no estar disponvel),
ser suficiente na maioria das vezes. Tambm no difcil, com os atuais
meios de informtica, obter dados topogrficos aproximados de determinada
rea e incorpor-los a uma planta urbanstica sem topografia, que poder
ser utilizada nessa etapa. A exceo fica por conta do estudo de cidades e
reas muito planas, quando podem ser necessrias concepo geral plantas
com intervalo entre curvas de nvel de 1 metro (ou at menos em situaes
extremas e em reas especiais).
Nessa perspectiva, os planos de ordenamento, quer tomem por base
planos diretores prexistentes (que o mais desejvel), quer provenham de
81

Metodologia do Sistema Condominial de esgotos

iniciativas especficas, na sua forma mais elementar (suficiente, por exemplo,


para bem situar na cidade intervenes parciais ou experincias-piloto),
devem contemplar as definies mais estveis do futuro sistema. Eles sero
quase que somente um desenho da soluo, numa base cadastral como
aquela aqui citada e com as seguintes ilustraes provenientes de pesquisa
bibliogrfica, de meticulosa observao da realidade local e da possvel
criatividade:
t delimitao dos micro sistemas da rea, e que passam a ser
considerados daqui por diante Unidades de Coleta aquelas passveis
de constiturem solues parciais, gradativas, do sistema geral;
t localizao das estaes elevatrias, a partir da conceituao de rede
bsica e dos parmetros do concessionrio para a sua profundidade
mxima;
t localizao de reas potencialmente adequadas ao tratamento
de efluentes: as menores, destinadas a unidades estratgicas,
eventualmente temporrias, e aquelas para situar as maiores e mais
definitivas unidades;
t JOEJDBPEPTTJTUFNBTFWFOUVBMNFOUFFYJTUFOUFTEFFTHPUPT
A par dessas definies, o Plano de Ordenamento tambm comportar o
equacionamento do Processamento Final dos Esgotos, abrangendo a sua
modelao, sua estratgia de implantao e o desejvel equacionamento da
reutilizao de efluentes do processo.
medida que o modelo condominial v se enraizando na cidade, tornase necessrio o aprofundamento de seu Plano de Ordenamento, o qual
assumir, num dado momento, o prprio contedo daqueles planos diretores,
mas com uma diferena bsica: ele ser atualizado em cada oportunidade
de investimento, tomando como unidade de planejamento, nesse sentido, as
Unidades de Coleta da cidade.

8.3 A ENGENHARIA DA REDE BSICA


Como visto no Caderno 1, no seu traado, os ramais condominiais
proporcionam a mxima racionalidade da rede coletora do sistema,
denominada Rede Bsica - a minimizao de sua extenso e de
suas profundidades, mas dos pontos de vista da hidrulica (e de seu
dimensionamento), da sua construo e da sua operao, contudo, nada
a distingue, em princpio, dos procedimentos mais usuais dos sistemas
tradicionais, possivelmente, com menos escoramentos, rebaixamentos,
exploses, quebras e reposies. Nesse sentido, ao abordar-se, aqui, a
Engenharia da Rede Bsica dos estudos e projetos, construo e operao
embora no se deixe maiores lacunas, conferir-se- maior ateno, contudo,
aos aspectos que sejam mais caractersticos do modelo condominial. o que se
ver a partir de agora, lanando-se mo de boxes para algumas informaes
que sejam mais triviais (portanto, dispensveis para alguns leitores) para uma
memria sobre as frmulas de referncia para o clculo hidrulico.
82

Sistema Condominial

Para facilitar essa tarefa descritiva, lanou-se mo, mais uma vez, do
diagrama mostrado na figura 21, desta feita contemplando as grandes
etapas que compem a aqui chamada Engenharia da Rede Bsica e a sua
interdependncia. Chama-se a ateno, ainda, para o fato de que as atividades
aqui tratadas pressupem sua alimentao a partir de dois segmentos
contidos neste Caderno, a saber:
t o Plano de Ordenamento, abordado no item anterior, sobretudo
pelo que ele esclarece sobre as Unidades de Coleta, e partindo-se
do pressuposto de que o seu nvel de resoluo compatvel (nas
suas definies e informaes objetivas) com as demandas do
empreendimento estudado, seja um experimento-piloto, seja algo de
maior dimenso;
t o Estudo dos Condomnios, objeto do captulo 9 deste Caderno, pelo
que ele ensina sobre a caracterizao dos seus pontos de reunio de
esgotos nas quadras.
Uma sumria descrio das suas etapas a seguinte:

Pesquisas e estudos de campo


A implementao do Sistema Condominial baseada no conhecimento
profundo da realidade local, o que se consegue com observaes e
levantamentos detalhados de campo da rea do empreendimento, que
acompanham e alimentam todo o processo de elaborao dos projetos.
O registro das observaes de campo realizadas quadra a quadra sobretudo no caminhamento da rede bsica 11 - permite a preparao da
planta de caracterizao geral do empreendimento, que serve de apoio ao
desenvolvimento do projeto. A base para o registro dessas informaes de
campo deve ser uma planta na escala 1:5.000 ou maior, com o arruamento, as
quadras e sua diviso em lotes, tipo semicadastral, se possvel com curvas de
nvel ou referncias topogrficas.
As observaes pertinentes aqui so principalmente aquelas que favorecem as
maiores facilidades construtivas, e, conseqentemente, os menores custos da
rede bsica, tais como a natureza do subsolo, a ocorrncia de lenol fretico
e de interferncias com outros sistemas. Este conhecimento permitir que
os obstculos encontrados sejam evitados ao mximo ou, se isto no for
possvel, sejam contornados da forma mais conveniente; e a pavimentao
de vias e outros obstculos de percurso sejam devidamente orados. Na
figura 21, esses elementos esto mais detidamente especificados.

Lanamento da rede bsica


2EVHUYDUTXHDVDWLYLGDGHVHGDJXUD
21 so praticamente simultneas, com
o delineamento, em planta, do percurso
da rede bsica, se constituindo num dos
importantes focos dos levantamentos de
campo.

11

A rede bsica apenas tangencia cada condomnio, percorrendo os pontos


mais baixos de cada quadra, indicados naquele estudo preliminar dos
condomnios, na busca da melhor condio topogrfica para a sua conexo
com cada ramal condominial. Esses pontos baixos, que so os pontos de
83

Metodologia do Sistema Condominial de esgotos

Figura 21
Engenharia da rede bsica

84

Sistema Condominial

Os levantamentos de campo
SDUDRSURMHWRGD5HGH%iVLFD
compreendem os seguintes
elementos principais:
ORFDOL]DomRGRSRQWRGH
escoamento natural das guas de
cada quadra (ponto baixo) e sentido
de escoamento em cada trecho de
rua, para orientar o lanamento da
rede bsica;
ORFDOL]DomRGHGLYLVRUHVGHiJXDVH
bacias naturais de drenagem
ORFDOL]DomRGHHOHYDo}HVYDOHV
eroses, reas alagveis, corte e
aterros;
OHYDQWDPHQWRVWRSRJUiFRVQD
medida do necessrio;
RFRUUrQFLDVGHOHQoROIUHiWLFR
VXSHUFLDOHGHWHUUHQRVURFKRVRV
iUHDVFUtWLFDVGDFLGDGHSDUDR
funcionamento de sistemas de
disposio local de esgotos e
solues adotadas pela populao;
SRVLomRGDVIRVVDVH[LVWHQWHV
ocorrncias de esgoto a cu aberto
e lanamentos de esgotos sanitrios
no sistema de drenagem pluvial;
RFXSDomRGHFDGDFRQGRPtQLR
padres de ocupao, nmero de
lotes, consumidores especiais;
ODUJXUDGRVSDVVHLRVHFDOoDPHQWR
existente;
SDYLPHQWDomRGDVUXDV RFRUUrQFLD
e tipo) e suas larguras;
RFRUUrQFLDVGHRXWUDVUHGHV
enterradas e possveis interferncias;
DOWHUQDWLYDVORFDFLRQDLVSDUDDUHGH
de esgotos.
Deve se aproveitar as visitas a
campo para levantar tambm outras
informaes de interesse para o
SURMHWRGRVLVWHPDWDLVFRPR
SRQWRVGHODQoDPHQWRGHJDOHULDV
pluviais e canais nos cursos dgua e
contaminao por esgotos sanitrios;
FDSWDo}HVGHiJXD
iUHDVSDUDHVWDo}HVGHWUDWDPHQWR
e elevatrias, e pontos para
GLVSRVLomRQDOGRVHXHQWHV
tratados, se necessrio;
XVRVGDiJXDQRVFRUSRV
UHFHSWRUHVjMXVDQWHGDViUHDVSDUD
tratamento, se necessrio.

reunio dos efluentes de cada quadra devem ser verificados em campo.


Eles so os pontos obrigatrios de passagem da rede e, intuitivamente,
levam definio do seu traado com aquelas trs preocupaes
fundamentais que minimizam custos, alm da garantia da coleta de cada
condomnio: menores profundidades, menor extenso de coletores e
possvel desvio de obstculos.
As suas profundidades mnimas, do ponto de vista hidrulico, sero
determinadas pelos desaguamentos das quadras, no que se deve adotar uma
pequena folga por medida de segurana; e do ponto de vista da estabilidade
os recobrimentos mnimos sero de 0,65 m, quando a rede estiver situada nos
passeios, e de 0,90 m, quando no leito das ruas.
A localizao nos passeios francamente desejvel, caso haja espao
suficiente para as escavaes, inclusive permitindo a supresso dos ramais
condominiais que a estariam, j que os trechos assim situados podero
realizar a sua funo, com considervel economia para o empreendimento.
No intuito de realizar os maiores dribles nos obstculos acima citados,
tm sido adotados alguns recursos nos sistemas condominiais, dentre
outros, os seguintes:
t BVUJMJ[BPEFcoletores embutidos em passeios ou vias para fugir
das escavaes em rocha (nessas situaes os efluentes das casas so
praticamente superficiais, porque elas, as casas, tambm fugiram das
rochas);
t OBUSBWFTTJBEFEFQSFTTFTRVFPCSJHBSJBNPSFCBJYBNFOUPEFOJUJWP
do coletor, isso pode ser evitado pela utilizao de protees do tubo
que permitam a manuteno de sua profundidade ideal;
t PTUBMWFHVFTOBUVSBJTFNUFSSFOPTVSCBOPT MPDBJTQSFGFSFODJBJTQBSB
coletores, no raramente atravessam lotes urbanos, na decorrncia dos
precrios planejamentos. Nesses casos, comum a travessia desses
lotes por coletores da rede bsica, mediante consentimento dos
seus proprietrios em troca de alguma compensao (a exemplo da
canalizao das guas pluviais no mesmo percurso uma das mais
freqentes);
t USBWFTTJBEFSFBTNVJUPQMBOBT, e que levariam a grandes
profundidades, atravs de coletores pressurizados (nesses casos, as
eventuais contribuies em marcha so recolhidas por um coletor
local).
Para os trabalhos de lanamento da rede bsica aqui referidos, e adiante
para o seu prprio projeto, o ideal seria a disponibilidade de uma planta
detalhada da rea na escala 1:2.000 (ou maior) e com curvas de nvel a cada
metro, mas, ainda que no haja uma tal planta, se as declividades das ruas na
rea do empreendimento so perceptveis a olho nu, possvel realizar esse
servio atravs da observao direta das declividades naturais do terreno,
dos divisores de gua e de outros elementos relevantes da topografia local,
rua por rua, quadra por quadra. A vala negra, a gua que escoa na rua,

85

Metodologia do Sistema Condominial de esgotos

as soleiras e alicerces nivelados so bons auxiliares do projetista quando o


caimento natural se apresenta menos evidente.
Dois momentos deste trabalho aqui relatado esto ilustrados nas figuras
22 e 23 mostradas na pgina anterior, que so de uma planta semicadastral
e com curvas de nvel, de uma mesma rea urbana: na primeira esto as
indicaes dos pontos de reunio dos efluentes em cada quadra, pontos
esses que so obrigatrios no percurso da rede bsica; na segunda, j aparece
o lanamento propriamente dito da rede bsica.
Aps o traado dessa rede, os seus dispositivos de inspeo devem ser
assinalados em planta, definindo os trechos de coletor. Nisso se deve levar em
conta, tambm, os pontos previstos para chegada dos ramais condominiais e
outros pontos obrigatrios, tais como as mudanas de direo, de declividade
ou de dimetro do coletor, juno de coletores, etc.

Clculo das demandas e vazes


Na sua essncia, esses estudos no diferem daqueles corriqueiramente
realizados com as mesmas intenes por diferentes projetistas de redes
convencionais, razo pela qual sero vistos, aqui, superficialmente. O modelo
condominial apenas estimula e defende dois procedimentos que nem
sempre so os adotados, quais sejam:
t maior importncia adoo de densidades de saturao em
cada Unidade de Coleta estudada que esteja na iminncia de
sua implantao no que se refere formulao de hipteses nem
sempre crveis sobre a distribuio populacional segundo os espaos
citadinos;
t OBNPOUBHFNEBTQMBOJMIBTEFEJNFOTJPOBNFOUP considerao das
vazes concentradas nos pontos de sada das quadras, j que isto
uma realidade dos sistemas condominiais 12.

Parmetros de consumo e contribuio


Os parmetros de consumo e contribuio empregados no clculo das vazes
so aqueles definidos nas Normas Tcnicas. O consumo per capita de gua deve
ser estabelecido preferencialmente com base nos dados de micromedio da
rea do empreendimento ou, na falta desses, por extrapolao de consumos
conhecidos de bairros de caractersticas semelhantes. As vazes mximas e
mnimas devem ser preferencialmente estimadas com base em hidrogramas de
consumo de gua da rea, que na maioria das vezes, infelizmente, no estaro
disponveis. Nessas situaes, conforme recomendam aquelas Normas, os
parmetros a serem considerados no clculo so aqueles genricos, de uso
consagrado:
- Coeficiente de mxima vazo diria (k1)

86

1,2

- Coeficiente de mxima vazo horria (k2) -

1,5

- Coeficiente de mnima vazo horria (k3)

0,5

- Coeficiente de retorno (C)

0,8

12

Se esta base cadastral montada em


arquivo dinmico, e permanentemente
atualizada, se consegue manter as vazes
tambm sempre atualizadas em cada
FRQGRPtQLR~WHLVSDUDYHULFDo}HVGR
funcionamento da rede e para os sucessivos
SURMHWRVGHDPSOLDomR$PHVPDEDVH
devidamente adaptada, servir tambm
ao sistema de gua, e ainda com mais
propriedade dadas as suas caractersticas.

Sistema Condominial

Figura 22
3RQWRVGHUHXQLmRGHHXHQWHVQDVTXDGUDV

Figura 23
Lanamento da rede bsica

87

Metodologia do Sistema Condominial de esgotos

As vazes na lgica do Sistema Condominial


As vazes totais de projeto no diferem na sua essncia de um sistema
condominial para um convencional equivalente. Fundamentalmente,
dependem da populao e consumo e da infiltrao na rede. A distribuio
dessas vazes ao longo dos coletores, no Sistema Condominial, contudo,
obedece quela lgica j referida, distinta da comumente adotada nos sistemas
convencionais.
Apesar de ser possvel manter as tcnicas e critrios convencionais para
o clculo de vazes, para o dimensionamento do sistema condominial
recomenda-se uma abordagem diferente, conforme descrita a seguir, por ser
mais compatvel com o modelo aqui considerado. Alm disso, facilita o uso
de tcnicas de dimensionamento simplificado muito teis em determinadas
situaes.
O sistema convencional assume que os prdios se ligam diretamente rede
coletora. Com isso, as contribuies de esgoto tendem a distribuir-se de
maneira relativamente uniforme ao longo de toda a rede. O clculo de vazes
baseado na aplicao de taxas lineares de contribuio nos coletores representa
bem a forma caracterstica como as vazes alimentam a rede convencional.
Contudo, no o mtodo que melhor representa a lgica de vazes do Sistema
Condominial.
Neste, os prdios so conectados ao coletor pblico indiretamente, por meio
dos ramais condominiais, que coletam e levam os esgotos da quadra at
a rede bsica, lanando-os em inspees desta. Por isso, a forma como as
contribuies alimentam a rede bsica melhor representada por um modelo
baseado em contribuies pontuais, com o que tambm se facilita o clculo
de vazes com vista ao dimensionamento simplificado. Qualquer que seja o
modelo adotado, contudo, contribuies pontuais ou lineares, os resultados
finais do clculo de vazes tendem a ser bastante aproximados. No poderia
ser diferente, uma vez que as vazes consideradas so as mesmas, variando
apenas o critrio de sua atribuio aos trechos da rede bsica. A figura 24
ilustrativa das duas situaes.

Vazes de dimensionamento
A vazo de dimensionamento a soma das contribuies de esgoto e de
infiltrao acumuladas no trecho, respeitada a vazo mnima. O clculo
expedito de vazes fica facilitado se as contribuies de esgoto so estimadas
com base na contagem de unidades de contribuio e se a parcela de
infiltrao calculada em funo da contribuio de esgoto. Para tanto, as
vazes de esgoto podem ser expressas em equivalentes da contribuio de
uma economia de referncia, e as vazes de infiltrao podem ser estimadas
rateando-se o seu total (obtido da forma tradicional) entre os trechos de
coletor na proporo de suas vazes de esgoto.

Contribuies de esgoto
As contribuies de esgoto so melhor percebidas quando expressas
em equivalentes da vazo produzida por uma economia de consumo
88

Sistema Condominial

Figura 24
Contribuies de esgoto no sistema coletor

de referncia. Nas reas residenciais, essa economia de referncia deve ser


preferencialmente o domiclio, representando a contribuio de uma famlia
tpica da rea em estudo. Ela deve ser definida levando em conta os padres de
consumo de gua caractersticos da rea de projeto e pode ser estimada por meio
da seguinte expresso:
Qr

q u p u C u k1 u k 2
86.400

onde:
Qr = Contribuio de referncia (l/s)
q = Consumo mdio per capita de gua (l/hab.dia)
p = Nmero mdio de habitantes por domiclio
C = Coeficiente de retorno
k1 = Coeficiente de mxima vazo diria
k2 = Coeficiente de mxima vazo horria
As contribuies de edificaes de padro ou uso diverso da referncia
devem ser expressas em equivalentes da contribuio de referncia, como
prope, por exemplo, a tabela 1 apresentada a seguir.

89

Metodologia do Sistema Condominial de esgotos

&RQWULEXLo}HVGHLQOWUDomR
A bem da verdade, no Brasil, no se conhecem medies a esse respeito.
Por outro lado, sabido que na grande maioria dos seus sistemas de
coleta de esgotos as infiltraes de gua de chuva registradas durante as
enxurradas superam extraordinariamente os valores da infiltrao de
guas do subsolo no sistema (que so aquelas recomendadas pela norma
brasileira para o dimensionamento das redes coletoras) e chegam a prejudicar
enormemente as unidades elevatrias e de tratamento.
Na falta de informaes objetivas, portanto, a contribuio de infiltrao
pode ser estimada pelos mtodos tradicionais, com base em taxas por rea
ou metro de coletor. Calculada a partir de taxas de infiltrao da ordem de
0,2 a 0,5 l/s por quilmetro da rede bsica, ela representa freqentemente
entre 5% e 20% da contribuio de esgoto da rea do projeto (as normas
falam em valores entre 0,05 a 1,0 l/seg.km, para tubos de cermica ou
concreto, e 0,01 l/seg.km, para PVC).

Dimensionamento hidrulico
A hidrulica dos coletores do sistema condominial , como no poderia
deixar de ser, a mesma que se aplica aos coletores convencionais de esgoto.
Dessa forma, seu dimensionamento realizado com auxlio das mesmas
frmulas, critrios e parmetros comumente empregados no projeto de redes
convencionais, seguindo na essncia o estabelecido nas normas brasileiras
destinadas ao projeto de coletores de esgotos.
Os coletores devem ser projetados para funcionar como condutos
livres, admitindo-se o regime permanente e uniforme de escoamento. A
tubulao deve trabalhar com seo parcialmente cheia, com a vazo e
a velocidade mdia sendo consideradas constantes ao longo do trecho.

90

Tabela 1
Contribuies de referncia esgoto em
funo de padres tpicos de consumo de
gua

Sistema Condominial

Tabela 2
Vazes notveis e condies de
escoamento para Imin= 0,005 m/m

Clculo dos Coletores


Eles devem ser dimensionados para
DVYD]}HVPi[LPDVGHQDOGHSODQR
conforme a expresso:
Qf = (k1 . k2 . Qfmed ,4cf
onde:
Qf &RQWULEXLomRPi[LPDQDO
de esgotos (l/s)
Qfmed = Contribuio mdia
QDOGHHVJRWRGRPpVWLFR OV
Qcf= Contribuio concentrada
Pi[LPDQDOGHHVJRWR OV
, &RQWULEXLomRGHLQOWUDomR
(l/s)
k1 &RHFLHQWHGHPi[LPD
vazo diria
k2 &RHFLHQWHGHPi[LPD
vazo horria
7DPEpPGHYHPVHUYHULFDGDVDV
condies de escoamento (tenso
trativa) para as vazes mnimas no
incio do funcionamento do sistema:
Qi = (k2 . Qimed ,4ci
onde:
Qi= Contribuio mxima horria
inicial de esgoto (l/s)
Qimed= Contribuio mdia inicial de
esgoto (l/s)
Qci= Contribuio concentrada inicial
de esgoto (l/s)
k2 &RHFLHQWHGHPi[LPDYD]mR
horria
, ,QOWUDomR

Devem ser dimensionados para as vazes mximas de final de plano, quanto


capacidade hidrulica, e para as vazes mnimas de incio de plano,
quanto s condies de autolimpeza da tubulao (tenso trativa). Este
dimensionamento pode ser realizado com o auxlio de tabelas e grficos,
disponveis em qualquer manual de hidrulica, com o emprego de frmulas
aproximadas ou uso de mtodos matemticos iterativos, conforme se v na
caixa em destaque. A popularizao dos recursos da informtica tornou
muito simples e rpido o dimensionamento hidrulico dos coletores.
importante, ainda, a considerao das vazes notveis, ou seja, a capacidade
hidrulica de um coletor de esgoto de determinado dimetro varia com a sua
declividade e ser mnima quando as declividades forem mnimas. As vazes
que correspondem capacidade hidrulica dos coletores em condies
relevantes de escoamento, denominadas vazes notveis, podem ser usadas
como referncia no dimensionamento de coletores. A tabela 2 apresenta
essas vazes notveis para a declividade de 0,5% e tubos de at 200 mm,
juntamente com as condies de escoamento correspondentes.

Critrios de dimensionamento
Os principais critrios e parmetros recomendados para o dimensionamento
hidrulico dos coletores so os seguintes (ainda seguindo a prxis):
Vazo mnima:
Os coletores devem ser projetados para uma capacidade mnima de
escoamento, representada por uma vazo mnima de 1,5 l/s, segundo
as Normas Brasileiras, valor que corresponde, teoricamente, ao que
seria uma onda de vazo decorrente de uma descarga de um vaso
sanitrio tpico.
Dimetro mnimo:
O dimetro mnimo mais frequentemente adotado na Rede Bsica
de 150 mm, como nos sistemas tradicionais, embora em algumas
91

Metodologia do Sistema Condominial de esgotos

circunstncias e sempre atendendo hidrulica o dimetro de


100 mm tambm seja utilizado, em trechos de montante, como por
exemplo, em diversos sistemas de Braslia. Em Salvador, muito ao
contrrio de Braslia, os prprios ramais condominiais utilizaram
dimetros maiores do que 100 mm quando o nmero de casas
atendidas era superior a 20 unidades.
Chama-se a ateno para o fato de que as questes que giram em
torno do dimetro mnimo nos sistemas de esgotos terem a ver, na
sua essncia, com a posio (ou quase certeza, velada...) dos decisores
sobre a presena de guas pluviais nas redes. Defende-se, no caso,
o maior rigor no afastamento dessas guas e, em conseqncia, a
utilizao de dimetros to somente determinados pela hidrulica
para as demandas do servio de esgotos.
7HQVmRWUDWLYDPpGLD 
A tenso trativa representa a capacidade de arraste de slidos de um
coletor em determinadas condies. Para assegurar que elas sejam
adequadas ao escoamento e autolimpeza do coletor, essa tenso mdia
de cada trecho no deve ser inferior a 1,0 pascal, considerando-se na
verificao a vazo mxima horria inicial de projeto:
V= Y . Rh
onde,
V= tenso trativa mdia (Pa)
Y = peso especfico da gua (N/m3)
Rh = raio hidrulico (m)
Lmina molhada mxima (y/D):
Recomenda-se lmina mxima (y/D) de 75% do dimetro do coletor,
seguindo as Normas. Porm, no caso do emprego de tubulaes de
100 mm, a prtica comum tem sido a de se adotar limites menores,
geralmente da ordem de 50 ou 60% do dimetro da tubulao.
Qualquer que seja o critrio, contudo, se busca geralmente uma folga
operacional maior nos coletores de 100 mm.
Declividade mnima (Imin):
A recomendao usual pela adoo de declividades que atendam ao
critrio da tenso trativa mdia (), de modo a assegurar as condies
para a autolimpeza do coletor. Tambm apresenta uma expresso
aproximada para determinao de Imin , considerando n=0,013 13 e
com Qi em (l/s):

Imin = 0,005 x Qi -47


Para a vazo mnima de 1,5 l/s a expresso acima retorna uma
declividade mnima de 0,0045 m/m. No caso de coletores de dimetro
100 mm, comum a adoo na prtica de declividade mnima de 0,005
m/m, por segurana, em que pese a possibilidade de uso de valores um
pouco menores quando necessrio.
92

13

Este valor de n para tubos cermicos;


para PVC ele se reduz para 0,010, e Imin =
0,0035 x Qi0,47.

Sistema Condominial

Elaborao do projeto executivo


A experincia tem evidenciado a impossibilidade de antever-se, a priori,
projetos de obras enterradas como redes coletoras de esgoto. Por mais que
se detalhe um projeto de coletor, as caractersticas e interferncias contidas no
subsolo sero plenamente conhecidas apenas quando da execuo das obras,
quando ento os ajustes finais no projeto so feitos. assim que acontece na
prtica para qualquer sistema de esgoto. O projeto bsico, como conhecido,
se adequadamente elaborado, via de regra ser suficiente, do ponto de vista
de engenharia e de oramento, para a caracterizao, contratao e execuo
do empreendimento. Portanto, o projeto executivo da rede coletora, em
sua forma tradicionalmente conhecida, salvo em excepcionalidades,
perfeitamente dispensvel, sem qualquer prejuzo para a execuo das obras e
com grande economia de tempo e recursos. Ele deve ser realizado na ocasio da
implantao do empreendimento, pari passu com as prprias obras, e detalhado,
j, na forma de Ordem de Servio. Essa a forma mais racional, econmica e
confivel para a otimizao do sistema.
Para que a economia de tempo e recursos que tal procedimento proporciona
sejam viabilizados, fundamental que os organismos financiadores avancem
e aceitem o projeto bsico como instrumento suficiente para a contratao
da execuo do empreendimento. Isso tem acontecido por parte do Banco
Mundial (BIRD) e do Banco Interamericano de Desenvolvimento (BID),
que financiaram grandes projetos com tais caractersticas, como no Distrito
Federal e na Bahia. J a Caixa Econmica Federal, certamente que falta
de uma diretriz geral adequada sobre essa questo, ainda tem mantido as
exigncias de um projeto executivo para a contratao de financiamentos.
Isso, pelo menos em alguns Estados e at mesmo para pequenas cidades,
burocratiza o processo, impe custos e prazos desnecessrios aos
empreendimentos e dificulta o avano dos servios.
Adotada esta racionalizao, a preparao das Ordens de Servio para a
construo da Rede Bsica se d nas duas sucessivas etapas apresentadas a seguir.

Locao
Com a finalidade de se obter economia e simplicidade na construo
e operao do sistema coletor, a locao da Rede Bsica buscar o
caminhamento que possibilite as menores profundidades e o mnimo de
demolies e interferncias, explorando-se ao mximo a sua locao nos
passeios e reas verdes, antes de ser inevitvel o uso do leito das vias.
Com base nos projetos, e definidos os pontos de sada dos ramais
condominiais em cada quadra, ser realizada a locao final dos
dispositivos de inspeo e limpeza na rede bsica. Esses dispositivos, como
j referido, sero localizados nos pontos de mudana de direo ou de
declividade do coletor, nos pontos de encontro entre coletores bsicos e nos
pontos de contribuio dos ramais condominiais em cada quadra.
Visando a operacionalidade do sistema, a distncia mxima entre
inspees dever ser compatvel com as tcnicas e equipamentos
93

Metodologia do Sistema Condominial de esgotos

disponveis para a operao da rede. Havendo obstculos, o traado do


coletor ser desviado pelo deslocamento da posio das inspees que
definem o trecho. Caso no seja possvel, sero includas novas inspees
no percurso, ser alterado o traado ou definida a ultrapassagem do
obstculo com a utilizao de algum dispositivo de proteo, aquele que
melhor se adequar situao. Havendo, por outro lado, um trecho de rede
bsica de at 200mm de dimetro localizado no passeio (desejvel), caso
exista a, tambm, um ramal condominial, ele poder ser suprimido, com
a rede realizando o duplo papel. Neste caso a ligao de esgotos de cada
lote a ser atendido no trecho realizada diretamente na rede bsica, por
intermdio de ts ou dispositivos equivalentes.

Ordens de Servio
Elas so elaboradas aps a concluso dos servios de locao e nivelamento.
De cada ponto de inspeo sero identificados os trechos de montante
(contribuintes) e de jusante (receptores) e suas cotas de chegada e de sada
(esta ltima, obviamente, deve ser inferior). Exceto em casos especiais, o
recobrimento mnimo da rede bsica ser de 0,65m para os coletores locados
no passeio e 0,90m para trechos sob vias pblicas.
A declividade mnima de cada trecho de rede bsica ser funo da vazo,
observados os critrios das Normas Brasileiras. Para dimetros at 150mm,
sugere-se que seja adotada a declividade mnima de 0,005 m/m nas
cabeceiras da rede bsica, onde a vazo inferior a 1,5 l/s.
A Ordem de Servio composta dos seguintes elementos (um exemplo cedido
pela EMBASA, referente cidade de Salvador, est na figura 25, apresentada
adiante):
t JEFOUJDBPEBDJEBEF CBJSSP NJDSPTJTUFNBFDPMFUPS EBUBF
responsvel pela elaborao;
t QMBOUB DSPRVJ
NPTUSBOEPPUSBBEPEPTUSFDIPTEBSFEFCTJDBB
serem executados; localizao e numerao das caixas de inspeo
e trechos; dimetros e sentido de escoamento; localizao dos
ts e dispositivos similares, no caso de trechos de rede bsica
substituindo ramal condominial de passeio; eventuais interferncias;
as amarraes e afastamentos bsicos necessrios para a execuo do
ramal projetado; e identificao de quadras e ruas;
t QMBOJMIBEFOJWFMBNFOUPDPOUFOEPJEFOUJDBPFOVNFSBPEF
inspees; estaqueamento, distncia entre inspees (comprimento
de trechos); cotas de terreno e de coletor; declividades; dimetros;
profundidades e largura das valas; nivelamento dos obstculos a
transpor; gabaritos a serem utilizados;
t SFMBPEPTNBUFSJBJT

94

Para a contratao dos


empreendimentos, geralmente
VmRVXFLHQWHVRFKDPDGR
SURMHWREiVLFRGD5HGHHXPD
estimativa das quantidades e
oramento referentes aos Ramais
Condominiais, uma vez que estes
ltimos, a exemplo do que acontece
com os ramais prediais do sistema
convencional, praticamente no
requerem dimensionamento
(alm de dependerem da Reunio
Condominial, na etapa de
LPSODQWDomRSDUDXPDGHQLomR
QDOGRWUDoDGR $HVWLPDWLYDGRV
ramais, por sua vez, pode ser feita
com grande preciso levando em
conta que suas profundidades
sero prximas das mnimas
(como nos ramais prediais) e sua
extenso mdia por lote em
torno de pouco mais da largura
deste, salvo no caso dos ramais
de fundo de lote compartilhados
pelas duas faces da quadra, que
geralmente sero minoria, onde a
extenso mdia costuma ser pouco
maior que a metade da largura do
lote. A prtica vem demonstrando
TXHWDOFDPLQKRQmRSUHMXGLFDD
FRQDELOLGDGHWpFQLFDGRSURMHWR
nem a preciso dos quantitativos
e oramentos previstos, que no
devem variar em mais de 10% do
estimado quando da execuo
do empreendimento. Alm de
proporcionar maior rapidez (muito
maior) e economia na preparao
GRVSURMHWRVSHODHOLPLQDomR
de etapas e levantamentos no
essenciais ou redundantes.
Portanto, ao invs do procedimento
WUDGLFLRQDO WRSRJUDDSURMHWR
EiVLFRWRSRJUDDSURMHWR
H[HFXWLYRFRQWUDWDomRWRSRJUDD
nota de servio execuo da
REUD RVSURMHWRVFRQGRPLQLDLVWrP
utilizado, com excelente resultado
QDOXPFDPLQKRPDLVREMHWLYRH
UDFLRQDO WRSRJUDDGRLQGLVSHQViYHO
SURMHWREiVLFRFRQWUDWDomR
WRSRJUDDQRWDGHVHUYLoR 
deixando o detalhamento executivo
de Redes e Ramais para a fase de
implantao.

'

AA#)?

A(#'%?

A(#>

A@#$$
AA#?>?

A@#%))

(%#$@

AA#?>?

A@#@>

(#$

A(#A%

(%#>%$

(#>>>

A(#A%

(%#()>

(#??A

($#A'

(%#>%$

($#'@@

()#>@'

(#@%

($#>($

()#?''

(#>>>

()#%'
($#>($

('#$>$
()#?''

()#>>

('#(%$

A@#(?

(%#>?

(%#>?

(%#?>

(#>))

($#'>

()#%%$

()#%%$

()#))>

('#?A

('#@@@

(>#%($

(>#%($

(>#>'

(?#%>

(?>?




Figura 25
Ilustrao representativa de uma ordem de servio de rede bsica

%#%%

'

%#%%

'

>#%%

%#%%

>#%%

%#%%

'

'#%%

'

%#%%

%#%%

'#%%

%#%%

@#%%

%#%%

@#%%

%#%%

('#%?

(>#)?%




%#%%

















 

%#%?(%

%#%?(%

%#%@(

%#%@(

%#%@(

%#%@(

%%@(

%%()$

%#%()$

%#%()$

%#%()$

%%()$

%#%>%

%#%>%

%#%>%

%#%>%




 
 

$#>%%

>%

$#>%%

>%
$#>%%

$#>%%

>%

$#>%%

$#>%%

>%

>%

$#>%%

>%

>%

$#>%%

$#>%%

>%

$#>%%

$#>%%

>%

>%

$#>%%

>%

>%

$>%%
$#>%%

$#>%%

>%
>%

$>%%

>%

>%




#'%

#''?

#''?

#'%)

#$'$

#))%

#''A

#''A

#')'

#'$?

#'%>

')(

#')(

#$(@

#$'@

#$%




%@%

#%>'

%>'

#%@A

#$>(

#A%

#%>)

#%>)

#%??

#%A'

#%@>

#%?$

#%?$

#$

#$>

#$@@









 %$

 %)

 %'

 %'

 %)

 %

 %$



<

#%>

#%>

#%?

#)%




   
=

&91/7

 + 34&.1- 0- ,-5&.-1
 + 5.71/ 0/ 1897/ /- :720- 0/ ;/5/
 + 5.71/ 0/ 1897/ /- 91&30& 0/ 17/
 + 1-:72030/0& 0/ ;/5/







 
 + ,-./ 0- .&11&2 + -./ 0- 1-6&. + -./ 0/ 1897/
 + &,53;30/0& 0- .1&, -





 
  !" #$% &  ! '%%
$ #$% ! !" #(% &  ! '%%
)  * #(% &  ! '%%
'  *" '%%



 
 
 
  




  
   
 
 
 

Sistema Condominial

95

Metodologia do Sistema Condominial de esgotos

Disposies construtivas
As indicaes aqui realizadas decorrem da realidade local, ou seja, so
particularidades da cidade que devem ser levadas em conta para a construo
mais econmica da rede, e para se evitar ao mximo as surpresas durante
a construo. As mais importantes so as que dizem respeito s formas mais
convenientes de lidar com peculiaridades, relativas, por exemplo:
t presena de rochas ou de lenol fretico a pequenas
profundidades, no que seria importante a mxima superfcie da rede
e as melhores formas de escavao em rocha ou de escoramento e
rebaixamento de lenol;
t a elementos dos outros sistemas enterrados da infra-estrutura da
cidade drenagem, distribuio de gua e, eventualmente telefonia,
gs e eletricidade no que devero variar as indicaes construtivas
que minimizem interferncias e agilizem procedimentos para
superao de obstculos junto aos respectivos responsveis por tais
sistemas; as preocupaes decorrem do fato de que o sistema de
esgotos, dentre todos, o que oferece menor flexibilidade de locao;
t BDBSBDUFSTUJDBTEPDPNSDJPMPDBMRVFQPTTBNUSB[FSJNQPSUBOUFT
contribuies construo da rede, por exemplo disponibilidade e
preo de determinado tipo de tubulao, ou indisponibilidade de
equipamentos ou mo-de-obra especializada para determinadas
tarefas que vo estar presentes no sistema;
t verificao da rede prevista em face dos transtornos potenciais
do trnsito local, o que pode recomendar alteraes que at mesmo
a encaream, mas possam representar maior comodidade ao fluxo de
veculos.
Algumas situaes vivenciadas constituem interessantes exemplos a esse
respeito. Em Currais Novos, uma cidade do interior do Rio Grande do
Norte, literalmente construda sobre a rocha, sua rede foi praticamente
superficial, embutida em passeios ou linhas dgua, bastante mais rasa
que as recomendaes gerais aqui feitas (no que se seguiram, apenas, os
procedimentos que j vinham sendo observados pela municipalidade e
pela prpria comunidade). Em Salvador, por outro lado, a falta de um
entendimento mais conseqente com o setor da municipalidade responsvel
pela drenagem das guas pluviais, levou a obra a freqentes paralisaes
e, pior, a solues que quase sempre prejudicaram as profundidades do
sistema de esgotos. Em Petrolina, h 20 anos, a utilizao de tubos cermicos
fabricados na regio foi vista como mais interessante pelo lado do custo e do
fomento produo regional.

Construo da rede bsica


Esta a etapa fundamental do Diagrama utilizado para caracterizar o
processo de implementao da rede bsica, da a sua referncia, aqui, mas
nada se tem a dizer que v alm das recomendaes utilizadas numa rede
convencional de coleta. Quanto aos materiais utilizveis para a rede
propriamente dita, para as suas inspees (caixas de passagem ou poos
de visita) e para as suas estaes elevatrias, eles devem ser uma opo do
96

Sistema Condominial

Outros pormenores
da Rede Bsica
Tubo de queda
Quando o coletor afluente
apresentar diferena de cota
(degrau) superior ao estabelecido
na tabela em relao tubulao
efluente, obrigatrio o uso de
um tubo de queda acoplado ao
poo de visita.
Dimetro Nominal (mm)
100
150
200
250
300

Degrau Minimo (m)


0,58
0,84
1,00
1,25
1,45

Velocidade crtica
Quando a velocidade final, Vf, for
superior velocidade crtica, Vc,
a maior lmina lqida admissvel
deve ser de 50% do dimetro
interno do coletor, com o que se
assegurar a ventilao do trecho:
Vc= 6 (g - Rh)
onde g a acelerao da
gravidade (m/s2) e Rh o raio
hidrulico (m).
Remanso
Sempre que a cota do nvel dgua
na sada do poo de visita ou
til estiver acima de qualquer
das cotas dos nveis de entrada,
deve ser verificada a influncia do
remanso no trecho de montante.

prestador do servio, em funo da sua experincia anterior. Apenas se


propugna que sejam eles devidamente padronizados e modulados de forma
a favorecer as atividades de manuteno e reposio; e que as inspees,
particularmente, utilizem tanto quanto possvel segmentos pr-moldados na
sua composio.
Nos trechos sujeitos a cargas mveis, em que para evitar o aprofundamento do
coletor seja necessrio assent-lo com recobrimentos inferiores aos mnimos,
bom lembrar, as tubulaes devem ser adequadamente protegidas, a fim de
evitar deformaes, esmagamento ou deslocamento dos tubos.

Entrega da obra e cadastramento


Tambm aqui no se tem qualquer recomendao que v alm da tradicional.
Apenas se chama a ateno para a mais absoluta importncia desta etapa,
fundamental ao bom desempenho do sistema, quando se tem observado,
no raras vezes, a pouca importncia conferida, por exemplo, aos testes
de alinhamento e estanqueidade, ou ao cadastramento das tubulaes,
ou ainda ao perfeito acabamento requerido pelas peas de transio
do sistema caixas de inspeo e poos (calhas de fundo e tampas,
principalmente).

Funcionamento da rede bsica


Outra etapa sem diferenas em relao aos sistemas tradicionais. Aqui,
apenas algumas recomendaes que corrijam situaes comuns no
Brasil. Por exemplo, uma maior perfeio no registro das ocorrncias de
manuteno tornando possvel a acumulao de informes que permita
melhores estudos estatsticos, para uma ao mais efetiva de reduo ou
erradicao de acidentes. Uma rede bsica do sistema condominial em
absolutamente nada difere das redes coletoras tradicionais quanto ao seu
funcionamento e manuteno. Nesse sentido, sob este aspecto, o prestador
do servio apenas ter que cuidar de bem dimensionar as tarefas que
adviro e o treinamento das suas respectivas equipes.

97

Metodologia do Sistema Condominial de esgotos

9. OS SEGMENTOS ESPECIFICAMENTE
CONDOMINIAIS
Este captulo dedicado s questes caracteristicamente condominiais, ou seja,
que esto na essncia desse sistema. So as que aparecem na parte cinza do
diagrama da figura 20, na Introduo deste caderno 2: os Condomnios (e sua
caracterizao), as Regras Bsicas (ou a diviso de responsabilidades entre as
partes), a Mobilizao Social (o processo participativo propriamente dito) e os
Ramais Condominiais (e sua engenharia). So, portanto, os componentes do
Modelo Condominial que fogem do campo especfico da engenharia.
A sua implementao pela primeira vez numa cidade, sendo tambm a
primeira vez para o prestador do servio, representa uma mudana no
comportamento institucional deste ltimo e requer a adequao de algumas
de suas prticas, tudo em funo da nova relao que se quer estabelecer
com o pblico usurio. que em relao a esse pblico se estar introduzindo
uma nova forma de realizao do esgotamento sanitrio, diferente das
prticas vivenciadas na cidade a esse respeito (sistemas convencionais,
sistemas unitrios ou outros) e que nessa decorrncia torna necessrio o seu
esclarecimento, a busca das decises pertinentes e o estabelecimento de novos
preos para o servio isso, tanto quanto possvel, na forma de um pacto
social. Aspectos dessa natureza, portanto, muito mais que a engenharia do
modelo condominial, representam, francamente, uma novidade para o sistema
institucional que, com raras excees, consolidou uma cultura fortemente
marcada pelo isolamento de atitudes e de aes.
Objetivamente, a considerao dos aspectos dessa ordem tem a ver,
primeiramente, com a garantia da adeso ao novo sistema dos usurios
presentes na sua rea de abrangncia, e, depois, com a reduo dos
investimentos, que implica na abertura da perspectiva do atendimento
pleno - premissa bsica do modelo. Tudo isto a depender, evidentemente, da
mobilizao dos fatores e idias que esto na teoria do modelo condominial
e que aqui so as mais exigidas. So elas voltadas de forma especfica para
os usurios e os seus condomnios, e so de persuaso na sua natureza e
de ajustamento s condies locais pelo lado fsico: as Idias-Fora da
Participao Comunitria e da Adequao Realidade.
As decises giram em torno dos ramais condominiais, envolvendo sucessivas
escolhas: a da sua posio dentre as alternativas possveis, a da forma de sua
execuo e ainda a das condies de sua manuteno, em todos os casos
considerando-se, ainda, os preos e as formas de pagamento. Assim, pois,
as questes tratadas neste captulo so aquelas que, objetivamente, tocam a
populao usuria do servio. A abordagem especfica de cada um desses
elementos o que vem a seguir, com a ltima delas - Implementao dos
Ramais Condominiais incluindo o seu componente de engenharia, a par
dos aspectos sociais.

98

Figura 26
Construo de redes bsicas em
sistemas condominiais. Mtodo
convencional, cuidados especiais
pela proximidade das casas.

Sistema Condominial

9.1 OS CONDOMNIOS E SUA CARACTERIZAO


Como visto anteriormente, os sistemas condominiais tm incio em cada
um dos condomnios, atravs da coleta realizada pelos seus respectivos
ramais condominiais. Da a importncia de bem conhecer essa unidade e
sua diversidade na cidade objeto do empreendimento, nos vrios aspectos
que interessam ao futuro servio de esgotos: a conquista da adeso de sua
populao, as mais adequadas formas de processar-se a coleta, as condies
de uso do sistema quando se consideram os hbitos da populao, as suas
instalaes sanitrias prediais e o seu nvel de renda e correspondente
disposio para arcar com os inevitveis custos. Deste conhecimento,
portanto, devem fluir as alternativas que sejam as mais interessantes para a
mobilizao da populao quanto aos argumentos que levem sua adeso;
quanto aos tipos de ramais condominiais que permitam sua melhor escolha;
quanto aos direitos e deveres que possam estar includos no novo servio,
inclusive os que envolvam custos (de adaptao de instalaes internas, de
ressarcimento dos ramais e de pagamento das tarifas mensais); e quanto aos
ensinamentos que se mostrem mais necessrios em relao s exigncias para
o uso do futuro servio. a preparao, portanto, do que ir ser levado s
reunies condominiais e haver de seguir, eternamente, na operao do
futuro servio.

Figura 27
'LFXOGDGHVHIDFLOLGDGHVQD
delimitao dos condomnios,
em Braslia e em Salvador

14

Por exemplo, onde um sistema unitrio


efetivamente afaste os esgotos das vistas
do seu condomnio, os argumentos para a
substituio do sistema precisaro ser mais
consistentes do que aqueles a serem usados
nos condomnios que usam fossas e valas
negras.

Uma forma interessante de apreender esses conhecimentos seria aquela


decorrente do esforo de compreenso do atual processo de esgotamento
sanitrio de cada casa e do condomnio como um todo, feito no apenas
com os olhos, mas tambm com os ouvidos. Deve ser salientado, de antemo,
que quanto mais visvel o problema dos esgotos, mais simples os argumentos
que levaro s mudanas no servio, mais fceis as maiores exigncias;
quando, ao contrrio, o problema est escondido, ou seja, quando h uma
soluo embora que parcial, aparente, mais fortes precisam ser os argumentos
com aquela mesma finalidade. No primeiro caso, o problema alm de visvel
est no plano pessoal, est na casa ou na rua; no segundo caso, ele est mais
distante, de uma ordem que se poderia dizer ambiental 14.
Em qualquer condio, o passo inicial a delimitao dos condomnios, o
que no oferece dificuldade nas reas urbanizadas, quando eles coincidem
com as prprias quadras urbanas. Nas reas desarrumadas e favelas, esta
delimitao pode no ser assim to evidente, da porque se oferecem algumas
indicaes nesse sentido, no destaque inserido adiante, da mesma forma que
nos exemplos das figuras 28 e 29.
O segundo aspecto a ser observado nos condomnios diz respeito s suas
instalaes sanitrias prediais, quando ser avaliado o quanto so elas
compatveis com o novo servio que se vai oferecer ou, por outra, o quanto
dependeriam de intervenes de correo ou complementao. As situaes
mais graves a esse respeito so aquelas de ausncia de instalaes mnimas
requeridas para a coleta dos esgotos e as que renem, atualmente, no interior
das casas, as guas pluviais e os esgotos, demandando intervenes mais
custosas para a necessria separao.
Segue-se a apreciao do condomnio do ponto de vista da localizao
mais conveniente para o seu ramal condominial, no que so observados
os espaos disponveis, a topografia e a posio dos atuais desages de
esgotos. Adiante no processo de mobilizao, mais precisamente durante a
99

Metodologia do Sistema Condominial de esgotos

reunio condominial, ser feita a sugesto de localizao mais interessante,


decorrente desta anlise preliminar. Dela tambm decorrer uma importante
informao para a elaborao dos estudos e projetos da rede bsica, qual seja
a de locao (incluindo a profundidade aproximada) do ponto de reunio de
esgotos de cada condomnio, e que ser, tambm, ponto de interseco com
aquela rede.
As oportunidades de observao dos aspectos acima destacados sero
oportunidades, tambm, de apreenso do sentimento da populao com
relao questo dos esgotos: sua conscincia crtica com relao situao
atual e s mudanas propostas, sua disposio para investimentos em
melhorias sanitrias internas e para o pagamento das contas mensais e seus
conhecimentos sobre a questo ambiental na cidade. Tudo isso, tambm,
como reais insumos do processo que se ir vivenciar em cada condomnio.
Em suma, portanto, esta atividade seria, por assim dizer, a apropriao do
sistema existente de esgotamento da cidade, abrangendo as instalaes
sanitrias prediais, as estruturas pblicas de transporte, as condies em
que so realizados os lanamentos de efluentes, os custos da populao
com o servio (ou o dispndio de suas energias) e ainda, numa perspectiva
sociolgica, o que se perceba quanto ao nvel de satisfao dos usurios, sua
conscincia crtica sobre as virtudes e defeitos desse servio e seus anseios e
vontades quanto ao que poderia ser melhor para os seus esgotos.
Adotando uma figurao exagerada, o desejvel seria que esta ao trouxesse,
para a equipe que busca esse conhecimento, a sensao de entender to
bem a problemtica local como se ali vivesse h certo tempo. Portanto, os
100

Figura 28
Condomnios em reas sub
urbanizadas

Onde a quadra tradicional no


existir, o Condomnio ser a
unidade de vizinhana que nas
condies locais mais se aproximar
VLFDPHQWHGRTXHVHULDXPD
TXDGUD$OJRFRPRXPFRQMXQWRGH
casas, barracos e lotes vizinhos
contornados por vias de circulao
pblicas: ruas (se existirem),
ou caminhos, vielas, passagens,
escadarias. Situaes existem,
inclusive, onde essa delimitao
no pode ser feita diretamente
da planta disponvel, ou pela sua
LQVXFLrQFLDRXSHODFRPSOH[LGDGH
da rea. Nesses casos, esse
trabalho realizado com o apoio de
pesquisa direta, em campo. As fotos
GDFLGDGHGH6DOYDGRUJXUD
ilustram essa situao.

Sistema Condominial

Figura 29
Observaes e anotaes so feitas dentro dos condomnios: vendo, indagando, conversando, sentindo...

101

Metodologia do Sistema Condominial de esgotos

resultados concretos esperados dessa absoro seriam principalmente os


seguintes:
t alternativas mais apropriadas de localizao do ramal
condominial, em funo das condies urbansticas dos
condomnios e das instalaes sanitrias dos usurios, inclusive com
a indicao do seu ponto de descarga (a maior racionalidade dos
ramais leva as instalaes para a interligao das casas a menores
custos);
t argumentos consistentes para a mobilizao social no que tange
aos esclarecimentos necessrios, voltados para a conquista da
adeso do usurio sobre o novo servio: efetivao da sua ligao,
aceitao dos custos que isso venha a representar e a importncia do
seu engajamento no processo condominial (nisso, as facilidades e
dificuldades variam com a visibilidade e proximidade do problema
atual e com o nvel de educao e, principalmente, de renda do
usurio);
t indicaes objetivas quanto necessidade de realizao de
campanhas especficas em apoio ao processo do esgotamento, seja
para financiamento de instalaes sanitrias e das interligaes, seja
para aes educativas que possam garantir o bom uso do sistema
(as maiores atenes, aqui, devero estar voltadas para a questo
das guas pluviais e a necessidade de sua segregao em relao aos
esgotos);
t SFDPNFOEBFTRVBOUPconvenincia da considerao de temas
de carter mais especificamente ambiental no curso do processo
condominial de mobilizao.
Na realizao desse estudo se deve ter em mente que ele se faz exclusivamente
por observao direta, em campo - andando, observando e conversando
- inicialmente na experincia-piloto, onde dever ser censitrio, at que
as observaes realizadas permitam que se possa inferir o que se passa
dentro de um condomnio to-somente pela sua viso externa. A prtica do
trabalho evidencia que esta condio perfeitamente real, ao menos no que
reduza bastante a necessidade daquelas observaes no interior. Quando se
estenda adiante o empreendimento, os conhecimentos da experincia-piloto
naturalmente havero de indicar que reas diferentes devero ser visitadas,
desta feita por amostragem.
No se deve perder de vista, tambm, a favor da simplificao dessa atividade,
que o conhecimento que se procura dessa forma genrico, e, portanto,
representativo da rea experimental ou da cidade, conforme o caso. Adiante,
em ambas as situaes, o conhecimento vai chegar a cada condomnio, por
ocasio das reunies e da elaborao do projeto e da prpria implantao dos
ramais condominiais.
Para que se tenha uma idia da cidade como um todo, como se faz necessrio
at mesmo para que a experincia-piloto possa estar comprometida com
a realidade local, esses estudos devem ser feitos, por amostras, em zonas
102

Sistema Condominial

homogneas registradas em estudos existentes nos arquivos municipais. Em


sua falta, uma meticulosa visita de campo poder indicar numa planta uma
delimitao das reas que interessem mais diretamente a esses estudos 15.

9.2 AS REGRAS BSICAS


O seu equacionamento pressupe, alm do conhecimento sobre os
condomnios na forma como foi visto no item anterior, o conjunto das
informaes que precisam ser levadas em conta em todo o empreendimento.
Desde o projeto do sistema fsico de esgotamento sanitrio, ao planejamento
de sua execuo e respectivos cronogramas fsico e financeiro, s idias dos
decisores quanto s formas atravs das quais pretendem comprometer a
populao no processo de dotao do sistema. So, portanto, planos, projetos
e oramentos relativos ao sistema fsico, financiamentos negociados e seus
prazos de liberao dos recursos e respectivos requisitos e delineamentos
polticos que possam balizar as relaes entre o concessionrio e os usurios;
abrangendo a rea da experincia-piloto e as sucessivas reas de interveno
previstas em cada caso.
A definio dessas regras , sem dvida, no apenas o ponto de partida
do processo, mas a sua prpria linha condutora, da mesma forma que
ela decorrer de situaes que reflitam e conciliem as duas realidades em
jogo: a do executor, seus recursos e suas vontades; e a dos usurios, suas
necessidades e disponibilidades.
E as grandes questes que se interpem para essas definies menos ou
mais claramente visualizadas, debatidas e amadurecidas pelo executante
so, sucessivamente, as seguintes:
t Bmotivao da populao face ao novo servio, que proporcional
em carter quase absoluto ao estado atual da resoluo do problema:
lama na rua, alta motivao; sistemas unitrios desapercebidos,
baixa motivao;
t Pestado das instalaes sanitrias domiciliares das reas
mais pobres, aguando-se as necessidades de maior mobilizao
com a ausncia ou precariedade dos requisitos mnimos para a
coleta; eventualmente poder ser importante uma programao
auxiliar em torno dessa questo campanhas especficas de
esclarecimento e alocao de recursos (emprstimos ou doao)
para a aquisio de materiais e peas;
t Pnvel de conhecimento da populao a respeito do servio e da
forma de consumi-lo, eventualmente com as mesmas dependncias
anteriores;

15
Tais reas sero, precisamente, aquelas
TXHIXMDPGHXPDQRUPDOLGDGHXUEDQDHTXH
no tenham tido, ainda, trabalhos realizados
em outras reas da cidade semelhantes nos
aspectos aqui procurados.

t Bdeciso do executante sobre a oferta de opes para a localizao


dos ramais condominiais e para que a ela correspondam opes
de preos de implantao e tarifas; esta questo chave como
determinao do nvel de mobilizao e das respostas obtidas,
principalmente, pelo que envolve de investimentos.
103

Metodologia do Sistema Condominial de esgotos

As regras bsicas devem ser desenhadas em funo da realidade


local, levando-se em conta as condies socioeconmicas dos potenciais
usurios e observando os fundamentos do modelo condominial, de modo
a serem efetivas na construo de solues e acordos realmente viveis. Os
arranjos e combinaes possveis so bastante variados, o que contribui
para a grande capacidade de adaptao do sistema condominial aos mais
diversos ambientes urbanos, socioeconmicos e culturais. Por outro lado,
a transposio mecnica de arranjos concebidos para outros contextos,
a inobservncia de aspectos fundamentais do modelo condominial na
formulao das regras, a falta de clareza, consistncia e, sobretudo, coerncia
na sua arquitetura, so fatores que contribuem para a ocorrncia de arranjos
inadequados, que podem comprometer a eficincia e at mesmo a viabilidade
das solues concebidas. Deve ser ressaltado de antemo que a facilitao
das regras para os usurios tende a ser relaxante para a conscincia
e adeso deles, alm de representar maiores investimentos para o
executante.
Assim, portanto, as regras bsicas devem bem combinar critrios, condies,
procedimentos e alternativas que resultem consistentes entre si e sejam
socialmente justas e adequadas s condies locais, conforme anteriormente
dito, resultando em um instrumento capaz de promover as condies de
acordo entre o prestador do servio e os usurios em torno da viabilizao
das solues de saneamento, cuja abrangncia deve ser extensiva a toda a
cidade, sem qualquer discriminao de classes sociais ou bairros.
Para melhor situar os fatores em jogo no estabelecimento dessas regras bsicas,
lanou-se mo da figura 30, a qual apresenta e inter-relaciona esses fatores: a
posio do ramal condominial, a responsabilidade pela sua construo e
operao e os preos cobrados pela ligao e pelo futuro servio. sobre eles
que se discorre a seguir.
Os ramais condominiais podero estar situados em diferentes posies,
conforme a ilustrao da figura 31, sendo importante realar sobre isto as
duas observaes seguintes:
t PDPSSODJBEFDPOEPNOJPs onde as condies fsico-tcnicas
permitem diferentes opes de localizao, casos em que a escolha
deve ser realizada por eles prprios em conformidade com o que as
regras bsicas hajam estabelecido nesse sentido;
t TJUVBFT QPSPVUSPMBEP POEFno exista mais de uma alternativa
de localizao e, neste caso, apenas caber aos condomnios nesta
condio a aceitao (que dever ser estimulada pelas regras bsicas)
ou, hipoteticamente, a recusa ao servio oferecido 16.
Nas situaes em que os ramais condominiais externos so tecnicamente
viveis, a experincia tem demonstrado a preferncia dos condomnios
por essa alternativa, mesmo que seja preciso pagar um pouco mais por
isso, o que natural e at desejvel. Os ramais condominiais intra-lotes,
contudo, so indispensveis para viabilizar o atendimento em reas onde
o ramal externo no permite o atendimento adequado de todos, o que
104

16

Esta hiptese de recusa ainda no foi


decididamente manifestada; em alguns
casos ocorreu to somente certa demora na
resoluo ou at mesmo uma recusa inicial.

Sistema Condominial

Figura 30
Elementos determinantes das regras e suas
inter-relaes

acontece, por exemplo, quando os terrenos esto abaixo do nvel da rua,


ou onde a configurao urbana local impe um desenho mais livre para
que os coletores alcancem todos os lotes. Isso uma caracterstica das sub
urbanizaes largamente comentadas no Caderno 1, tendo sido freqente e
quase unnime, por exemplo, nas favelas e ocupaes de morros das cidades
de Salvador e do Rio de Janeiro.
Em cada realidade, esses diversos ramais tm seus respectivos custos
diferenciados, e as regras bsicas devem estabelecer para eles preos que
sejam proporcionais a esses custos. Por razes bvias recomendvel que
os ramais condominiais internos tenham preos e tarifas menores para os
usurios do que aqueles localizados em via pblica.
No s porque custam menos (menores profundidades e extenses), mas
tambm porque a permisso de passagem do coletor , sem dvida, uma
grande contribuio do usurio para a viabilizao dos servios na quadra,
o que deve ser estimulado. Por ltimo h que relembrar o primeiro caderno
sobre os ramais condominiais em reas sub urbanizadas: que tanto
quanto mudam suas casas e a prpria urbanizao, esses ramais tambm
esto passveis de mudar em alguma poca (como nos casos j referidos
de Petrolina e de Natal, onde existem alguns ramais condominiais internos,
originais, que se tornaram inadequados em funo de transformaes como
as acima citadas, e por isso comportariam mudanas).

105

Metodologia do Sistema Condominial de esgotos

Figura 31
Posio dos ramais condominiais

Modalidades de implantao do ramal condominial


Embora o usual e sempre que possvel, mais recomendvel seja a
implantao dos ramais condominiais pelo prestador do servio, que faz
as obras diretamente ou por meio de uma construtora no se deve descartar,
contudo, a sua construo pelos condomnios.
No primeiro caso, os usurios pagam as taxas e tarifas correspondentes ao
modelo por eles escolhido e no tero a preocupao com as obras. No final,
conectam suas instalaes prediais caixa de inspeo construda em cada
lote e podem usar o sistema. Essa a modalidade nica de implantao de
sistemas de saneamento adotada pela maioria dos prestadores de servio e,
sem dvida, um padro que deve ser perseguido sempre que possvel.
Muitas vezes, contudo, a escassez de recursos para investimentos severa.
Nesses casos, preciso considerar a possibilidade de parcerias com a
comunidade em torno da implantao do ramal condominial, o que
pode reduzir em cerca de 50% os investimentos institucionais necessrios
para a construo do sistema coletor, mas esta hiptese no exclui de
todo o prestador de servio, j que permanecer ele com todas aquelas
responsabilidades que no so cabveis para os usurios: o projeto, a
assistncia tcnica permanente e at mesmo a execuo de algumas tarefas
especializadas 17.
106

17

No abastecimento dgua de Parauapebas,


no Par, onde os ramais condominiais foram
DVVXPLGRVSHODFRPXQLGDGHRVSURMHWRVH
o assentamento dos ramais, propriamente
dito, permaneceram sob a responsabilidade
GRSUHVWDGRUGRVHUYLoRMXVWDPHQWHSRUOKHV
serem devidos. A aquisio dos materiais,
as escavaes e reaterros, e as quebras e
UHSRVLo}HVGHSDYLPHQWRFDUDPFRPRV
FRQGRPtQLRV DLQGDDVVLPVREVFDOL]DomR
institucional).

Sistema Condominial

Responsabilidade pela manuteno do ramal


Os dois agentes a quem se pode atribuir esta responsabilidade so,
alternativamente: os usurios, reunidos em seu condomnio, ou o prestador
do servio.
A alternativa de manuteno do ramal condominial pelo condomnio,
quando adotada, dever estar restrita aos casos em que os ramais esto
situados no interior dos lotes, embora existam algumas excees (no
recomendadas, todavia). Nos ramais externos, de domnio pblico, portanto,
a manuteno deve ser realizada pelo prestador do servio. importante que
os condomnios que assumirem a manuteno dos seus ramais condominiais
tenham uma compensao nas tarifas, j que esta tarefa representa um custo
efetivo na operao do sistema. Da mesma forma que se esta tarefa no for
por ele cumprida deva existir uma cobrana especfica por cada operao
realizada pelo prestador, contudo, independentemente do arranjo adotado,
dever sempre caber ao prestador dos servios assegurar, em qualquer
circunstncia, a operao adequada do sistema. Uma maior freqncia
desses casos de transferncia de atribuies poder sugerir uma repactuao
do acordo inicial, inclusive com alterao da tarifa inicial ajustada.
Do acima exposto se depreende que as alternativas de manuteno decorrem
da posio do ramal, onde as responsabilidades so bvias: local pblico,
prestador do servio; propriedade privada, usurio. No se pode, contudo,
deixar de reconhecer que a situao mais prtica e tambm a mais cara
para todos a correspondente ao ramal externo com a manuteno pelo
prestador do servio.

Preos e tarifas
A taxa de ligao pode ser excelente instrumento de mobilizao de recursos
em favor da expanso dos servios, o que pode ser fundamental nas situaes
de escassez de recursos. Uma condio tima, do ponto de vista da mobilizao
de recursos financeiros, que a taxa de ligao corresponda ao custo de
implantao do ramal condominial (e que os recursos arrecadados dessa
forma sejam destinados, por meio de um fundo ou mecanismo equivalente,
expanso do sistema com vistas universalizao dos servios locais).
A paridade entre o custo do ramal condominial e o preo da ligao,
contudo, nem sempre vivel. Quando no for, ser possvel adotar arranjos
intermedirios, em que a taxa de ligao cubra, na medida do possvel e
mesmo que parcialmente, os referidos custos de implantao, no que devero
ser levados em conta as diferentes classes de renda da populao. E ocorrero
ainda situaes em que a cobrana de uma taxa de ligao no seja compatvel
com as condies locais e sua aplicao poder afetar negativamente a adeso
aos servios. Nesses casos, h que se recorrer a subsdios e a mecanismos de
retorno, por dentro da tarifa, para viabilizar o servio.
Em qualquer situao, preciso que os arranjos e condies ofertados sejam
atrativos para o usurio potencial (um bom negcio!), para conquistar
107

Metodologia do Sistema Condominial de esgotos

sua adeso ao saneamento da cidade, e que sejam compatveis com a


sustentabilidade dos servios. Independente do arranjo que seja adotado ser
fundamental que as taxas de ligao (assim como as tarifas) estabelecidas
para os sistemas condominiais sejam menores que aquelas praticadas na
cidade para o esgoto convencional, repassando ao usurio a economia
proporcionada pelo novo sistema, o que se traduz em estmulo adeso
da populao; havero de levar em conta, ainda, a responsabilidade pela
manuteno, beneficiando-se aqueles que optarem por esta tarefa.
O desejvel, a esse respeito, seria efetivamente o clculo da tarifa com base
nos custos reais do sistema, o que decididamente deixou de ser uma prtica
no Brasil, da porque to somente se tem aplicado um redutor sobre a tarifa
do sistema convencional para levar em conta o menor custo, real, do sistema
condominial 18.
As polticas de subsdios, por sua vez, devem ser dirigidas viabilizao
dos servios para as populaes de menor renda e, sua concesso, associada
preferencialmente aos padres mais elementares de atendimento.
Na figura 32 esto mostradas as regras bsicas vigentes em trs situaes
distintas Braslia e Salvador, no Brasil, e El Alto, na Bolvia -, que
merecem os seguintes comentrios:
t FN#SBTMJB IPKFDPNVNNJMIPEFVTVSJPTEFUPEPTPTFTUSBUPT
de renda presentes no Distrito Federal, cumpre observar a coerncia
implcita nas regras para a escolha dos ramais, quando cada um deles
cobrado proporcionalmente ao seu custo real, e ainda se oferece a
possibilidade da autoconstruo pelo condomnio. Nada mais justo,
portanto! Com relao s tarifas, por seu turno, conquanto se mostre
justa a diferena de preos entre as duas formas de manuteno (pela
CAESB e pelos usurios), h que se registrar uma certa injustia
na igualdade da tarifa entre o sistema convencional (com maiores
investimentos) e o condominial com ramais externos, uma vez que
o investimento neste ltimo consideravelmente menor que no
primeiro;
t FN4BMWBEPS QPSPVUSPMBEP POEFPTSBNBJTDPOEPNJOJBJTPV
so externos ou so daqueles que no oferecem opes em face
dos bairros, verifica-se a gratuidade deles, onde quer que estejam
situados, o que nivela as diversas classes de renda no benefcio; por
outro lado, as regras atribudas aos que optarem pela manuteno de
seus ramais se mostram bastante ingnuas, induzindo a todos a esta
condio e que, na prtica, no tem correspondido aos compromissos
por parte da populao;
t OPDBTPEF&M"MUP QPSTVBWF[ UFNTFVNBDPOEJPsui generis e
aparentemente sem uma maior perspectiva: a construo realizada
pelos condminos (o que revela um alto grau de mobilizao e de
contribuio expanso do atendimento), em presena, contudo, da
gratuidade do servio, que traz consigo uma certa negao quela
mobilizao e, principalmente, um evidente mau costume (a
gratuidade).
108

18

Com efeito, as tarifas, no Brasil, na sua


base e na sua estrutura, vm desde as
origens de cada empresa. Elas apenas
so atualizadas anualmente, ou noutros
LQWHUYDORVDSDUWLUGHFRHFLHQWHV
multiplicadores e que so negociados em
cada caso. O Pas se ressente, sem dvida,
de algo mais circunstanciado a esse respeito.

Figura 32
Comparao de regras:
Salvador e Braslia, no Brasil; El Alto, na Bolvia

Sistema Condominial

109

Metodologia do Sistema Condominial de esgotos

As atividades no processo de concepo das regras


Veja-se agora uma forma atravs da qual essas Regras Bsicas podero
ser equacionadas de uma maneira satisfatria, conforme as indicaes do
diagrama contido na figura 33, e cujas atividades podem ser descritas da
seguinte forma:

Dados do empreendimento
Aqui estaro arroladas as informaes relativas ao oramento das partes
componentes do sistema fsico proposto, de modo a evidenciar os valores
relativos dos diversos tipos de ramais condominiais e a sua participao
no investimento global; para a experincia-piloto e, por extrapolao, para
a cidade inteira. Tais informaes ensejaro a concepo de regras, com
variaes no valor atribudo aos usurios para a implantao dos ramais
condominiais, constituindo-se na parcela privada do sistema. Em muitos
casos a viabilizao do pleno atendimento da cidade poder depender
desta atribuio de responsabilidades.

Estudo dos condomnios


No item inicial deste captulo, os estudos preliminares relativos
caracterizao dos condomnios foram tratados exausto. Para os objetivos
aqui perseguidos, o que se precisa conhecer a respeito deles diz respeito aos
diversos tipos de ramais condominiais que podero existir na experinciapiloto, mas tambm na cidade, j que esta deve contemplar integralmente
uma perspectiva do sistema integralmente. Aps a devida tipificao, deve
ser feita a estimativa de seus custos de construo, separando-se materiais
e mo-de-obra e oferecendo-se os resultados por metro e por tipo, estudo
este que se constituir na base fsica para o estabelecimento das regras.
Alm disso, ele subsidiar a concepo das regras em relao questo
das instalaes sanitrias prediais e das futuras interconexes ao sistema,
na medida em que, conhecendo e apreciando as dificuldades que da
advenham, poder oferecer idias para a superao dos problemas, mediante
incentivos aos usurios, que venham a ser includos nas regras. Por exemplo,
financiamentos, subsdios ou facilidades, em troca de garantias da ligao e
da opo mais vantajosa para os ramais condominiais.

Delineamento poltico
Aqui o decisor se coloca no que pretende quanto ao papel da populao:
tipologias aceitveis de ramais, sua cobrana ou no dos usurios, subsdios
para os mais pobres, e outros fatores da problemtica local que devam ser
considerados (ou seja, o que se quer da populao e o que se quer para a
cidade...).

110

Sistema Condominial

Figura 33
'LDJUDPDGHGHQLomRGDVUHJUDV

111

Metodologia do Sistema Condominial de esgotos

Formulao de regras alternativas


Considerando a deciso poltica e a configurao dos ramais conforme as
indicaes anteriores, aqui sero formuladas as alternativas que devam
ser levadas ao decisor para a sua escolha final sobre as opes que sero
oferecidas populao.

Seleo e escolha das regras


Agora o patrocinador tem todas as informaes necessrias tomada de
sua deciso: escolha das regras que vo presidir o desenvolvimento do
processo e que devero ser capazes de promover o pacto social sobre o qual
se apia o modelo condominial. Ser bastante conveniente e importante!
que tenha ele segurana sobre esta sua deciso, j que a mesma ser levada
populao e devidamente questionada.
Lembrar: quanto mais fceis as regras para a populao, mais curto
o dinheiro para o empreendimento, menos consistente as decises da
populao, mas aqui comporta, tambm, a no participao, como em
tantos casos.

Legitimao poltica
At agora o processo se passou internamente ao prestador do servio, e,
portanto, no se tem sobre ele uma mnima avaliao sobre a sua aceitao
potencial perante a sociedade. disto, ento, que se cuida nesta atividade.
Nesse sentido, so visveis dois planos de legitimao das regras antes
escolhidas:
t um interno ao decisor, precipuamente poltico seus assessores,
pessoas influentes na cidade e de sua rea de influncia ou a prpria
classe poltica, embora que informalmente;
t outro externo, uma assemblia, por exemplo, que represente um
ou mais bairros (da experincia-piloto) ou da cidade como um todo
(reunio que no discrimine partidos polticos, religies ou times de
futebol, etc, como sinal da universalidade da questo do saneamento).
Ao final do processo, com a sua sensibilidade, o decisor haver de sentir se as
regras antes concebidas devem seguir adiante, tal qual estejam equacionadas
ou, ao contrrio, se deve voltar com o processo para a atividade 5, anterior,
conforme indicado no diagrama. A aceitao das idias postas corresponder
ao alcance de uma primeira e indispensvel aprovao do pacto social
proposto. Estimule-se, ento, aos presentes e participantes deste momento, que
divulguem as novas idias e as discutam nos seus respectivos ambientes.

Teste do processo condominial


Em um, dois ou trs condomnios, tanto quanto possvel diferenciados,
deve ser realizado o teste de aceitao das regras, com a sua apresentao,
112

Sistema Condominial

Figura 34
Tpicas reunies com lideranas, para
OHJLWLPDomRGRSURMHWR
De um lado, em Belm, Par;
de outro, Itabuna, Bahia

discusso e colheita de resultados sendo realizadas na prpria arena, na


prtica, portanto. Tais oportunidades de contato tambm instruiro o
discurso bsico do projeto e agregaro outros fatores locais (percebidos) ao
processo, tais como as eventuais necessidades de aes paralelas de educao
sanitria e de estimulao s instalaes domiciliares mnimas.

9.3 A PARTICIPAO COMUNITRIA


A participao comunitria um dos potenciais motores do modelo
condominial, pois ajuda bastante a concretizar as propostas, idias e
solues que levam ao atendimento pleno da populao. Ela fomentada
principalmente por meio de atividades de mobilizao comunitria,
desenvolvidas com mais intensidade na fase de implantao do sistema, e
pela institucionalizao de instrumentos participativos de gesto dos servios
locais de saneamento.
Neste processo, deve ser observada uma segura coordenao de suas aes
com aquelas da engenharia, conforme o diagrama da figura 35, que ilustra
a concatenao necessria entre as atividades de natureza diferentes e
realizadas por equipes tambm diferentes presentes no processo condominial
a engenharia e a mobilizao social. Essa preocupao tem a ver com a
necessidade de se garantir, com o modelo condominial, prazos de realizao
dos seus empreendimentos que sejam ditados, exclusivamente, pelos
cronogramas de implantao de obras, ou seja, as atividades de carter
comunitrio podem ser perfeitamente realizadas em ateno a esta condio,
afastando-se decididamente a impresso, um tanto ou quanto generalizada
nos meios tcnicos, de que o social esticaria os prazos do empreendimento.
Com efeito, a construo das obras, a mobilizao comunitria e os projetos
do sistema coletor e seus trabalhos de campo so realizados, usualmente, por
equipes diferentes. Entretanto, como a reunio condominial deve preceder
o projeto do ramal condominial correspondente, e como o projeto da rede
bsica depende das cotas e pontos de chegada definidos naquele projeto do
ramal, necessrio que as equipes atuem de modo integrado e complementar.

113

Metodologia do Sistema Condominial de esgotos

preciso que haja uma boa coordenao de atividades para que o processo
de implantao obtenha sucesso e para que as obras sejam executadas em
ritmo adequado, em nada diverso dos prazos de obras convencionais.
O processo de implantao do sistema condominial pode e deve ser
simples e rpido, a depender das condies locais, e sobretudo de como
os arranjos e suas aes so estruturados. Pode-se afirmar que, se bem
estruturadas as regras bsicas, corretamente estabelecidos os procedimentos
e adequadamente gerenciadas as atividades de implantao, na maioria das
situaes a obra corre em um ritmo que nada se diferencia daquele de uma
soluo tradicional. Essas so caractersticas, alis, que tm viabilizado a
aplicao desse novo sistema em larga escala e para atendimento em massa
em lugares como Salvador, Braslia, Parauapebas e Belm.
Feitas essas ressalvas, passe-se, agora, ao processo propriamente dito de
participao condominial, destacando-lhe a preciso dos seus objetivos,
os meios utilizados e os seus requisitos, finalizando-se com a indicao
de uma ordenao e sua metodologia - para o desenvolvimento das
atividades do processo.

114

Figura 35
A concatenao
engenharia e mobilizao

Sistema Condominial

Objetivo
O processo de participao comunitria que faz parte do sistema
condominial tem um forte compromisso com a objetividade, de modo a
no cair no caminho da participao pela participao, que apresenta
poucos resultados objetivos. Ao contrrio, ele tem objetivos que precisam
ser bastante explcitos e quanto mais restritos, melhor! e no tm a
pretenso de promover o desenvolvimento social ou a educao ambiental
da populao; ou outros que tais... O que a esse respeito venha a ocorrer,
timo, que se faa um bom proveito; que algo dessa natureza semeado com
o processo condominial, no se tenha dvida, porm que outras iniciativas
que no o saneamento a aproveitem, pois, afinal, se trata de algo da maior
importncia para a sociedade e em termos mais largos, muito mais amplos
que o saneamento.
Um outro aspecto importante a considerar sobre esta matria a de que uma
metade da populao urbana brasileira aquela das reas sub urbanizadas
nas formas e condies mais variadas depende, efetivamente, de um
processo de mobilizao social para o seu saneamento (indiscutvel e
inclusive j aceito pela quase unanimidade do setor). Porm, a prtica de um
tal processo tem uma certa incompatibilidade com a feio das empresas
brasileiras de saneamento na sua cultura, principalmente, mas tambm na
sua organizao e nos seus prprios objetivos. Tanto isso verdade que so
raros os casos de empresas que incluram em seus quadros equipes com essa
finalidade, sendo a opo mais freqente, nesse sentido, o apelo chamada
terceirizao.
Ainda a destacar nesse mesmo rol, nesse prembulo da discusso sobre
a mobilizao social presente no modelo condominial, o fato de que a
simplicidade desse processo tal que acessvel a todas as pessoas
que tenham gosto por esse trabalho, um razovel conhecimento do
saneamento local e da soluo que est sendo proposta e, naturalmente,
certa habilidade. Com efeito, o que se tem a dizer e explicar nesse processo
algo que deva ser acessvel a qualquer usurio, da porque os mobilizadores
pessoas simples e, s vezes, das prprias comunidades tm esta condio,
mesmo que se trate de questes sobre os dimetros ou a localizao adequada
dos ramais 19. Isso no exclui, todavia, a importncia de que um especialista
na matria deva estar presente na coordenao dos trabalhos, bem como de
que trabalhos especiais situados alm do mbito condominial tenham um
tratamento tcnico mais sofisticado, certamente realizado por especialistas.

19

O treinamento com os mobilizadores


devem prepar-los para conhecer os ramais
condominiais como se fossem ser seus
usurios.

Indo agora questo do objetivo propriamente dito, determinante da


participao comunitria, pode ser dito que ele se resume, na prtica,
garantia da perspectiva de universalizao do atendimento pelo servio
condominial de esgotamento sanitrio, na rea do empreendimento. Para
que fique mais explcito precisa ser abordado de uma maneira convincente,
em cada uma das suas faces:

115

Metodologia do Sistema Condominial de esgotos

t Bconquista da adeso, que simbolizada na assinatura de um


chamado Termo de Adeso, pelo condomnio, conforme se ver
mais adiante, e que traz consigo a opo por uma das alternativas
das Regras Bsicas no que diz respeito aos ramais condominiais: sua
localizao e as responsabilidades pela construo e manuteno e
respectiva tarifa;
t Befetivao da ligao, que representa a adeso fsica, real, do
usurio, tambm numa forma que ter sido contemplada pela Regras
Bsicas quanto responsabilidade pela sua execuo e custos;
t Badequao das instalaes sanitrias domiciliares aos requisitos
do servio, aspecto que poder demandar uma campanha especfica,
certamente marginal ao processo condominial, embora se volte para
o seu usufruto 20;
t Beducao para o uso do servio, que pode estar includa no
processo condominial, e seus instrumentos de informao neste
caso sendo restrita a pontos especficos como a defesa das instalaes
sanitrias em face dos resduos slidos e das guas pluviais ou,
como no caso anterior, poder determinar uma ao especfica de
maior intensidade 21.

Meios
Para o alcance desses objetivos, a mobilizao social se realiza ao nvel de
cada condomnio um processo condominial, portanto o qual tem dois
momentos fundamentais: a Reunio Condominial e a obteno do Termo
de Adeso do Condomnio. Esse processo dito condominial movido por
um Discurso que contempla as Regras Bsicas, vistas no item anterior; a
viso que tem o provedor do servio sobre o empreendimento e sobre a
realidade onde ele ser realizado; e ainda, as razes que levaram adoo
do modelo condominial na cidade. Este ltimo aspecto requer um cuidado
especial quando se tratar de uma transio, na histria do saneamento da
cidade, do modelo convencional para o condominial.

O discurso
Do discurso do projeto se h de exigir, em termos absolutos, uma
coerncia interna, tal que reflita perfeitamente as regras bsicas e a sua
universalizao a nvel de toda a cidade e seus diversos segmentos, sem
prejuzo de que a sua forma verbal, escrita ou miditica varie conforme o
veculo e o pblico-alvo. Ele deve ser entendido como sendo o Projeto Poltico
do Sistema, em aluso ao Projeto de Engenharia do mesmo sistema e que se
expressa atravs de clculos, desenhos e especificaes. De ambos se exige,
pois, os mesmos nveis de preciso!
Ele ser uma proposta da instituio patrocinadora do empreendimento,
inicialmente, e ser legitimado nos trs seguintes patamares, sucessivos,
para que tenha ampliada a sua hiptese de sucesso 22:
116

20

No Brasil, no se tem at agora um registro


GHFDPSDQKDVHVSHFtFDVQHVVHVHQWLGRDR
contrrio do que se pratica em Lima e em El
Alto, na Bolvia, pelas razes expostas na
nota seguinte.

21

Nos assentamentos suburbanos de Lima,


no Peru os chamados Pueblos Jvenes
os sistemas condominiais de gua e
de esgotos esto sendo disponibilizados
simultaneamente. Da que os usurios,
at ento abastecidos por chafarizes ou
similares, no estavam preparados ou
aculturados para a gua encanada, razo
da intensa e meritria campanha para a
implantao das instalaes sanitrias
mnimas, que nas regras ali aplicadas
constituam o nico nus da populao. No
Brasil, essas campanhas, quando existentes,
tm correspondido a diferentes formas de
LQFHQWLYRVQDQFHLURVSDUDDDTXLVLomRH
montagem dos equipamentos.

22

Nesses patamares assim distintos em


sua composio e diferenciada audincia
DOpPGRVDMXVWHVGHFRQWH~GRTXHVmR
VHXVSULQFLSDLVREMHWLYRVWDPEpPVHUmR
HOHVXWLOL]DGRVSDUDRVDMXVWHVGHIRUPDHGH
linguagem.

Sistema Condominial

t em primeiro lugar, no nvel dos parceiros do patrocinador, nas


esferas do governo e da classe poltica que lhe d sustentao;
desejvel, aqui, a consonncia de idias, mesmo que isto represente
alteraes possveis na proposta inicial;
t em seguida, a sua exposio e discusso se faro num mbito
pblico, reunindo lideranas importantes da comunidade, sem
discriminaes de qualquer espcie (no h registro, que se saiba,
de qualquer problema minimamente significativo nesses processos,
conquanto no sejam eles dos mais usuais); o cumprimento dessa
etapa traz um apoio substancial ao processo;
t e, por ltimo, em alguns condomnios tomados como amostra,
onde as discusses vo se passar em verdadeira grandeza, na base da
sociedade; quase certamente ajustes advm desse mbito, no apenas
no contedo, mas, sobretudo, na forma.
Alguns instrumentos de divulgao e propaganda devem ser aprontados ao
longo do processo condominial, sempre que algum evento ou circunstncia
de momento o exija. Alguns desses podem ser destacados de antemo pelo
seu papel no processo, como os trs primeiros a seguir relacionados e que
se fazem necessrios para o uso diuturno - e os dois ltimos que so bastante
recomendveis:
t P Termo de Adeso, que expressa o compromisso do condomnio na
aceitao do sistema em determinada modalidade de sua escolha e
que, nesse caso, inteiramente calcado nas regras bsicas;
t VNlbum Seriado, neste caso elaborado para servir de roteiro
conduo das reunies condominiais (em destaque, adiante, uma
sntese do lbum seriado utilizado em Parauapebas, na mobilizao
para o seu abastecimento dgua);
t VNtexto institucional que servir de base ao noticirio do projeto ao
longo de sua implementao;
t EFTFKBWFMNFOUF VNvdeo com animao no melhor estilo e
que possa ilustrar as reunies condominiais e outros eventos do
programa;
t VNBFTQDJFEFcartilha, capaz de traduzir as regras bsicas para a
populao e que dever ser utilizada em apoio s decises em torno
da Adeso do Condomnio (seria um instrumento para lembrar a
reunio do condomnio aps a sua realizao).

A reunio condominial
Ela realizada no mbito de cada quadra, com a finalidade de promover
a organizao do condomnio, informando-se aos moradores sobre sua
participao na deciso quanto soluo para o seu problema de esgotos da
quadra. Essa reunio o mais sistemtico instrumento de participao
comunitria do modelo condominial, em torno da qual se desenvolve todo
o processo de implantao do sistema. A sua pauta contempla a apresentao
e discusso daquele discurso bsico adaptado a este mbito (regras de
117

Metodologia do Sistema Condominial de esgotos

adeso, as formas e padres de atendimento, custos, direitos e deveres


relacionados com a implantao e operao dos ramais condominiais), a
escolha de um sndico ou representante do condomnio e a distribuio
do termo de adeso (para circulao no condomnio e coleta de sua opo).
Alm desses, outros itens importantes na preparao e conduo dessas
reunies so, principalmente, os seguintes:
t adequado treinamento das equipes responsveis pelas reunies, a
partir de triagem que leve em conta a aptido para trabalhos do gnero;
t Bboa convocao da reunio, desde o dia anterior e com uma
mobilizao momentos antes de sua realizao, distribuindo-se, na
ocasio, um convite-panfleto ilustrativo e atraente;
t elaborao de uma ata de presena e da sntese da reunio;
t VUJMJ[BPEFVNqurum mnimo para a sua realizao,
recomendando-se que seja ele, por exemplo, de metade dos moradores;
t debates sobre o direito de maioria e explicao de sua utilizao
para as decises do condomnio; e sobre questes mais prementes da
realidade local;
t RVFTUFTEBQSPCMFNUJDBMPDBMSFMBUJWBTBPuso do sistema e
preservao ambiental; sobre eventuais questes circunstanciais do
interesse da populao;
t utilizao, tanto quanto possvel, de peas ilustrativas do processo e
do sistema fsico e que possam facilitar a compreenso da populao:
maquetes, modelos reduzidos, cartilhas informativas, plantas
ilustrativas do sistema, vdeo; em particular, apresentao do croqui do
condomnio com as indicaes obtidas em campo sobre a posio do
ramal condominial;
tanimao das reunies, como realizado em certos casos, com a idia
de eleio de um nome para o condomnio e que passa a figurar no
cadastro do sistema.

118

Figura 36
Reunies de condomnio em que
se destacam a freqncia e a
ateno dos condminos, moradores de
favelas do Rio de Janeiro

Sistema Condominial

Figura 37
Maquete de sistema condominial utilizada
em reunies condominiais no interior de
Pernambuco

O sndico e o termo de adeso


O sndico o vizinho escolhido na reunio para, desejavelmente, cuidar dos
interesses do condomnio, represent-lo perante o Servio de Saneamento,
apoiar e fiscalizar a correta implantao do sistema de esgotos na quadra e
ajudar, no possvel, a normalidade da operao do ramal condominial. Ele
no pode ser visto como um empregado do Servio de Saneamento ou do seu
Condomnio, sequer como um sndico oficial, mas sim como um cidado
que se dispe a colaborar com a sua comunidade, devendo, portanto, ter
sua atuao incentivada, valorizada e respeitada; trata-se de uma atividade
essencialmente amadora, na acepo desse termo. Se ele no existe, ou
pouco ou nada faz, o Servio deve fazer por onde isto no se constitua
problema; ou seja, nada deve ser imputado, a qualquer ttulo, a este
sndico. Nesse contexto, foram relacionadas, na caixa em destaque adiante
inserida, atividades que poderiam ser aes do sndico no interesse da
coletividade.
Com a colaborao dos sndicos, interessados diretos na questo, os
eventuais problemas relacionados s obras poderiam ter uma soluo mais
rpida, evitando-se, assim, a burocracia. Aps a fase de implantao, seria
muito importante a realizao de reunies peridicas com os sndicos para
orient-los no desempenho de suas atribuies, discutir demandas, avaliar
o funcionamento do sistema condominial e tratar de questes de interesse
dos moradores. Alm de manter-se um programa permanente de difuso
de informaes aos sndicos com atividades de capacitao tcnica para
o desempenho de suas funes e canais escolha do ramal condominial
e as suas responsabilidades sobre a construo e a operao do mesmo,
alm das tarifas para remunerao mensal pelo servio. Ele tem a forma
de um abaixo-assinado e informal na sua essncia; conquanto no se
tenha qualquer pesquisa a respeito, tem sido muito poucos os registros de
problemas decorrentes desta informalidade.
119

Metodologia do Sistema Condominial de esgotos

Idia de pauta para uma reunio condominial


As reunies condominiais seguem geralmente um roteiro bsico com os seguintes elementos principais:
- apresentao dos participantes;
- HVFODUHFLPHQWRVVREUHDQDOLGDGH da reunio e dos assuntos a serem tratados;
- discusso sobre a situao do saneamento na localidade (problemas, conseqncias e alternativas de soluo) e
panorama do saneamento no Brasil;
- apresentao do programa de saneamento que est sendo implantado na localidade;
- apresentao e discusso dos fundamentos do Sistema Condominial;
- apresentao das Regras Bsicas e condies gerais de adeso ao sistema modalidades de servio, alternativas
de ramal, tarifas, custos, formas de pagamento, diviso de responsabilidades, etc;
- informe de noes de educao sanitria e ambiental e orientao quanto ao uso adequado do sistema de esgotos e
de sua manuteno;
- apresentao das alternativas de adeso ao sistema de esgotos e das opes de atendimento disponveis para a
quadra com os moradores;
- eleio preliminar da modalidade de atendimento e do tipo de Ramal Condominial de preferncia do Condomnio,
FXMDVRSo}HVXVXDLVVmRDVVHJXLQWHV
Em reas de ocupao ordenada:
- Ramal de Fundo de Lote, passando nas reas livres disponveis na parte de trs dos terrenos,
geralmente associado aos padres mais bsicos de servios e de tarifas;
- Ramal de Jardim, passando por entre os muros na parte da frente dos lotes;
- Ramal de Passeio, localizado na calada.
Em reas de morro, em locais de difcil acesso e com ocupao desordenada:
- Ramal Condominial possvel, passando nas reas livres deixadas pela ocupao desordenada,
VHJXLQGRRFDPLQKRQDWXUDOGDWRSRJUDDHVHDSUR[LPDQGRGRFDPLQKDPHQWRGHVLVWHPDVUXGLPHQWDUHVH[LVWHQWHVQR
local, contudo, com a adoo de um padro construtivo adequado e buscando a separao das guas pluviais.
- orientao quanto ao processo de adeso formal do Condomnio ao sistema e para formalizao da opo de
DWHQGLPHQWRGHVHMDGD
- constituio do Condomnio e eleio do seu representante (sndico), ao qual deve ser atribuda, entre outras
competncias, a coordenao do processo de escolha da opo de atendimento no mbito da quadra, o acompanhamento
dos trabalhos de implantao do sistema e a representao dos moradores perante a instituio prestadora do servio de
saneamento.

Requisitos
Os requisitos exigidos no processo condominial de participao comunitria
so aqueles caractersticos dos processos participativos em qualquer
setor de atividade, com o seu promotor que quem tem a iniciativa de
propor alguma coisa devendo antes de mais nada inspirar credibilidade e
segurana no cumprimento daquilo que est posto. Nesse sentido, os pontos
fundamentais a serem vivenciados no processo so os seguintes:
t coerncia do discurso e justia no estabelecimento das regras, ou
seja, dever estar implcito em ambos que a proposta em discusso
para um bom negcio para as partes; provedor e usurios, cada qual
fazendo a sua parte em benefcio da coletividade;
t sua generalizao no tempo e no espao, o que quer dizer que a
postura e o discurso do provedor devem ser uniformes a qualquer

120

Sistema Condominial

$WLYLGDGHVTXHGHVHMDYHOPHQWH
poderia ser atribuies dos sndicos
(em seu condomnio):
5HSUHVHQWDURJUXSRGHPRUDGRUHV
do seu condomnio, inclusive
para tratar de questes relativas
aos servios e ao funcionamento
do sistema com o servio de
saneamento;
'LVFXWLUFRPVHXVYL]LQKRV
de condomnio os problemas
relativos coleta de esgoto
sanitrio e encaminhar sua
soluo, acionando o servio de
saneamento quando for o caso;
3URPRYHUTXDQGRQHFHVViULR
reunies com os condminos para
tratar de questes relativas ao
sistema de esgotos e seu uso no
mbito da quadra;
$FRPSDQKDUVHPSUHTXHSRVVtYHO
as obras de abastecimento de
gua e de esgotamento sanitrio
em sua quadra;
3DUWLFLSDUGDVDWLYLGDGHVGH
educao sanitria e ambiental
promovidas pelo servio de
saneamento e atuar com o agente
multiplicador dessas atividades em
seu condomnio;
5HDOL]DUFROHWDGHDVVLQDWXUDVGRV
vizinhos de quadra no termo de
adeso, com apoio do servio de
saneamento;
3DUWLFLSDUGRUHFHELPHQWRGRUDPDO
de seu condomnio;
3DUWLFLSDUGHUHXQL}HVGH
sndicos para tratar de assuntos
de interesse com um dos
condomnios.

poca e em todos os locais do universo do empreendimento;


ausncia de qualquer forma de discriminao ou distino de
classes, bairros ou grupos;
t conhecimento da realidade, por parte de quem vai vivenciar
o processo participativo, de forma a tornar possvel o dilogo
em qualquer circunstncia, desde que tendo em conta o
empreendimento; interessante que no pairem dvidas sobre as
discusses, que no terminem as reunies enquanto haja indagaes,
que o conhecimento da proposta seja visto como mais importante
que a sua prpria aceitao;
t habilidade dos condutores, no sentido de tornar as reunies e os
contatos entre as partes momentos interessantes e agradveis a par
da seriedade com que devam ser abordados e esclarecidos os vrios
temas.

Ordenao e descrio das atividades


O diagrama da figura 38 procura juntar e ordenar as atividades presentes no
desenvolvimento do modelo participativo condominial e, nesse sentido, orienta
a organizao para sua execuo. As atividades nele presentes, de que muito j
se falou, merecem as consideraes feitas a seguir.
As atividades 1, 2 e 3 so exatamente as mesmas presentes no diagrama
de Definio das Regras, as duas primeiras sendo seus insumos e a ltima
sendo as prprias regras, que aqui constituiro os principais elementos
para a formao do Discurso do Empreendimento. Com elas se tm as
condies de formular as Alternativas de Discurso (atividade 4), e que
sero variveis principalmente no que atribuam de responsabilidades ao
provedor e aos condomnios. Dentre elas o decisor, que juntamente com
seus eventuais parceiros na promoo do empreendimento construir o
discurso poltico a ser levado sociedade.
Seguem-se duas atividades especificamente preparatrias do desenvolvimento
dos trabalhos, respectivamente:
t B elaborao da programao do empreendimento, compreendendo
todas as informaes caractersticas do provedor na sua organizao,
bem como a Preparao dos Instrumentos que venham a ser
utilizados no processo relativos sua divulgao, e que dependiam
da definio daquele discurso; aqui se incluem a minuta do Termo
de Adeso e todas as peas previstas para animao das reunies e
divulgao mais larga do projeto;
t FBseleo das equipes que sero responsveis pelo processo de
mobilizao social em correspondncia aos cronogramas da
programao geral e seu respectivo treinamento (a etapa final
desse treinamento se far necessariamente em servio, durante a
fase inicial do processo).
121

Metodologia do Sistema Condominial de esgotos

Figura 38
Processo de participao

122

Sistema Condominial

Sntese do lbum seriado utilizado para o processo condominial de Parauapebas


Tpico 1 - As reunies

(...) vai chegar o sistema condominial e a reunio para explicar como cada um vai poder ter gua nas suas casas...; neste
sistema as coisas so decididas em reunies onde tudo muito explicado e a reunio s termina quando todas as pessoas
QmRWLYHUHPPDLVG~YLGDVQyVVRPRVGDHPSUHVDTXHHVWiFRQWUDWDGDSHODSUHIHLWXUDSDUDID]HUDVUHXQL}HVHDMXGDUD
fazer o sistema (...); nosso endereo (...); nosso telefone (...); meu nome (...); qualquer informao ou dvida podem
nos procurar.

Tpico 2 - O Sistema Condominial: por que e o que ?

Condominial o nome do sistema que vai ser usado para trazer a gua; ele foi escolhido pela prefeitura porque o mais
econmico, funciona melhor e mais democrtico; com ele ser possvel o atendimento de todo mundo; vamos explicar
tudo!
O sistema usual chamado convencional e mais ou menos assim: tem um cano mestre em cada rua (...): cada casa vai
buscar gua neste cano da rua, por meio de uma ligao (...): mais caro para o morador (...); se o custo assim maior, a
conta mensal tambm mais cara (...); com este sistema s ia haver gua para menos da metade da cidade.
1RVLVWHPDFRQGRPLQLDOpGLIHUHQWHRFDQRPHVWUHSDVVDDSHQDVQXPODGRGDTXDGUDDVFDVDVGDTXDGUDVHMXQWDPH
fazem uma nica ligao; (...) se o custo menor, ento a conta mensal tambm ser!; em compensao... as pessoas
GDTXDGUDWrPTXHVHMXQWDUIRUPDQGRFRPRVHIRVVHXPFRQGRPtQLR  HVFROKHPXPVtQGLFR  HDVVLQDPXP
compromisso chamado Termo de Adeso (...)

Tpico 3 O acordo entre o povo e a prefeitura

O povo tem as seguintes responsabilidades: constri o ramal condominial com o apoio da prefeitura (...); faz e conserva as
suas canalizaes internas; paga a conta mensal; cuida do relgio que vai medir a gua(...); presta ateno no servio e
reclama do que estiver errado; chama o sndico e faz reunies quando achar necessrio (...)
J a prefeitura assume o seguinte: constri a rede e (...) faz ela funcionar sem parar (...); faz a manuteno do ramal
condominial que est nas caladas; mede a gua e cobra a conta mensal; pode cobrar multa de quem atrasar e cortar a
gua de quem no pagar (...); obrigada a atender reclamaes (...)

Tpico 4 O bom uso do sistema

3DUDTXHQXQFDIDOWHiJXDQmRMRJDUiJXDIRUD  SRUH[HPSORIHFKDUDWRUQHLUDTXDQGRHVWLYHUID]HQGRDEDUEDRX


enxaguando a roupa ou (...); no varrer a casa com mangueira; no regar a rua com a gua tratada; somente usar o poo,
TXHWHPiJXDFRQWDPLQDGDSDUDRMDUGLPRXSDUDDUXD 

123

Metodologia do Sistema Condominial de esgotos

TERMO DE ADESO AO SISTEMA CONDOMINIAL DE ESGOTO


,GHQWLFDomRGRFRQGRPtQLR
O condomnio acima indicado, representado pelo sndico, Sr....... e a EMBASA, acordam, entre si, o contedo deste Termo
GH$GHVmRUHIHUHQGDGRSHODOLVWDGH&RQG{PLQRVHPDQH[R$UHSUHVHQWDomRGRFRQGRPtQLRMXQWRj(0%$6$VHUiIHLWD
pelo sndico e na sua ausncia, pelo subsndico, Sr........ eleitos diretamente pelos Condminos.
1. Compete EMBASA: 1.1. Construir o ramal condominial, entregando-o ao condomnio em perfeito estado de
funcionamento; 1.2. Operar o sistema de esgoto convencional, ao qual os sistemas condominiais esto interligados;
&REUDUDVFRQWDVPHQVDLVGRVHUYLoRGHHVJRWRMXQWRFRPDVFRQWDVGHiJXDjEDVHGH TXDUHQWDHFLQFRSRU
FHQWR GDWDULIDGHiJXD&RPXQLFDURFLDOPHQWHDR&RQGRPtQLRTXDOTXHUDQRUPDOLGDGHHQFRQWUDGDQRVUHVSHFWLYRV
Sistemas; 1.5. Executar novas Ligaes Prediais, considerando somente o trecho entre o ramal condominial e o limite
GRORWH3URPRYHUSURJUDPDVGH(GXFDomR6DQLWiULDH$PELHQWDOMXQWRjFRPXQLGDGHHDRXVXiULRREMHWLYDQGRD
PDQXWHQomRGRVUDPDLV([HFXWDUUHSDURVQRUDPDOFRQGRPLQLDOTXDQGRVROLFLWDGRSHORFRQGRPtQLRHLGHQWLFDGRV
como conseqncia de defeitos construtivos; 1.8. A EMBASA dar orientao tcnica ao condomnio durante 2 (dois)
meses aps o recebimento da obra e a implantao do sistema, para garantir o correto funcionamento dos ramais
condominiais.
2. Compete ao Condomnio: 2.1. Eleger o sndico e respectivo sub-sndico; 2.2. Realizar nos limites fsicos do condomnio
a manuteno e limpeza das caixas de passagem e dos ramais condominiais de esgoto; 2.3. Consultar a EMBASA antes
GHID]HUTXDOTXHULQWHUYHQomRTXHYHQKDDDOWHUDURSURMHWRRULJLQDO1mRMRJDUTXDOTXHUWLSRGHOL[RQRYDVRVDQLWiULR
pias, tanques de lavar roupa e caixa de passagem; 2.5. Impedir que as guas de chuva entrem nas canalizaes de
esgotos, evitando, desta forma, entupimento na rede; 2.6. Fazer interveno nos ramais condominiais apenas para limpeza
da tubulao e das caixas de passagem; 2.7. Solicitar EMBASA a execuo de novas Ligaes Prediais.
'LVSRVLo}HV*HUDLV&DVRVHMDVROLFLWDGDDSUHVHQoDGD(0%$6$SDUDH[HFXomRGHVHUYLoRVQRVUDPDLV
FRQGRPLQLDLVRPHVPRVHUiFREUDGRGHVGHTXHDUHVSRQVDELOLGDGHSHORSUREOHPDVHMDGRXVXiULR&DVRR
condomnio solicite a EMBASA e esta assuma a responsabilidade pela manuteno dos ramais condominiais, passar
a cobrar a tarifa de 80% (oitenta por cento) sobre o consumo de gua; 3.3. Os moradores do condomnio autorizam a
passagem dos ramais condominiais por seus lotes, possibilitando a coleta e escoamento dos esgotos da quadra.
(Seguem-se as assinaturas e endereos do sndico e subsndico)

Por ltimo, tm curso as Reunies Condominiais, as primeiras sendo


realizadas como teste do discurso e das regras, e as seguintes na condio de
regime do processo. A qualquer poca, porm, sobretudo no incio que
tem carter experimental, essas reunies podero oferecer contribuies
que atualizem e aperfeioem o processo, conforme indicado no diagrama
quando sim a necessidade de alteraes do discurso. Referidas alteraes
podero variar de simples mudanas na forma do discurso prpria
possibilidade de ajustamento das regras bsicas.

124

Sistema Condominial

O ramal condominial, por suas


caractersticas, pela baixo custo
dos materiais empregados,
pela simplicidade de execuo,
est ao alcance da capacidade
construtiva de qualquer comunidade
tecnicamente assistida. Por isso,
em torno de sua implantao
h uma excelente oportunidade
GHSDUFHULDVFXMDFRQFUHWL]DomR
depende, principalmente, da
comunidade querer o servio de
esgoto e da disposio do prestador
de buscar e promover parcerias.
A autoconstruo assistida dos
Ramais Condominiais pelos
Condomnios tm sido utilizada
HPGLYHUVRVSURMHWRVHFRP
timos resultados em locais to
distintos quanto o Distrito Federal e
Parauapebas (PA), Guarulhos (SP),
El Alto (La Paz, Bolvia) e outros.
Sua implementao normalmente
simples, rpida e as obras,se
bem asistidas, no perdem em
qualidade para uma obra tradicional
equivalente. O Condomnio que
assume a autoconstruo de seus
Ramais Condominiais deve ter sua
grande contribuio viabilizao
dos servios retribuda de forma
MXVWDPHGLDQWHSRUH[HPSORSUHoRV
e tarifas especiais, que considerem
o valor econmico das energias
aportadas pela comunidade.

9.4 OS RAMAIS CONDOMINIAIS E SUA


ENGENHARIA
Recordando...
Anteriormente abordagem da Engenharia dos Ramais Condominiais
projeto, construo, operao convm recordar toda a conceituao
que sobre eles foi considerada no Caderno 1, apenas se atentando, agora,
mais objetivamente, para os seus aspectos fsicos conforme a figura 31 j
mostrada.
O ramal condominial, ao qual as edificaes de uma mesma quadra
se conectam ao longo de seu percurso, o meio coletivo de ligao do
condomnio rede bsica. Por outro lado, ele tambm o principal objeto
de informao, discusso e negociao do sistema condominial envolvendo
a comunidade. Esta deve participar da definio de sua concepo fsica,
principalmente sua localizao relativa no condomnio, e sua regulao,
sobretudo por meio de acordo em torno dos direitos e deveres das partes
envolvidas (especialmente a concessionria e a comunidade) quanto sua
implantao e operao. Isto contribui para a melhor adequao da soluo a
cada unidade de demanda, sempre a partir de um mesmo modelo de coleta
a rede bsica que apenas tangencia cada condomnio.
Uma virtude importante do ramal condominial a sua flexibilidade.
Como composto de tubulaes de pequeno dimetro e de dispositivos de
inspeo compactos, capaz de caber em menores espaos. Com trechos
curtos e muitas junes, uma estrutura com muitos graus de liberdade, que
permite ao projetista explorar o traado mais favorvel em cada situao,
contornando os obstculos existentes e tirando o mximo proveito da
topografia natural do terreno, para chegar aos lugares mais difceis, com o
mnimo de escavaes e de quebra de pavimentos.
Alm de ser econmico, ele muito simples, a ponto de poder ter a sua
construo e manuteno ao alcance das prefeituras, da pequena construtora
ou da prpria comunidade organizada (os condomnios) atentar, a respeito,
para o destaque que vem a seguir. A escavao geralmente manual, devido
sua localizao e s dimenses reduzidas das valas. Os componentes do ramal
so econmicos, fceis de adquirir (tubos de pequeno dimetro) e simples de
fazer (caixas de inspeo).
Em cada condomnio especfico, sempre haver uma opo que, do ponto
de vista tcnico, ser a melhor (mais adequada e mais econmica), seno
a nica. A deciso sobre o tipo de ramal, todavia, deve caber aos usurios,
no seu condomnio, que escolhe entre as alternativas tecnicamente viveis
para a quadra (e condies associadas a cada uma delas) aquela de sua
preferncia. A formao ou fechamento do condomnio condio do
acesso dos usurios ao sistema - corresponde, na prtica, realizao de um
pacto entre os seus usurios e o prestador do servio, que regulador deste.

125

Metodologia do Sistema Condominial de esgotos

Envolve, conseqentemente, um pacote de decises sobre direitos e deveres


das partes na construo e na operao do ramal, alm da escolha do tipo de
ramal.
No que tange aos tipos de ramais, em reas de urbanizao regular,
normalmente, so trs as alternativas locacionais bsicas: os chamados
ramal de passeio, ramal de jardim e ramal de fundo de lote, alm das
solues mistas, que combinam mais de uma dessas alternativas num
mesmo condomnio. Nas reas de sub urbanizao e em favelas, pelas suas
exticas condies, esses ramais fogem das solues padronizadas, e tornamse aqueles que so os possveis em cada caso, os que passam por onde
puderem.
Cada condomnio pode ter mais de um ramal condominial, com as
ramificaes necessrias para a interligao de todas as economias da quadra
rede bsica. O ramal condominial, por sua vez, deve ser exclusivo de um
nico condomnio. Ele sempre nasce e termina na mesma quadra. No
recebe contribuies de fora do condomnio e contribui apenas para a
rede bsica, nunca para outros condomnios.
O ramal de passeio a alternativa mais caracterstica da cidade plenamente
urbanizada, de topografia favorvel; e, sem dvida, o desejvel quando
as condies locais o permitirem, inclusive ele tende a ter a preferncia
dos condomnios. Sua utilizao deve ser obrigatria onde houver grandes
consumidores ou unidades de consumo especial. Por outro lado, no
recomendvel nas reas pouco urbanizadas, sobretudo, quando no h
sequer a delimitao dos passeios. Embora no seja uma alternativa comum,
importante dizer que tambm seria possvel, como sua alternativa, atender
situaes tais como a ocorrncia de ruas bastante estreitas, ou de passeios e
laterais de vias largamente tomados por outros assentamentos subterrneos.
O condomnio, no caso, envolveria as duas faces de quarteiro confrontantes.
O ramal de fundo de lote destinado, sobretudo, ao atendimento de quadras
situadas abaixo do nvel da rua ou cujos terrenos caem para os fundos, ou
ainda quadras com geminao lateral das casas e fossas no fundo, desde
que existam, nesta posio, os espaos mnimos necessrios. Tambm pode
ser uma opo econmica do condomnio, j que quando esta posio
vivel ele o mais econmico na sua prpria construo e na instalao da
interligao da casa.
O ramal de jardim, dentro dos lotes e na sua parte frontal, permite o
atendimento de quadras situadas abaixo do nvel da rua e com casas com
fossa na frente. tambm uma alternativa ao ramal de passeio em reas
pouco urbanizadas e sem delimitao de passeios, ou tambm como opo
econmica do condomnio (em relao ao de passeio). A sua escolha, da
mesma forma que na alternativa anterior, depende da existncia de espaos
livres no trajeto.
Os ramais mistos atendem, principalmente, quadras com partes de
caractersticas distintas quanto ao escoamento (por exemplo, com uma face
escoando para o fundo e outra para a frente dos lotes) ou de preferncias
126

Sistema Condominial

distintas quanto ao tipo de ramal, fato mais raro e que poder subdividir
fisicamente o condomnio.
Aquele ramal das reas desarrumadas, que passa por onde puder, obriga
uma certa flexibilidade dos padres e deve percorrer os meandros da quadra,
das casas, procurando os espaos disponveis, ora enterrado, ora superficial ou
at areo, sob uma sala, fixado em um muro, na vertical, buscando o caminho
possvel e muitas vezes nico, para o atendimento da quadra.

As caractersticas dos ramais condominiais


Se os ramais condominiais j so naturalmente econmicos em decorrncia
da sua localizao em reas protegidas quanto a impactos que ameacem
a integridade dos tubos (passeios, reas verdes e interiores dos lotes),
urge tirar-se o mximo proveito desta condio. Minimizando-se a sua
profundidade, pela explorao das maiores declividades, e o seu percurso,
pelo desvio de obstculos, sem prejuzo, todavia, de sua mais interessante
aproximao dos pontos de captao das casas. A busca de minimizao
desses parmetros conseqncia de que a abertura e o fechamento de valas
para instalao da tubulao e a retirada e recomposio de pavimentos para
sua passagem so os dois itens principais da composio de custos das redes
de esgotos.
Nesse sentido, tem sido freqentemente adotado, sem problemas, o
recobrimento mnimo de 30 cm nos ramais internos (naturalmente mais
protegidos e que assim rasos facilitam a manuteno) e de 60 cm nos ramais
situados nos passeios. A profundidade mxima recomendada para os ramais
condominiais, por sua vez, sempre que possvel no deve ultrapassar 1,00
metro. Evidentemente tais condies e critrios devem ser flexibilizados nas
situaes onde sua aplicao rigorosa incompatvel com o atendimento das
casas, sobretudo, naquelas onde o ramal passa por onde puder. Precede,
todavia, tais valores prefixados, a necessidade desses ramais permitirem,
com as suas cotas, o esgotamento de casa casa do condomnio, salvo aquelas
excepcionalmente rebaixadas.
Quando da eventual necessidade de proteo das tubulaes em reas
sujeitas a alguma carga mvel (entradas de garagens, por exemplo) ou em
travessias de reas construdas, comum a utilizao de solues tais como o
envolvimento da canalizao em concreto simples, o capeamento por lajotas
do mesmo material ou ainda o bero de apoio ao assentamento.
O dimensionamento hidrulico detalhado do Ramal Condominial
normalmente no necessrio, pelo mesmo motivo que no se dimensiona
um ramal predial tradicional: as vazes de trabalho so bem inferiores
capacidade do coletor. Em uma quadra comum, com 20 a 40 casas, a vazo
de esgoto geralmente no ultrapassa 0,4 l/s. Essa vazo muito menor que
a vazo mnima de dimensionamento preconizada na Norma Brasileira,
que de 1,5 l/s, e que a capacidade de escoamento de um coletor de 100
mm (na pior das hipteses 1,8 l/s, com meia seo), que comporta os
esgotos sanitrios de cerca de 180 domiclios de padro mdio. A sobra de
127

Metodologia do Sistema Condominial de esgotos

capacidade do coletor de 100 mm para atender uma quadra comum to


grande que no h o que dimensionar no projeto do ramal condominial.
Basta que as declividades mnimas sejam respeitadas. Claro, no entanto, que
existem as excees: quadras de alto consumo de gua e outras caractersticas
especiais devem ser tratadas caso a caso.
As declividades de projeto sempre que possvel devem acompanhar a
declividade natural do terreno e evoluirem a partir dos mnimos que assegurem
as condies para a autolimpeza do coletor. As consideraes feitas quanto
declividade mnima para a Rede Bsica permanecem vlidas tambm aqui.
E para a vazo mnima que de 1,5 l/s, aquela expresso retorna
declividade mnima de 0,0045 m/m. No caso dos ramais condominiais,
comum a adoo, na prtica, de declividade mnima de 0,005 m/m, por
segurana, em que pese a possibilidade de uso de valores um pouco menores
quando necessrio.
Nas reas residenciais mais comuns, as vazes no ramal condominial
so pequenas, pois sua rea de contribuio restrita quadra. Nos
casos de obstruo, isso contribui para simplificar a manuteno e evitar
extravasamentos de grandes volumes de esgotos. Essa condio tambm
torna possvel a utilizao de tubulaes de dimetro mnimo em quase todas
as situaes, ficando as excees por conta da existncia de consumidores
especiais na quadra (seja por seus grandes consumos, seja pela natureza
incomum dos efluentes), ocasies em que dimetros maiores que 100 mm
podem ser necessrios. Os tubos empregados na construo dos ramais
condominiais no Brasil so de plstico ou de cermica. Os de plstico,
pela facilidade e rapidez de instalao, estanqueidade e outras caractersticas,
so os mais usados. Devem ser adotados tubos de PVC ou PEAD de linhas
para esgoto pblico, tubos para esgoto predial de linha reforada ou mesmo
tubos brancos classe A, que so de boa qualidade. Estes ltimos, no caso de
pequenas obras ou envolvimento da comunidade na implantao do sistema,
tm a vantagem de serem facilmente encontrados no comrcio local de
materiais de construo.
As caixas de inspeo (CI) devem ser projetadas levando-se em conta a
natureza do agente que ir oper-las, geralmente o prprio usurio, no
caso dos ramais internos, ou a concessionria, no dos externos. Suas funes
so as de receber o lanamento dos efluentes das vrias casas ao ramal, de
acesso dos agentes de limpeza e desobstruo e de viabilizao (hidrulica)
dos ngulos no percurso do ramal, que o flexibiliza para a recepo de
contribuies e o drible de obstculos. No caso dos ramais condominiais,
as CIs comumente empregadas tm seo interna mnima de 0,40m para
profundidades at 0,60 m; ou de 0,60 m para profundidades at 1,00 m.
As mais comuns so de pr-moldados de concreto, mas as de alvenaria e de
plstico tambm tm sido empregadas. A distncia mxima entre elas deve
ser compatvel com a natureza do operador e dos equipamentos e tcnicas de
manuteno disponveis em cada caso. Nos ramais internos, uma caixa em
cada lote, espaamento at 20m. Nos de passeio, 50m ou mais, se o operador
128

Sistema Condominial

for o prestador de servios e at 20m se for o condomnio. Os modelos


adotados para essas caixas terminam sendo, naturalmente, uma marca ou
caracterstica do prestador do servio.
A figura 39 de um Diagrama de Inter-relacionamento dos segmentos
presentes na vida de um Ramal Condominial, desde as decises iniciais a
seu respeito e at os procedimentos de sua operao e manuteno. Ele no
retrata exatamente o que se passou a respeito em todos os empreendimentos
condominiais, mas representa uma indicao segura de mtodo no
tratamento de suas sucessivas etapas, conforme se poder ver a seguir,
quando se descreve cada um dos tais segmentos.

Projeto, construo e operao


Os trs primeiros segmentos 1 (Dados dos Empreendimentos), 2 (Estudo
dos Condomnios) e 3 (Regras do Empreendimento) so aqueles mesmos
j contemplados no captulo anterior, de cujos textos interessa, aqui, o
pertinente aos ramais condominiais, ou seja, os critrios e regras de sua
escolha, as alternativas que foram levadas ao exame de cada condomnio
e o zoneamento da cidade no que diz respeito a tipologias das quadras e,
conseqentemente, dos condomnios e seus ramais.
A Obteno do Termo de Adeso, segmento 4, somente interessa ao
processo aqui considerado para que se tenham as informaes sobre o
conjunto dos ramais condominiais a serem construdos e se possa, ento,
elaborar a programao das atividades relacionadas s suas Ordens de
Servio e s suas Obras; e sobre a modalidade de ramal adotada em cada
condomnio, para que assim se faa.
Recordando, isto ocorre com a participao da comunidade, em reunies
realizadas com os moradores em cada quadra, as chamadas reunies
condominiais, e so formalizadas por meio do termo de adeso ou
instrumento pactual equivalente.
Do segmento 5, Programao das Atividades, pouco se tem a considerar j
que se trata de algo que deve levar as caractersticas do empreendedor, desde
que respeitada a ordenao aqui exposta. Os Levantamentos de Campo,
que fazem parte do segmento 6, correspondem, praticamente, elaborao
de um croqui apoiado em planta bsica disponvel do condomnio em escala
ampliada (1:200, aproximadamente), que obtido por levantamento de
campo contendo todas as informaes essenciais elaborao da ordem de
Servio para Execuo do Ramal Condominial, a saber:
t DBSBDUFSTUJDBTEBPDVQBPEPTMPUFT
t UJQPEFDPOTUSVPFYJTUFOUFFTVBTJUVBPFNDBEBMPUF
t UJQPMPHJBFQPTJPEBTJOTUBMBFTTBOJUSJBTEPNJDJMJBSFT
t MPDBMJ[BPEFDBJYBTEFJOTQFP GPTTBT TVNJEPVSPTFEFPVUSBT
solues de disposio de esgotos existentes;
t SFBTQBWJNFOUBEBTFTFVTSFTQFDUJWPTNBUFSJBJT EFOUSPEFDBEBMPUFF
nos passeios;
129

Figura 39
A vida do ramal condominial

Metodologia do Sistema Condominial de esgotos

130

Sistema Condominial

Figura 40
Fabricao estocagem de caixas de inspeo
de sistemas condominiais em Recife,
Pernambuco

t TFOUJEPEPFTDPBNFOUPOBUVSBMEBTHVBTFNDBEBMPUFFOPQBTTFJP
t EFNBJTJOUFSGFSODJBTJEFOUJDBEBTFPVUSBTJOGPSNBFTSFMFWBOUFT
para a definio dos ramais;
t QSJNFJSBJOEJDBPEPQFSDVSTPUJEPDPNPNBJTJOUFSFTTBOUFQBSBP
ramal condominial, j respeitada a escolha do condomnio.
A realizao desses levantamentos proporciona a oportunidade para um
contato muito rico com cada morador. A equipe responsvel pelos trabalhos
deve aproveitar a ocasio para esclarecer dvidas, orientar os usurios a
respeito do sistema e ouvir suas demandas individuais, procurando ajust-las
ao projeto para que o ramal atenda satisfatoriamente cada morador.
A Elaborao de Ordens de Servio (OS), segmento 7, o instrumento adotado
para definir completamente o Ramal Condominial na sua implantao.
Corresponde, naturalmente, a um projeto executivo que elaborado
imediatamente antes da obra, at porque suas informaes bsicas so bastante
sensveis ao tempo e, portanto, desatualizam-se com facilidade. A OS
composta, basicamente, de um croqui e notas de servio, preparados com base
no estudo do condomnio e nos levantamentos de campo realizados na quadra.
Seu nvel de detalhamento deve ser suficiente para a execuo das obras, o
que pode variar conforme a situao. Sua preparao adequada demanda
conhecimentos detalhados da situao local da quadra e das instalaes
sanitrias de cada casa, razo pela qual se exige que aqueles levantamentos de
campo sejam minuciosos. Contudo, os pontos de conexo de cada um deles
com a rede bsica devem ser previstos quando do lanamento das inspees
dessa rede, bem como das cotas mnimas necessrias.
As Caixas de Inspeo (CI) (ou o que lhes sejam equivalentes) so os
elementos que garantem a conexo dos esgotos de cada usurio ao ramal
condominial. Em cada lote, portanto, deve existir uma inspeo com essa
finalidade, alm daquelas que forem necessrias s mudanas de direo e
declividade do ramal condominial.
131

Metodologia do Sistema Condominial de esgotos

No caso de opo pelo ramal de passeio, a inspeo deve ser localizada,


preferencialmente, na parte frontal do terreno e poder ser conectada ao
ramal condominial por intermdio de um t (ou conexo equivalente) ou
ainda a outra inspeo. Nesses casos, deve ser feita tambm a locao do
dispositivo de ligao ao ramal de passeio.
Os pontos mais adequados para a construo das inspees devem ser
definidos com os moradores, de modo a conciliarem trs fatores importantes:
a maior facilidade para o esgotamento das instalaes sanitrias existentes,
as pretenses do morador quanto s futuras ampliaes das edificaes
(a serem evitadas pelo ramal) e a localizao das fossas (atual receptor de
efluentes). Esses locais sero materializados por meio de piquetes, ou marcas
de tinta, nas reas pavimentadas. Os pontos locados devem ser amarrados
a pontos fixos existentes, com auxlio de trena, de maneira a possibilitar sua
restituio.
Por ocasio da locao das inspees, devem ser identificados, em cada
terreno, e locados em relao ao dispositivo de inspeo, que receber
sua contribuio, os pontos mais desfavorveis para esgotamento das
edificaes existentes e previstas. Definida a locao das inspees pode ser
traado o ramal condominial. O seu lanamento, ou seu caminhamento,
determinado pela posio das caixas de inspeo por onde ele deve passar
(ou que a ele se ligam). Deve acompanhar, sempre que possvel, a declividade
natural do terreno, de modo a minimizar profundidades. Deve ser verificada,
ainda, a existncia de obstculos (como rvores, fossas, reas edificadas,
fundaes e outros), por ocasio da locao do ramal condominial, e
formulada uma soluo adequada para cada caso. Havendo obstculos
intransponveis, na prtica, o recurso a se adotar ser o deslocamento do
ramal com a correspondente criao de caixas de inspeo adicionais para
contornar o obstculo.
Nos pontos de mudana acentuada da declividade natural (elevaes ou
depresses do terreno) localizados na linha de caminhamento do ramal, ser
considerada a locao de caixa de inspeo para ajustar o perfil do coletor ao
do terreno.
Visando a operacionalidade do sistema, a distncia mxima entre dispositivos
de inspeo, preferencialmente, no deve ultrapassar 20 m, no mximo 30 m,
no caso dos ramais internos. Em ramais de passeio operados pelo prestador
de servio com equipamentos de pequeno porte, uma inspeo a cada 50
m o suficiente. Caso a distncia ultrapasse os limites, devero ser locadas
inspees intermedirias. Em terrenos planos, a manuteno da declividade
mnima obriga o aprofundamento do coletor na medida da distncia
percorrida. Em tais situaes, havendo caminhamentos longos a percorrer,
deve ser considerada a diviso do ramal em dois coletores mais curtos,
escoando em sentidos opostos, com a finalidade de evitar o aprofundamento
excessivo do coletor condominial e a imposio de aumento de profundidade
rede bsica para receber o ramal.
Nas quadras cortadas por divisores de gua, deve-se evitar que os
ramais condominiais os cruzem. Havendo interferncia da linha de
132

Sistema Condominial

caminhamento do ramal com divisores, os coletores condominiais devero


ser, preferencialmente, iniciados sobre o divisor, para que o sentido de
escoamento acompanhe a declividade natural do terreno. Sempre que
possvel, o ramal condominial deve guardar um afastamento mnimo de cerca
de 70 cm em relao aos limites do terreno, tanto no caso dos ramais internos
quanto nos de passeio. A conexo do ramal condominial rede bsica deve
ser feita por meio de um dispositivo de inspeo nesta ltima (caixa de
inspeo ou poo de visita).
A realizao de nivelamento topogrfico, por seu turno, ocorrer nos
casos em que as declividades do percurso locado para o ramal no sejam
visivelmente maiores que a mnima necessria, 0,005 m/m, caso em que
a OS adotar a profundidade constante como sua referncia. Para sua
realizao dever ser assinalada, em cada quadra, preferencialmente, em
ponto de montante, uma referncia de nvel (RN) auxiliar baseada na rede
de RNs implantada na rea do empreendimento. Essa referncia deve ser
pintada preferencialmente em postes de energia ou na face externa dos
muros e construes. Partindo dessas RNs auxiliares, devem ser nivelados e
contranivelados todos os pontos do ramal condominial, tais como caixas de
inspeo, pontos de conexo, pontos de sua interligao com a rede bsica,
bem como os pontos crticos para esgotamento dos prdios (pontos mais
baixos, caixas de gordura, inspees e fossas existentes). O nivelamento
poder ser realizado tanto com aparelhos topogrficos como com nvel de
mangueira. Processo este mais comum e normalmente mais eficiente no caso
dos ramais e instalaes internas, onde os espaos so exguos e as visadas
difceis.
Finalmente, na elaborao das OSs propriamente ditas, dever ser
inicialmente definida a cota de fundo da caixa de inspeo capaz de
possibilitar o atendimento de cada lote, em funo do nivelamento realizado;
a declividade mnima do ramal, lembra-se, deve ser a 0,005m/m, ao
passo que a interligao das instalaes sanitrias domiciliares ao ramal
condominial deve ter declividade a partir de 1%.
A tubulao deve ser preferencialmente de 100 mm de dimetro. Existindo
consumidores especiais na quadra, conforme dito antes, as vazes
precisam ser analisadas caso a caso e os dimetros adotados devem ser
aqueles necessrios, que sero hidraulicamente dimensionados. Exceto em
casos especiais, o recobrimento mnimo deve ser de 0,30 m, para ramais
condominiais internos (fundo de lote ou jardim), e de 0,60 m para ramais de
passeio, devendo-se evitar que ele ultrapasse 1,00 m de profundidade.
No clculo da OS deve-se buscar a minimizao das profundidades,
mantendo-as, sempre que possvel, naquele valor mnimo. A OS composta
dos seguintes elementos principais e um seu exemplo est mostrado na figura
41, tirado do sistema condominial de Salvador, Bahia:
t QMBOUBCBJYBEFQSPKFUPEBRVBESB JEFOUJDBOEPBEJWJTPEPTMPUFT
e as ruas que a delimitam, indicando: o traado do ramal, com
dimetro e sentido de escoamento em cada trecho; localizao, tipo e
numerao das caixas de inspeo; localizao dos ts de ligao, no
133

Figura 41
Exemplo de ordem de servio para ramal condominial de esgotos, do Sistema Salvador, da EMBASA

Metodologia do Sistema Condominial de esgotos

134

Sistema Condominial

caso de ramais de passeio; ponto(s) de lanamento do ramal na rede


bsica e identificao desta; eventuais interferncias; e as amarraes
e afastamentos bsicos necessrios para a execuo do ramal
projetado; planilha de clculo constando de: identificao da quadra
e do ramal; tipo e numerao das caixas de inspeo; distncias
entre inspees; cotas do terreno, da caixa e do(s) coletor(es) em
cada ponto; profundidades; largura de valas; diferena de nvel entre
pontos; declividade de cada trecho de ramal; quantitativos principais.
tSFMBPEPTNBUFSJBJT
Elaborada a OS, pode ter incio a Construo do Ramal Condominial,
segmento 8 do diagrama, a qual deve ser feita de maneira similar a qualquer
obra de coleta de esgotos de pequeno porte. normalmente uma obra muito
simples e de rpida execuo, em razo das pequenas profundidades e dos
componentes compactos empregados na sua construo. Sua implantao
pode ser feita pelo prestador de servios, diretamente, ou por meio de uma
empresa contratada; pelas prefeituras, onde for o caso; ou at mesmo pelo
condomnio, mediante orientao e assistncia tcnica adequadas.
Os ramais internos, normalmente contidos em espaos limitados, so
realizados com escavao manual. Os externos, a depender dos espaos
disponveis, podem ser tambm realizados com o uso de equipamentos de
escavao mecnica.
As caixas de inspeo mais empregadas so de concreto, de alvenaria ou de
plstico. Recomenda-se o emprego de caixas de inspeo pr-fabricadas,
para agilizar a realizao das obras e uniformizar sua qualidade. Caixas de
inspeo com pr-moldados de concreto so de uso muito difundido e seus
componentes so fceis de fabricar no canteiro, ou mesmo pela comunidade,
no caso de implantao sob o regime de autoconstruo.
Antes ou durante a construo, so pertinentes as seguintes recomendaes
de carter geral:
t BOUFTEPBTTFOUBNFOUP PTUVCPTEFWFNTFSJOTQFDJPOBEPT 
eliminando-se terra e entulhos do seu interior e recusando-se aqueles
que no forem lineares ou apresentarem outros defeitos;

Figura 42
Ramais condominiais em construo no
Recife.

t PGVOEPEBWBMBEFWFTFSSFHVMBSJ[BEPFBQSFTFOUBSDPNQBDUBP
adequada em toda sua extenso, com declividade igual a do coletor
a ser instalado, conforme definido na OS; precisa estar livre de
materiais ou salincias que prejudiquem o perfeito assentamento
e a integridade da tubulao. Na ocorrncia de tal situao, caso
o terreno natural seja constitudo por solo argiloso compactado,
rocha, ou em terrenos soltos nos quais se verifique a presena de
pedregulhos ou materiais estranhos diversos, deve ser utilizado
bero de areia, que precisa ser devidamente compactado para evitar
recalques futuros;
t PTUVCPTEPTDPMFUPSFTEFWFSPDBSBQPJBEPT OPMFJUPEBWBMB FN
todo o seu comprimento, com juntas perfeitamente conectadas e sem
sinuosidades verticais ou horizontais;
135

Metodologia do Sistema Condominial de esgotos

t BEFTDJEBFNPOUBHFNEBUVCVMBPOBTWBMBTTFSPQSPDFEJEBT
empregando-se tcnicas e equipamentos adequados a cada situao e
conforme o material utilizado.
Por outro lado, as seguintes Especificaes e Procedimentos Bsicos de
Instalao devem ser observados:
t PBMJOIBNFOUPFPOJWFMBNFOUPEPTUVCPTEFWFNTFSBTTFHVSBEPT
mediante a instalao de rguas nos pontos definidos na OS, as quais
so niveladas nesses pontos, para que a declividade entre duas rguas
consecutivas reproduza aquela que dever ter a tubulao no trecho
entre elas;
t POJWFMBNFOUPEBTSHVBTQPEFTFSGFJUPDPNJOTUSVNFOUPT
topogrficos ou com o auxlio de mangueira de nvel, que a melhor
opo no caso de ramais internos e em espaos sinuosos fechados;
t POJWFMBNFOUPEBQSJNFJSBSHVB EFNPOUBOUF
EFWFSUFSDPNP
referncia a RN auxiliar implantada na quadra; o das rguas seguintes
dever ser sempre executado em relao ao nvel da rgua anterior,
observadas a extenso real do trecho e a declividade mnima em
espaos exguos.
t BSHVBQPEFSTFSDPOTUJUVEBQPSVNBFTUBDBDSBWBEBOPFJYPEB
inspeo, desde que a distncia entre inspees no ultrapasse 15
m para o assentamento dos tubos de plstico. Pode-se utilizar uma
linha de nylon amarrada s tais rguas ou estacas, esticada sobre a
geratriz externa superior da tubulao, determinando o alinhamento
e a inclinao do trecho; tambm pode ser utilizado o nivelamento do
fundo da vala;
t BQTPBTTFOUBNFOUPEFDBEBUSFDIP EFWFTFWFSJDBSTFBUVCVMBP
assentada encontra-se livre de objetos em seu interior, removendo-os
caso existam, bem como se o trecho linear e estanque;
t RVBOEPIPVWFSGPTTBOPQFSDVSTPEPSBNBM EFWFTFSDPOTJEFSBEB
a possibilidade de passar a tubulao pelo seu interior e vedar
novamente as suas paredes; ela poder continuar em carga at o incio
do funcionamento do sistema, quando ento dever ser desativada e
aterrada.
Nos trechos sujeitos a cargas mveis, em que para evitar o aprofundamento
do coletor seja necessrio usar recobrimentos inferiores aos mnimos, as
tubulaes devem ser adequadamente protegidas para evitar deformaes,
esmagamento ou deslocamento dos tubos. No caso de coletores localizados em
passeios e em reas sem trfego, a proteo da tubulao, quando necessria,
pode ser feita com placas de concreto simples ou armado sobre o trecho a
proteger. O coletor deve ser assentado sobre bero de areia, ou outro material
incompressvel e recoberto igualmente com areia em toda a extenso a ser
protegida.
Aps a concluso do assentamento de cada trecho devem ser realizados
os testes para controle da perfeita execuo dos servios. Com auxlio de
espelho, pode ser verificado se o trecho est livre de materiais estranhos de
136

Sistema Condominial

qualquer natureza ou se esto corretos os alinhamentos horizontal e vertical


do trecho (colocado o espelho em uma das extremidades da tubulao, a
outra dever ser vista formando um crculo perfeito). Ainda, dever ser
lanada gua no ponto de montante da tubulao, para verificao do seu
completo escoamento no sentido previsto, indicando a inclinao, o correto
alinhamento e a inexistncia de obstrues no trecho. Tambm deve ser
verificado o perfeito acabamento das caixas de inspeo, incluindo as suas
calhas de fundo, tampa e encaixes entre componentes, alm de sua resistncia
aos empuxos laterais e cargas a que poder ser submetida.
Segue-se o cadastro do ramal condominial, que ser facilitado com a
utilizao da OS como sua base, destacando-se, contudo, a absoluta
importncia da incluso, neste cadastro, de todas as modificaes
introduzidas nas respectivas OSs.
O segmento 9 o Funcionamento do Ramal Condominial, inicialmente,
em carter experimental e devidamente assistido pela equipe tcnica; e, em
seguida, na sua fase de regime, dever ser eterna, por assim dizer-se 23.
Segue-se, agora em carter permanente e em acompanhamento ao segmento
anterior, a Manuteno Corretiva, segmento 9 do diagrama, para a qual se
pressupe que o operador tenha se preparado devidamente, lembrando que
os ramais condominiais so unidades muito prximas dos usurios, e que
por isso mesmo demandam urgncia no seu atendimento. A preparao das
equipes precisa atentar para esta proximidade e para as regras bsicas que
presidem o servio, bem como para a condio especial de falta de espaos
a ocorrentes, sobretudo nas reas sub urbanizadas. Os equipamentos, se
mecanizados, tm que se ajustar a tais caractersticas.

23

Essa eternidade poder ser interrompida


com mudanas no prdio e que determinem,
tambm, mudanas do seu ramal
condominial, o que mais comum nos
ramais internos, sobretudo em reas sub
urbanizadas.

A manuteno corretiva aquela que decorre de um chamado da populao,


quando ocorrem acidentes com os ramais condominiais: quebras, obstrues,
solicitao de desvios e at rixas entre vizinhos. As equipes de operao
devero estar preparadas para, antes de qualquer interveno, observar se o
chamado cabvel (corresponde efetivamente a uma tarefa do concessionrio
conforme o Termo de Adeso do condomnio) ou se uma solicitao
indevida quanto s responsabilidades assumidas. importante caracterizar
o acidente para as estatsticas do servio, localizando-o para fins de
catalogao. Se a tarefa for daquelas indevidas, a equipe deve bem explicar a
situao ao usurio e tentar induzi-lo a realizar a operao, nem que seja com
a sua ajuda, procedimento este que estimula a fixar as regras ajustadas no
incio do servio. No caso de recusa do responsvel, a operao deve ser, de
qualquer forma, realizada pela equipe. Essas circunstncias devero se somar
quela caracterizao do problema que ir ser catalogada, ou para orientar
uma providncia previamente estabelecida para esses casos, como, por
exemplo, a cobrana do servio realizado juntamente com a conta mensal; ou
para dar margem a estudos que eventualmente venham a sugerir a alterao
das regras do jogo.
A Acumulao de Informaes, que o segmento 11, deve estar ajustada
aos procedimentos especficos do operador com relao acumulao de
informaes que orienta as suas estatsticas e, conseqentemente, pode
137

Metodologia do Sistema Condominial de esgotos

aperfeioar o processo operacional. Caso esse acervo no seja formado,


ou esteja em regime precrio, recomendvel a montagem de um sistema
voltado apenas para os ramais condominiais, dado que so essas unidades
as mais sensveis do sistema de esgotamento condominial e que, portanto,
demandam um processo de ajustamentos sucessivos. A sua operao haver
de indicar, a par de alteraes de procedimentos, a necessidade de pesquisas
especficas que ajudem a melhor apreciar os eventos crticos e estudar as
solues mais adequadas para sua correo.
O segmento 12 compreende as Pesquisas Especficas e Estudos Correlatos,
que so espordicos e tm a finalidade de conhecer, o melhor possvel, o
desempenho dos ramais condominiais e seus condomnios, no sistema, com
base no que ser possvel estudar, propor e implantar procedimentos que
o faam evoluir favoravelmente. As questes mais presentes neste rol e
ainda no estudadas estaro nas comunidades de reas sub urbanizadas e
dizem respeito ao papel da comunidade de usurios no uso do sistema e no
cumprimento de suas obrigaes pactuadas, bem como identificao das
causas mais freqentes de acidentes e defeitos de projeto ou de construo.
Os resultados de tais estudos podero oferecer trs diferentes respostas ao
servio: alteraes de procedimentos ou de regras, realizao de campanhas
educativas com objetivos especficos, ou simplesmente nada a se fazer alm
de acumular as informaes decorrentes.
Convm observar que aquilo que demandaria efetivamente uma pesquisa
especfica e estudos nos termos acima frisados, e que no teve esta pesquisa
realizada, continuar sendo um estorvo para a operao, e certamente
representando custos, agravamentos e descrdito crescente; alm disso, pode
estar enraizando e aculturando prticas certamente inconvenientes.
Na decorrncia direta do segmento 12, podero resultar atividades que se
insiram no segmento 13, Alteraes de Procedimento, seja voltando-se
mobilizao social quando a questo diz respeito aos usurios (acredita-se
que possa ela limitar-se aos sndicos) -, seja pela mudana de procedimentos
na operao e manuteno do servio, ou na prpria correo do sistema
fsico. Quando, porm, esses estudos apontam problemas comportamentais
na sociedade usuria, a necessidade se volta, ento, para a realizao de
Campanhas Educativas Especficas, que no diagrama esto representadas
pelo segmento 14. As campanhas correspondem ao esforo de sanar
problemas decorrentes de falhas no uso do sistema ou do cumprimento das
obrigaes da populao para com o servio. Desse modo, compreenderiam
a utilizao dos espaos de reunio dos bairros, sobretudo as escolas e
eventos pblicos com animao artstica, alm da produo e disseminao
de peas ilustrativas (cartilhas, vdeos, panfletos, informativos, etc).

138

Sistema Condominial

10. APLICAO DO MODELO:


REQUISITOS DESEJVEIS E ALGUNS
INDICADORES
Essas so questes um tanto difceis na sua abordagem, devendo-se inclusive
confessar que aqui esto, muito mais por insistncia de interessados do que
por vontade do autor. Principalmente daqueles para os quais os sistemas
condominiais ainda representam uma novidade. que os requisitos gerais
para o xito na aplicao dos sistemas condominiais so, na realidade, os
mesmos de qualquer empreendimento com iguais objetivos. Apenas alguns
requisitos especficos podem e devem ser destacados. Quanto aos indicadores
no so muitos os que provm dos acervos e das estatsticas dos prestadores
de servio experientes na matria, justamente pela fragilidade de a cultura
brasileira guardar e, sobretudo, trabalhar dados operacionais. Alm disso,
relativamente pequena, ainda, a histria dos sistemas condominiais
brasileiros. De qualquer forma, faz-se aqui um esforo para o preenchimento
dessa lacuna, alm do que j foi posto no ltimo captulo do Caderno 1, a
ttulo de vantagens e premissas da prpria teoria - e do que ser tentado no
Caderno 3, ao se discorrer sobre alguns empreendimentos especficos.

10.1 REQUISITOS IMPORTANTES NA APLICAO


DO MODELO
Quando se disse, acima, que os requisitos gerais para o alcance do xito nos
empreendimentos condominiais so, genericamente, os mesmos de qualquer
empreendimento com igual inteno de sucesso, est-se falando o bvio, de
fato. O que de diferente se poderia desejar a esse respeito sobretudo quando
se tratar de primeiros empreendimentos condominiais no mbito de quem
vai realiz-lo na nfase nos preceitos usuais, um algo mais de entusiasmo
e cuidados capazes de compensar a inexperincia e a inovao... ou seja, se
no conhecemos, nunca fizemos e estamos interessados em que d certo,
ento, precisamos nos cercar de maiores cuidados e de maiores precaues.
Precisamos, enfim, caprichar. No que concerne, por outro lado, os requisitos
especficos, eles existem, sim, e devem ser devidamente observados. Os mais
importantes so os cinco seguintes.

Conscincia e consistncia na deciso


Decisivamente, h uma correlao direta entre o nvel alcanado por esses
fatores na definio do empreendimento e a obteno de xito nos seus
resultados. Os aspectos que melhor expressam esse requisito so o razovel
conhecimento dos decisores sobre o modelo, a autoridade transmitida aos
executores e a adeso ao empreendimento. Observe-se que faltando ou
minimizando-se qualquer desses aspectos bastante possvel a ocorrncia de
um mau comeo.
139

Metodologia do Sistema Condominial de esgotos

Coerncia e consistncia das regras bsicas


Trata-se de outra questo determinante dos resultados alcanveis pelo
empreendimento. Ela interfere diretamente no nvel de adeso dos usurios,
no valor dos investimentos, nos custos operacionais e na futura operao do
servio. Mais apertadas as regras (mais esforos da populao), menores os
investimentos, mais consistente a adeso (e melhor o uso) e mais exigente a
participao comunitria. Menos apertadas ou mais leves essas regras, as
correlaes ocorrem no sentido contrrio.

Criteriosa escolha da rea para a experincia-piloto


Recorde-se de que est em jogo, aqui, so as questes do novo modelo
e que representa o desconhecido para o prestador do servio e para os
usurios, como sejam a participao da comunidade (a sua reao ao
processo) e a dotao dos ramais condominiais e os primeiros momentos
de sua operao. Da porque a escolha da rea-piloto dever combinar
fatores tais como a ocorrncia de problema visvel com esgotos
(em conseqncia, interesse da comunidade pela soluo); uma certa
organizao comunitria e pelo menos latente mobilizao (facilitao
do processo condominial); alguma representatividade da populao
local (desejvel, por exemplo, que no se trate de uma rea muito pobre
(capaz de sugerir que o modelo tem propenso apenas para tais reas);
e facilidades para o lanamento do efluente, de sorte que a unidade de
tratamento no polarize a ateno dos tcnicos.

Formao das equipes de coordenao e execuo


Est aqui outro fator decisivo para o sucesso da experincia-piloto e dos seus
prprios desdobramentos, j que a coordenao inicial est sendo treinada
justamente para que d continuidade ao processo. Os seus requisitos mais
importantes so, em primeiro lugar, a vontade de a estar na decorrncia da
adeso que fez ao modelo; depois, a competncia tcnica para as tarefas
que correspondero a cada um; a habilidade no trato com a populao e o
domnio das questes que vo estar presentes nas reunies e contatos. No
deve faltar numa fase inicial do projeto uma consultoria especializada, em
tempo parcial, com experincia anterior, se possvel, em empreendimentos com
disposies similares.

10.2 INDICADORES E REFERNCIAS


As consideraes a esse respeito havero de estar limitadas ao sistema
coletor, j que ele o elemento que se pode considerar caracteristicamente
condominial, decorrncia de uma nova idia, uma nova teoria. Com efeito,
o processamento final e as estruturas de transporte entre bacias, a despeito
de indicaes, sugestes ou mesmo recomendaes sobre eles a partir
das idias bsicas do modelo condominial, no permitem, contudo, que
se possa consider-los uma exclusividade desse sistema. De uma forma
140

Sistema Condominial

mais radical a esse respeito, apenas se procurou estabelecer o conceito de


Plano de Ordenamento, que na realidade uma estratgia de potencial
descentralizao do processamento final com o objetivo precpuo de
garantir a efetividade de solues, seja qual for a disponibilidade de recursos
financeiros a qualquer poca.
Segue-se, ento, o que foi possvel relacionar como indicadores e referncias
dos sistemas condominiais de coleta.

Extenso do Sistema Coletor Condominial


A extenso da rede bsica, por exemplo, funo, principalmente, do
tamanho e forma das quadras e das disposies urbanstica e topogrfica da
cidade, sendo verdadeiro que quanto mais geomtrica a urbanizao e mais
discreta a topografia, menores as extenses de rede bsica. O intervalo de
40 a 55 % da extenso total de ruas ou de rede convencional de um bairro
ou de uma cidade , certamente, uma boa indicao para a extenso de sua
rede bsica condominial. No caso, para efeito de estimativas preliminares,
45% seria uma boa referncia geral.
Para a extenso dos ramais condominiais, o que se pode dizer que ela
funo, principalmente, da quantidade de lotes e sua largura mdia, alm da
incidncia dos diversos tipos de ramal no empreendimento. Ramais de fundo
de lote de uso compartilhado pelos lotes das duas metades da quadra tm
extenso mdia por lote geralmente pouco maior que a metade da largura
mdia do lote. Os demais tipos de ramais por dentro da quadra costumam
apresentar comprimento mdio em torno da largura do lote mdio. Ramais
de passeio, por sua vez, tendem a uma extenso mdia pouco maior (no
mais que 10%) que a testada do lote mdio tpico. Salvo em situaes
particulares, sobretudo topogrficas, tende a haver uma predominncia dos
ramais de passeio no empreendimento - e uma incidncia muito reduzida do
ramal de fundo de lote compartilhado.
No conjunto do sistema coletor, a extenso dos ramais condominiais muito
maior que a extenso da rede bsica correspondente, com esta representando
entre 25 e 35 % da extenso total do sistema coletor condominial, do qual
se deduz que os ramais condominiais representam os restantes 65 a 75%,
o seja, cerca de 2 a 3 metros de ramal condominial para cada metro de
rede bsica. Estes nmeros so particularmente importantes nas tomadas de
deciso a respeito da atribuio de responsabilidades pelos investimentos nos
ramais condominiais. A idia que se defende a esse respeito a de que sejam
eles um nus da populao usuria, pelo quanto esta medida significa de
apoio universalizao do atendimento. Como j se falou noutro ponto deste
documento, a medida comporta compensaes que minimizem os pagamentos
dos mais pobres e uma importante contribuio efetividade das ligaes e
ao melhor uso futuro do servio em face do processo participativo que se torna
indispensvel para a escolha dos ramais pelos condminos e seus respectivos
custos.

141

Metodologia do Sistema Condominial de esgotos

Custos de Implantao
Os custos unitrios da rede bsica dependem das caractersticas da rea
de projeto, bastante variveis, sendo especialmente relevantes, no caso,
a topografia do terreno (determinante das escavaes e seus potenciais
requisitos), a existncia e o tipo de pavimentao e a natureza do subsolo
(principalmente a presena de rocha e gua). Do mesmo modo, os preos
dos servios e insumos podem variar enormemente de um local para
o outro (pases, regies, cidades) e ao longo do tempo, assim como os
preos unitrios adotados pelos diversos prestadores de servio, que
geralmente tm critrios prprios para a elaborao de suas tabelas de
preos. Desse modo, muito difcil falar em preos de referncia no caso
dos coletores de esgoto.
Em termos relativos, conforme j foi visto a partir da prpria teoria do
modelo condominial, o seu custo alcanar no mximo a metade do que
custaria um sistema convencional equivalente, variando esse percentual
conforme as caractersticas locais e o sistema convencional utilizado na
comparao. Por outro lado, a rede bsica representa, normalmente, de 40
a 50% do custo de implantao do sistema coletor condominial, enquanto
os Ramais Condominiais representam de 50 a 60% desse custo. Em bairros
com pouca pavimentao e solo favorvel s escavaes, os investimentos
esperados para a implantao da rede bsica e dos ramais condominiais, no
Brasil, se situam, freqentemente, nas seguintes faixas, com base nos preos
de 2007:
Rede Bsica:

R$ 70/m a R$ 105/m

Ramais Condominiais:

R$ 50/m a R$ 70/m

Sobre os respectivos preos pode ser dito que, em reas com densidade entre
15 e 40 lotes por hectare e ocupao horizontal, os investimentos podem ser
admitidos na seguinte ordem de grandeza:
Rede Bsica:

R$ 350,00/lig a R$ 600,00/ligao

Ramais Condominiais:

R$ 450,00/lig a R$ 800,00/ligao

Na composio dos custos de implantao da rede bsica, o item


mais significativo costuma ser o movimento de terra, que representa
freqentemente mais da metade do investimento (sobretudo nas reas onde
a incidncia de pavimentao no caminhamento dos coletores no grande).
Onde a taxa de pavimentao elevada, o custo de remoo e recomposio
dos pavimentos pode pesar significativamente no valor do empreendimento.
Outros itens importantes so as inspees (CI e PV) e os materiais (tubos
especialmente), cada qual representando algo da ordem de 20% do valor do
empreendimento e at mais, a depender da situao.

142

Sistema Condominial

Servios Condominiais
(Mobilizao e projeto dos ramais)
A mobilizao comunitria e o projeto dos ramais condominiais so
atividades interdependentes que devem ser realizadas de maneira articulada,
conforme visto anteriormente neste caderno. Alm disso devem ter uma
coordenao geral nica, condio importante para a eficcia e agilidade do
processo de formao dos condomnios e definio dos ramais condominiais.
Um engenheiro e um tcnico social (ou um profissional com tal dupla
aptido), com apoio de um desenhista e um auxiliar administrativo e 6
equipes de campo (4 de mobilizao comunitria e 2 de topografia e projeto)
podem dar conta de at quatro condomnios (quadras) e o projeto de seus
respectivos ramais condominiais por cada dia de trabalho, dependendo
das condies ocasionais. Isso equivale, mais ou menos, a um bairro de seis
ou sete mil habitantes e ao projeto de quatro a cinco mil metros de ramais
condominiais por ms.
As equipes de campo aqui referidas podem ter a seguinte composio bsica:
t FRVJQFEFNPCJMJ[BPDPNVOJUSJBVNUDOJDPTPDJBMFVN
auxiliar;
t FRVJQFEFUPQPHSBBFQSPKFUPVNUDOJDPEFUPQPHSBBFEPJT
auxiliares.
Em termos de custo, as atividades de mobilizao comunitria e projeto
de ramais condominiais podem ser estimadas na ordem de 5 a 10%
do valor do empreendimento, a depender da escala do projeto e das
condies locais.

Estrutura operacional
Da parte do prestador do servio, a operao do sistema condominial deve
ser realizada com equipes qualificadas e bem dimensionadas e com o auxlio
de equipamentos e ferramentas adequados. No caso dos coletores de PVC,
sugere-se o uso de equipamentos com hidrojato, os quais no danificam a
tubulao durante os servios de desobstruo. Em condies normais,
uma equipe de campo, composta de um oficial de manuteno e um
auxiliar, equipada com um veculo leve e um dispositivo porttil de
hidrojateamento, consegue manter um micro sistema equivalente a um
bairro com 5 mil ligaes, com coletores de at 200 mm de dimetro e
distncia mxima entre inspees de at 50 m. Para coletores com trechos
mais longos ou de dimetros maiores, pode-se utilizar os hidrojatos de porte
mdio, montados em camionetes, operveis por uma equipe similar descrita
para o uso de equipamentos portteis e com produtividade semelhante. Ou
mesmo equipamentos combinados (jato-suco) de grande porte, montados
em chassi de caminho, apropriado para tubulaes de grande dimetro.

143

Metodologia do Sistema Condominial de esgotos

Desempenho e custos operacionais


So raros e pouco conclusivos, no Brasil, estudos publicados analisando
a fundo o desempenho e o custo operacional dos sistemas convencionais
de esgotos, ao passo que para os sistemas condominiais eles inexistem.
As informaes disponveis, contudo, apontam para um desempenho
operacional semelhante entre os dois tipos de sistemas quando submetidos,
ambos, a condies sociais e ambientais similares. Dados recentes da CAESB,
por exemplo, apontam uma incidncia de servios de manuteno da ordem
de uma dezena por quilmetro de coletor por ano no Distrito Federal, tanto
para redes convencionais quanto para os sistemas condominiais.
Em termos de custo operacional, em que pese a falta de informaes
conclusivas, considera-se que os sistemas condominiais podem beneficiarse da possibilidade da utilizao de equipamentos de menor porte e mais
econmicos, em decorrncia das menores profundidades e dimetros que as
redes condominiais apresentam relativamente ao sistema convencional.

144

Sistema Condominial

11. INTRODUO AO CADERNO 3


Se os cadernos anteriores procuraram ser exaustivos na teoria dos sistemas
condominiais as razes que o determinaram, seus conceitos, a metodologia
de sua execuo chegada a ocasio de se conhecer a sua prtica, atravs
de casos concretos de sua aplicao. Nesse sentido, foram selecionados
alguns empreendimentos, do rol dos que tiveram a participao do autor
desta srie, diretamente como consultor ou atravs da empresa da qual faz
parte (Condominium Empreendimentos Ambientais Ltda), e que alm
de estarem entre os principais por suas caractersticas, peculiaridades ou
dimenses, conseguem oferecer um largo acervo de informaes, bastante
diferenciado em suas circunstncias. A preocupao maior com a exposio
no ser propriamente com os aspectos da engenharia ento praticada de
resto bastante simples e de fcil domnio como j visto anteriormente mas,
sobretudo, com o que poderia ser considerada, em cada caso, a alma do
negcio Ou seja, as circunstncias geradoras, as decises, as concepes
fsicas, as regras adotadas, os resultados alcanados, os fatores positivos e
negativos, a continuidade, os seus fatos interessantes ou at mesmo pitorescos.
Assim, os empreendimentos considerados foram, em primeiro lugar,
aqueles que constituram o verdadeiro embrio do modelo, nas suas
origens no incio dos anos oitenta, no Rio Grande do Norte (na Capital e
cidades do interior), e em Petrolina, Pernambuco; depois, os do Distrito
Federal e da cidade do Salvador, pela grandiosidade comum a ambos, de um
lado, e pela profunda diferenciao, por outro lado, dos seus aspectos fsicourbansticos, sociais e institucionais; e finalmente o caso da cidade do Recife,
pela inovao que representou a sua concepo fsica, j absorvida pelo
sistema institucional, e uma proposta para sua implementao em parceria
com a iniciativa privada, ainda latente.
As idias-fora que foram explicadas no Caderno 1 - e que voltaram
tona em vrias outros pontos dos dois cadernos iniciais - tero, aqui,
oportunidades de melhor se apresentar, porque desta feita estaro
concretamente colocadas, muitas vezes se constituindo em diferencial
nas diversas situaes. So idias de certa forma abstratas, dificilmente
mensurveis, mas que agora estaro mais materializadas: a participao
comunitria, a adequao realidade, a integrao e interao de agentes
e de aes e o gradualismo. Para rememorar o que j foi dito sobre a
influncia desses fatores sobre os resultados dos empreendimentos, volta-se
a apresentar, aqui, na figura 43, o mesmo grfico indicativo mostrado ao
final daquele primeiro caderno. Tanto mais e melhor aplicadas essas idias,
menores os custos e maiores o atendimento e a satisfao dos usurios.

145

Empreendimentos condominiais de esgotos no Brasil

O caso do Rio Grande do Norte o objeto do captulo seguinte, emana da


sua Companhia de gua e Esgotos, a CAERN, remonta aos anos iniciais
da dcada de 80 e trata de trs situaes absolutamente diferentes a que se
procurou a maior possvel adequao s suas realidades. A de dois bairros
pobres da cidade do Natal, Rocas e Santos Reis, onde a nfase para a
participao comunitria; a de um conjunto habitacional Cnego Monte,
em Santa Cruz, na regio Agreste do interior do Estado, onde prevaleceu
a racionalidade tcnica; e por ltimo a de uma cidade da regio semirida do Serto, Currais Novos, onde a busca do conhecimento do seu
sistema preexistente de esgotamento sanitrio foi um seguro indicador da
concepo do novo sistema. Nas trs situaes, faz-se um relato do como se
passaram os episdios da implantao e de que constaram eles, tecendo-se
consideraes, ao final, sobre a continuidade dos servios at os dias atuais.
No dcimo terceiro captulo est o caso de Petrolina, com trs sucessivas
etapas marcadas pela condio da disponibilidade de recursos financeiros
e suas distintas formas de manipulao. O agente executor foi (e continua
sendo) a Prefeitura Municipal e o prestador do servio de operao a
empresa estadual de saneamento, a COMPESA, que ajustou suas tarifas
ao menor custo do novo modelo, fatos esses (tarifa e integrao), que foram
absoluta novidade nos idos de 1980, quando eles ocorreram. A sua primeira

146

Figura 43
O Sistema Condominial e suas Idias-fora

Sistema Condominial

etapa foi, sem dvida, um dos mais ricos exemplos da aplicao daquelas
idias-fora.
O captulo 14 dedicado ao Distrito Federal, sem dvida, a mais bem
sucedida, organizada e disciplinada aplicao do sistema condominial de
esgotamento sanitrio, a qual contou com a fora poltica dos sucessivos
governos locais a partir do ano de 1992. A respeito desse programa, o
captulo trata das suas condies gerais, mas est focado no caso da cidade de
Santa Maria, onde foi mais marcante a ao deste autor.
A cidade do Recife, capital de Pernambuco, ocupa o captulo 15, com o
Plano de Ordenamento do seu Sistema Fsico, j adotado e at estendido
para a sua Regio Metropolitana, e o seu desdobramento, ainda uma mera
proposta, que uma consistente idia para um Sistema de Gesto em
parceria com a iniciativa privada. Nele, o modelo condominial ser mais
explorado na sua segunda instncia, dos micro sistemas, do que naquela
primeira, dos condomnios.
O ltimo caso apresentado e discutido, no captulo 16, ser o do sistema
condominial da cidade do Salvador, Capital do Estado da Bahia. Ao
contrrio de Braslia e do Distrito Federal, aqui esto a mais complexa
urbanizao em face de um sistema de esgotamento e a mais difcil transio
de um sistema unitrio fsica e culturalmente, entranhado para um sistema
separador. Alm disso, estiveram tambm complicando o processo, decises
das mais frgeis pelo modelo condominial, acompanhadas de regras de
acesso igualmente frgeis. A operao dos servios, com as correes de
curso que necessita, o seu desafio maior neste momento.

147

Empreendimentos condominiais de esgotos no Brasil

12. RIO GRANDE DO NORTE


Foi nesse Estado, a partir de 1980, que efetivamente teve incio a
histria dos sistemas condominiais os primeiros esforos na sua
sistematizao - sob os auspcios da CAERN 24, com a experimentao
do novel modelo em urbanizaes de trs diferentes naturezas, e que
at certo ponto representavam as cidades brasileiras. A primeira, dois
bairros contguos da cidade do Natal, pobres e desordenados nas
suas habitaes; o segundo rol abrangeu uma vila popular, o Conjunto
Cnego Monte na cidade de Santa Cruz; e, finalmente, trs cidades
do interior do Estado que compuseram uma pesquisa Goianinha,
Parnamirim e Currais Novos, situadas em trs distintas regies
do Estado. Um universo variado, portanto, que bem contemplou
diferenciados contextos urbanos, diferentes classes sociais e diferentes
presenas institucionais.
Antes da apreciao de cada uma dessas experincias (na poca, verdadeiras
experincias!) foi importante um relato e algumas consideraes sobre
o contexto em que elas ocorreram: o do setor do saneamento nacional,
histrico, e o especificamente institucional - CAERN e adjacncias.
Sob o primeiro aspecto, o Brasil estava saindo de um regime militar
extremamente fechado, implantado em 1964, e que deixou seqelas fortes
no seu sistema institucional. Particularmente no setor do saneamento
foi notrio o desatendimento dos estratos sociais de menor renda por
esses servios essenciais (e tambm muito pouca preocupao em sair
dessa condio) e uma postura autocrtica nas suas empresas, distante
da populao e at mesmo das prefeituras. No mbito mais operacional, o
setor estava decididamente marcado por uma cultura tcnica rigidamente
padronizada e avessa a novidades como ainda hoje prevalece em muitos
ambientes principalmente quando o novo representasse mudanas
de procedimentos, de processos e de cursos de ao, como era o caso,
precisamente, dos sistemas condominiais. A CAERN, francamente, muito
bem representava esse pensamento dominante e seu status quo viria a ser
pertinaz opositor das inovaes. Esse contexto, inclusive, foi determinante
da forma como a empresa seria organizada para o desenvolvimento dos
seus sistemas condominiais, qual seja a de confinamento (at fsico) de uma
equipe tcnica composta por jovens funcionrios (engenheiros, tcnicos de
nvel mdio e estagirios de engenharia) e prestadores de servio (portanto,
temporrios) 25, que tinham em comum muito entusiasmo, alm da
competncia tcnica.
J organismos internacionais de financiamento, como o Banco Mundial,
ao contrrio, comeavam a estender suas preocupaes na direo oposta,
propugnando por esforos na abertura do atendimento por servios de
saneamento aos setores at ento relegados e oferecendo idias e recursos
financeiros para pesquisas e experimentos que ensejassem essas aes, e que
estimulassem a participao das comunidades 26. O Governo Brasileiro
148

24

A bem da verdade, o autor dos cadernos


foi tambm autor de dois prenncios
do sistema condominial (1979/80), que
antecederam essa sistematizao, a
saber: uma citao a reas que teriam que
contar com ramais intramuros para a sua
FROHWDGDGDVDVGLFXOGDGHVRIHUHFLGDV
pela sua urbanizao... no Plano Diretor
de Esgotos da Regio Metropolitana do
Recife (ACQUA-PLAN/COMPESA); e pelo
menos 7 sistemas coletores de esgotos em
conjuntos populares, os quais anteciparam o
desenho condominial com ramais de fundo
de lote (ACQUA-PLAN/COHAB-PE), todos
construdos e que vieram a ter uma precria
operao.

25

O ncleo desta equipe precisa ser


registrado: dos quadros da CAERN, os
engenheiros Vilmar Rocha, Geny Formiga
de Farias, Herslia Coelho de Medeiros,
Aldo Tinoco, Paula de Melo Liberato,
Silvana Lima e o ento estagirio Ivan
Paiva Jnior; da Universidade Federal do
R. G. do Norte, os professores engenheiros
Ccero Onofre de Andrade Neto e Lindolfo
Neto de Oliveira Sales; da Universidade
de Leeds, Inglaterra, o engenheiro George
Simnatamby, colaborando nas pesquisas
e ao mesmo tempo colhendo elementos
para a elaborao de sua tese de doutorado
naquela Universidade, sob este tema (feita e
aprovada), orientada pelo professor Duncan
Mara, coincidentemente tambm consultor
do Banco Mundial no projeto Rocas e Santos
5HLVHQDOPHQWHRDXWRUGHVWHWUDEDOKR
como consultor e orientador da equipe.

26

Interessante observar que esta


participao da comunidade viria a ocupar,
por toda a dcada de 80, muitas pginas
em projetos governamentais, mais como
uma palavra mgica do que como efetivo
exerccio da democratizao do aparelho
institucional.

Sistema Condominial

foi sendo sensvel a esses apelos e um dos seus programas pioneiros nesse
sentido foi o dirigido s Cidades de Porte Mdio do Pas, para investimentos
em infra-estrutura urbana e social, inclusive de saneamento, que veio a
contemplar a cidade do Natal. Por essa porta, ento, chegou-se ao projeto
Rocas e Santos Reis aqui considerado e, por decorrncia, aos demais
experimentos que deram curso aos sistemas condominiais.
Feitos esses esclarecimentos de natureza institucional, passa-se agora, ento,
abordagem de cada uma das experincias aqui citadas, e em seguida a
uma viso geral da situao atual da empresa no que tange aos sistemas
condominiais.

12.1 ROCAS E SANTOS REIS


Essas duas comunidades contguas reuniam 16.000 habitantes, poca
(1981), se situando-se nas proximidades da praia, na cidade do Natal.
Tinham precrias condies habitacionais e, ainda mais precrias, condies
sanitrias. Isso, em face da situao de pobreza das pessoas e das suas casas,
da elevada densidade de ocupao e do fato de que grande parte de suas casas
estava situada abaixo do nvel dos logradouros locais, o que se depreende
da figura 44. Para elas, ento, o programa Cidades de Porte Mdio, que
destinava um projeto de esgotamento sanitrio convencional que,
analisado no momento de sua implantao, veio a ter uma constatao
fatal: muito poucas seriam as casas em condies de se ligarem atravs dos
ramais individuais, pois alm de todas aquelas caractersticas desfavorveis
(principalmente a questo dos desnveis), as instalaes sanitrias de
praticamente todas as casas estavam situadas em seus fundos, tornando
impossvel, na prtica, o rompimento dos pisos para a travessia das
canalizaes em direo s ruas.
Estava aberto, dessa forma, o caminho para o primeiro teste do novel
modelo, contando com dois apoios fundamentais nesta direo: o de Josem
de Azevedo, presidente da CAERN, e o de Duncan Mara, consultor do Banco
Mundial, financiador do projeto. Apesar do inusitado desse caminho, para
a poca, ele se imps muito mais pela evidncia apontada pela realidade
local, do que por uma caprichosa inveno tcnica. Com efeito, estava vista
que a forma mais racional e, possivelmente nica, em termos prticos, de
coletar os esgotos de cada casa, dependeria de uma canalizao receptora
meticulosamente localizada dentro dos lotes e atendendo a duas condies
bsicas: passar nos pontos mais adequados para os desges de cada casa
e driblar da melhor forma os obstculos existentes, para minimizar a
quebradeira de pisos. O complemento tambm evidente era o de que isso
somente poderia ser feito com a concordncia claro que plena e irrestrita
da populao residente, e da a sua incluso, no apenas como partcipe do
processo, mas como sua decisora (certamente que pela primeira vez no Pas!).
Exerccios, portanto, das idias-fora de adequao realidade (a melhor
soluo tcnica) e de participao comunitria (a simples concordncia
resolvendo o problema e economizando investimentos). Mas a criatividade
149

Empreendimentos condominiais de esgotos no Brasil

tcnica, a inveno propriamente dita, ficaria com a definio da quadra


- o condomnio - como unidade de resoluo, decorrncia do seu timo
tamanho em face das duas necessidades em jogo: no plano fsico, a coleta
atravs dos ramais condominiais; no plano social, a busca da adeso atravs
do processo coletivo de mobilizao.
Dessa forma, a soluo tcnica representada por um ramal intramuros,
nunca vista porque pioneira, driblando obstculos, mas tambm tendo
que romper muitos pisos das casas no seu percurso, levou necessidade da
150

Figura 44
Fotos da poca, revelando a precariedade
das casas: na primeira,
instalaes sanitrias no quintal; na
segunda, a lavagem de roupas na rua,
coletivamente, para evitar o acmulo de
gua nos quintais afundados; na ltima,o
piso, de to rebaixado, obriga a retirada
manual das guas servidas para a rua

Sistema Condominial

Algumas das idias-fora do sistema


condominial foram testadas com
muito proveito e consolidadas,
em Rocas e Santos Reis, a partir
daquele compromisso fundamental
com o atendimento pleno: o denodo
com que, obstinadamente, se
partiu para uma obra que parecia
impossvel. Em seguida, pelo esforo
de sua adequao realidade local,
nem que isso constitusse algo at
ento inusitado; o extraordinrio,
inclusive porque pioneiro, esforo
de mobilizao social atravs das
reunies condominiais realizadas
exclusivamente por engenheiros;
e ainda o gradualismo adotado em
certas situaes, das quais duas
merecem citao: i) a transformao
de uma verba destinada
construo de banheiros para
apenas uma parte dos moradores,
em vasos sanitrios para todos
que no os tivessem e para o
assentamento de peas hidrulicas
adquiridas pelos moradores na
ocasio das obras, como um
embrio das futuras instalaes;
ii) o exemplo da casa quase
subterrnea que no podendo ser
ligada ao sistema, teve nela deixada
uma caixa receptora 1 metro acima
de sua soleira, para o emboque
manual de guas servidas - visto
como um passo importantssimo
no saneamento e no bem-estar dos
moradores que, antes, esvaziavam
com o balde transportado at a rua,
RVHXHQWHVDFXPXODGRVQRTXLQWDO
$JXUDDGLDQWHpDOXVLYDDLVWR
27

Seria injusto, a esse respeito, no referir


aes de instituies (j extintas) como a
Fundao SESP e o DNERU, por exemplo,
no interior das casas e levando saneamento e
alguma educao sanitria, mas num processo
diferente, assistencial, casa a casa, outra
coisa que no a mobilizao social de forma
sistematizada, introduzida pelos sistemas
condominiais e com um ntido cunho poltico
o sistema de esgotos como um direito!

28

A adeso ocorreu em cima de dois


compromissos : i) todo mundo deixa passar
o ramal no ponto mais conveniente do seu
quintal, participa da escolha do local da caixa
de sua casa, aceita manter e conservar o
seu trecho e se dispe a pagar a tarifa que
no excederia metade daquela do servio
de gua; e ii) a CAERN constri tudo e
reconstri o que tiver que ser quebrado....

consulta populao. Esta, tanto quanto o ramal, tambm se tornara bvia,


afinal no seria possvel uma tal obra dentro das casas sem o mais expresso
consentimento de seus moradores. Impunha-se, assim, a reunio na quadra
a primeira vez que uma empresa de saneamento debatia com o povo 27 o
seu problema e com ele pactuava uma soluo. Nasciam com este ramal a
reunio de quadra, o termo de adeso e, logo em seguida, o nome do novo
modelo: sistema condominial, seus condomnios e seus ramais condominiais
(por analogia, como visto no Caderno 1, aos edifcios de apartamento, com
os seus condomnios formais e estruturas verticais; agora, os condomnios
informais, as estruturas horizontais o prdio deitado...). Testadas e
aprovadas tambm saam da as idias bsicas da adequao realidade, da
participao comunitria e do gradualismo, conforme est mais enfatizado
no quadro aqui destacado.
Se esse pequeno bairro viria a ser a primeira experincia efetiva com os
sistemas condominiais, a sua quadra 90 foi a quadra-piloto da experinciapiloto... Com efeito, ela que j havia gerado o primeiro projeto (conforme a
figura 45), primeira reunio, primeiro sndico, primeiro termo de adeso e
primeira construo de ramal condominial, levou a teste, durante um ano,
a primeira operao dessa inveno. Com uma fossa sptica recebendo seus
efluentes em carter provisrio, esse ramal funcionou perfeio, passando
por uma nica obstruo (resolvida pelos prprios moradores), a quem
se entregou, na inaugurao, um arame para estas operaes e que tambm
se tornaria, no bairro, smbolo do condomnio formado. Interessante o
registro das preocupaes diuturnas, do estado de tenso, mesmo, da equipe
encarregada dos trabalhos, traduzida por observaes do local e entrevistas
permanentes com os usurios-cobaias. Nesse mesmo ano, a centena de
quadras do bairro submeteu-se ao mesmo processo participativo, s que,
desta feita com maiores facilidades, porque havia uma demonstrao ao
vivo e em verdadeira grandeza.
A extenso do sistema a todo o bairro caminhou regularmente, com algumas
indecises em certas quadras, mas sem nenhuma defeco ao final, e
obedecendo a uma sui generis ordem na construo: a prpria ordem em que
os termos de adeso eram entregues, procedimento que criou uma saudvel
disputa entre os comunitrios.
Os procedimentos de projeto e de construo foram de mais difcil
aprendizado do que os de mobilizao comunitria. Neste, prevalecia
o vigor nos esclarecimentos da soluo (quando flua normalmente a
compreenso e aceitao da populao) e cuidados que no deixariam de
estar presentes na maioria dos processos do gnero: uma maquete (que
caprichosamente reproduzia a quadra 90), o rodzio nas duplas de tcnicos na
realizao das reunies (para manter o discurso), a lista de presena, a eleio
do sndico, o termo de adeso 28... Naqueles, a demora em perceber que o
nvel de mangueira se prestava melhor que o equipamento regulamentar
para medir as declividades em locais to apertados, os extremos cuidados
na entrada de cada casa, os trabalhos exclusivamente manuais, as caixas
construdas in loco (alvenaria de tijolos), os tubos cermicos de 100 mm,
151

Empreendimentos condominiais de esgotos no Brasil

Figura 45
A quadra-piloto e o seu pioneiro ramal
intramuros
Fonte: CAERN

29

a mais que perfeita reposio dos pavimentos internos quebrados . A


inusitada obra, ao seu final, alcanou o efetivo atendimento de 98% da
populao, mudou por inteiro a feio do bairro pela eliminao das
poas de esgotos, conforme o demonstra a figura 46, atraiu a ateno do
Saneamento Nacional e conquistou do Governo outras obras de infraestrutura. A vista area mostrada na figura 47 recente e revela a renovada
face das Rocas. O sucesso alcanado por Rocas e Santos Reis, com os seus
ramais condominiais internos superando as condies mais desfavorveis
possveis, trouxe equipe e seus decisores uma sensao de que o mais
difcil havia passado e daqui por diante tudo seria mais fcil. E, de certo
modo, assim foi.
29

Desde este empreendimento e em todos


os outros realizados, a eterna suspeita dos
XVXiULRVFRPDLQVXFLrQFLDGRVWXERVGH
100 mm, compreendida pelos tcnicos,
GHVGHDRULJHPFRPRGHFRUUrQFLDGRV
grandes dimetros da drenagem de guas
pluviais que, antes da chegada do sistema
separador, o inevitvel receptor dos
esgotos.

152

Sistema Condominial

Figura 46
As fotos antes e depois das obras evidenciando o sucesso da soluo: acima, um quintal; na faixa intermediria, uma rua; na de baixo, aquela
casa rebaixada melhorando a disposio de suas guas servidas, numa caixa pertencente ao ramal, embora elevada. Fonte: CAERN

153

Empreendimentos condominiais de esgotos no Brasil

Figura 47
Vista area das Rocas, hoje: melhor
urbanizao,melhores casas e a mesma
densidade da ocupao

154

Sistema Condominial

12.2 A VILA CNEGO MONTE, EM SANTA CRUZ


Em 1981, quando o sistema Rocas e Santos Reis ainda era apenas uma idia,
foi construdo, pela Companhia de Habitao do Estado (COHAB-RN), o
Conjunto Residencial Cnego Monte, na cidade de Santa Cruz, no Serto
do Estado, com 800 casas populares, dispostas em vrias quadras iguais,
num terreno rochoso e de topografia moderadamente acidentada. Este autor
foi, ento, instado a elaborar um projeto de sistema condominial para esse
conjunto, o qual teve todos os seus ramais condominiais internos ao lote,
conforme a figura 48 de uma quadra tpica, e contou com trs unidades
de tratamento que combinavam tanques spticos e lagoas de estabilizao,
alimentados sem qualquer estao elevatria 30. Curiosamente o citado
conjunto j dispunha de estudos realizados para soluo do seu problema de
esgotos atravs de fossas spticas e sumidouros (que de resto no haveriam
de funcionar em funo da natureza impermevel do local) e de um sistema
convencional com tratamento centralizado. Oradas em UPC unidade
monetria utilizada poca pelo Banco Nacional de Habitao, BNH as
trs alternativas foram muito discrepantes nos seus custos: 145 UPC/casa
para o convencional, 30 para as fossas e 20 para o modelo condominial.
No apenas foi este ltimo o adotado, como se tornou o modelo
condominial, da por diante, a soluo padro para as vilas construdas no
Estado, todas com o mesmo tipo de ramal e a mesma natureza de tratamento.
A falta da participao comunitria durante o processo de implantao desses
sistemas, que seria to importante em presena de ramais condominiais
internos a serem operados pelos usurios, passou a ser compensada ou
pelo menos mitigada por um interessante processo informativo que era
levado a cabo pela equipe condominial da CAERN. Em cada conjunto com
esta soluo uma de suas quadras permanecia com as suas valas abertas
exibindo os ramais condominiais e suas caixas de inspeo para que os novos
moradores, convocados por grupos e em dias determinados, ouvissem as
explicaes cabveis e apreciassem ao vivo a composio do sistema que
lhes era oferecido. A figura 49 ilustrativa desse procedimento.
Dois anos aps a implantao do Conjunto Cnego Monte, a CAERN
realizou uma pesquisa de avaliao do seu comportamento, havendo
concludo que apesar da operao espontnea dos ramais pelos usurios
rede e tratamento continuavam sem manuteno oficial o sistema tem
funcionado satisfatoriamente, bem aceito pela populao que se diz muito
satisfeita com o mesmo....

30

O engenheiro Ccero Onofre de andrade


Neto foi um baluarte na implantao desse
sistema: acompanhando suas obras e
criando uma sistemtica, para isto, que
seria sempre adotada e projetando um
SURFHVVDPHQWRQDOGHVFHQWUDOL]DGRSDUDRV
HXHQWHV

155

Empreendimentos condominiais de esgotos no Brasil

Figura 48
Uma quadra tpica de Santa Cruz e o seu tambm tpico ramal de fundo de lote
Fonte: CAERN

12.3 AS CIDADES DO INTERIOR DO ESTADO


As experincias anteriores credenciaram bastante a CAERN no cenrio
nacional e despertaram a ateno do BNH, que na ocasio era o rgo
mximo do saneamento nacional no estabelecimento de polticas e no
financiamento de obras. E ele veio a financiar uma pesquisa no Estado,
abordando a cidade como um todo e partindo das experincias vitoriosas
com a descoberta dos ramais condominiais advindos do esforo de
156

Figura 49
O processo informativo onde no era
possvel a participao durante as obras:
antes, na observao de uma vala aberta e,
em seguida, numa reunio
Fonte: CAERN

Sistema Condominial

Todas as necessidades vitais do


homem, como o servio de esgotos,
esto sendo supridas a cada
momento, mesmo que os rgos
RFLDLVTXHWHQKDPWDLVREULJDo}HV
no se faam presentes. Nestes
casos, ento, as prprias pessoas
menos ou mais organizadas, menos
ou mais apoiadas por estruturas
institucionais realizam o autosuprimento, numa forma que
menos ou mais satisfatria em
funo dos conhecimentos tcnicos
e recursos materiais utilizados.
Mas sempre representando um
GLVSrQGLRSDUDDSRSXODomR
diuturnamente - ora um esforo
fsico, ora um gasto de dinheiro, ora
uma perda de vitalidade ou sade.
Quando bem se possa conhecer
essas formas espontneas de autoservio, bem se poder critic-las e
entender o que delas estaria e no
estaria numa direo correta e bem
se poder imaginar formas criativas
de melhor aproveitar aqueles
GLVSrQGLRVQDFRQVWUXomRGHDOJR
correto e at ideal, mesmo que a
ser alcanado gradualmente.

adequao realidade e a comprovao da participao comunitria como


fora viva na dotao de sistemas de interesse da populao.
Para que se alcanasse uma razovel representao da cidade potiguar
de determinado padro - ou nordestina ou brasileira foram eleitas trs
cidades do Interior do Estado, de distintas reas fisiogrficas e diferentes
tamanhos, respectivamente Parnamirim (na Regio Metropolitana do
Natal), Goianinha (na Zona da Mata) e Currais Novos (no Serto do
Serid). Os recursos alocados eram suficientes apenas para estudos, alguma
mobilizao social e pequenos experimentos-piloto. Os objetivos, agora,
eram principalmente, os de equacionar uma soluo para cada uma das
cidades como um todo, na perspectiva de que trs diferentes universos como
os aqui arrolados pudessem conferir certa generalidade s concepes. Aos
esforos j testados e aprovados nas experincias anteriores se acrescentariam
outros, agora, como os da incluso das estruturas municipais no processo,
os de racionalizao da relao esgotos - meio ambiente produo, os
de integrao de aes, e, principalmente, o exerccio do gradualismo na
dotao dos sistemas.
A respeito desta ltima idia, o fundamento era o de que a compreenso dos
sistemas existentes de esgotos, espontneos, a apropriao dos esforos locais
na sua construo (comunidades e municipalidades) e o redirecionamento
tcnico do que estivesse numa direo incorreta, pudesse sugerir uma
evoluo progressiva a partir do estado atual e at o alcance da soluo ideal
adequada para cada cidade. Tratava-se assim, de uma pesquisa para servir
diretamente s cidades, e que abria CAERN um extraordinrio campo de
aperfeioamento de suas pesquisas com o novo sistema.
E sob esses ngulos de observao os resultados alcanados, salvo melhor
juzo, foram bastante interessantes.
Em Goianinha, por exemplo, na poca com 5.000 habitantes, encravada
numa zona canavieira extremamente mida, o sistema de esgotos era
um arremedo de sistema unitrio, juntando todas as guas atravs de
canaletas a cu aberto seguidas por tubulaes enterradas; as primeiras
sob a responsabilidade do povo, as ltimas, da municipalidade. Os efluentes,
quanto mais canalizados, mais rpido chegavam ao riacho Brando, dreno
natural da cidade e que se transformou progressivamente na sua grande
cloaca; a exemplo do que acontece com quase todos os cursos dgua urbanos
do Brasil, deixou de ser vivo e atraente, para ser morto e repelido.
Na falta de recursos financeiros para uma soluo definitiva, a comunidade,
a prefeitura e a grande empresa do Municpio (uma usina de acar)
concordaram com uma soluo gradual para a destinao dos esgotos: a
criao de um lagoo no trecho mais urbano daquele riacho (na seca,
j mais esgotos do que gua) passando-lhe de 1 metro de largura para 8
metros, de imediato, e ao longo de 400 m onde a sua profundidade tambm
seria ampliada para 1 m. Se no uma legtima lagoa de estabilizao, algo
bastante melhor do que o que ali se encontrava, melhorando-se, portanto,
157

Empreendimentos condominiais de esgotos no Brasil

as condies sanitrias da cidade e do seu efluente, e incorporando


paisagem uma interessante rea de lazer, passvel de constituir o que de
mais interessante viesse a existir, a esse respeito, na cidade 31. O terreno desse
empreendimento foi cedido pelo seu proprietrio (com ganhos evidentes
para as suas reas remanescentes) e as mquinas que o executaram foram
cedidas pelo grande empresrio antes referido. O processo condominial foi
exercitado e bem sucedido na rea onde veio a ser realizada a experinciapiloto, os ramais foram nos fundos dos lotes e algumas constataes foram
observadas simplificando o sistema espontneo: simples valetas a cu aberto
atravessando quintais (curiosos embries dos condominiais) e canalizaes
de porte atravessando lotes particulares quando estes continham os talvegues
naturais, conforme evidencia a figura 50, da poca.

As tarifas do sistema condominial


foram estudadas com base na
comparao de custos, possvel
poca, entre o antigo sistema
praticado no Estado, o chamado
convencional, e o novo sistema
condominial, disto resultando,
e sendo informalmente aceito
pela direo da empresa, o uso
de um redutor sobre as contas
de gua para o novo sistema de
valor igual a 0,4. A despeito dessa
aceitao tcita, demorou mais de
um ano para que as novas tarifas
fossem efetivamente aplicadas...
ou, melhor dizendo, vencessem
a inrcia. At que em memorvel
reunio pblica na cidade de
Goianinha, informal mas legtima
(o que equivaleria, quase, s
DXGLrQFLDVS~EOLFDVGHKRMH HVWH
valor foi anunciado e aplaudido
pelos presentes, para dias depois
vir a ser formalizado pela empresa.

Parnamirim, cuja sede municipal tinha poca uma populao de 15.000


habitantes, estava toda ela assentada em uma plancie sedimentar, e sua
urbanizao, alinhada e aprazvel, era influenciada pela forte presena militar
na cidade, com as suas organizadas vilas que tiveram origem na segunda
guerra mundial, quando a cidade constituiu uma base americana de apoio.
O sistema de esgotos era constitudo por fossas e sumidouros que atingiam
praticamente todas as casas e conferiam um ambiente de salubridade ao
meio urbano 32. Aos olhos da populao, portanto, os esgotos sanitrios
no constituam problema para o seu bem-estar, salvo em reas perifricas
onde o menor nvel de renda impedia a melhor construo de fossas e
principalmente de sumidouros, de sorte que nessas reas eram visveis as
valas negras.
Esta condio urbana favorvel e, talvez, um menor interesse da sua
municipalidade fizeram de Parnamirim uma exceo no universo at ento
percorrido dos que ansiavam por solues para o problema do esgotamento
sanitrio. Ainda assim duas ou trs quadras, dentre as crticas da cidade,
chegaram a ser mobilizadas para uma soluo que parecia adequada s
condies locais. Eram os ramais condominiais acoplados a fossas tambm
condominiais, dispostas nas caladas das casas e com seus sumidouros, to
superficiais quanto possvel, irrigando jardins a serem dispostos nos passeios.
Imaginava-se a reduo da infiltrao perniciosa como uma etapa inicial da
soluo e, associadamente a esse benefcio, a beleza dos jardins oferecidos
cidade.
Finalmente, a cidade sertaneja de Currais Novos, o mais interessante
sistema existente, o mais prximo daquele que em condies adequadas
seria o sistema ideal. Situada no Serto, naturalmente carente da gua e da
matria orgnica que h nos esgotos, da mesma forma que haveria de desejar
espelhos dgua e reas verdes, como amenizadores do seu clima quente e de
sua paisagem rida. Na sua conformao a cidade um morro muito regular,
um cuscuz como se diz no Nordeste, todo ele rocha aflorante, e sua volta
os rios locais, s que quase sempre secos.
As observaes realizadas poca procura do seu sistema existente
revelaram, na prtica, um sistema separador absoluto, at que parecido com o
158

31

Durante a poca chuvosa, evidentemente,


essa lagoa entraria em disfuno, mas
haveria a compensao da diluio
GRVHXHQWHVWDPEpPKDYHULDGHVHU
desarranjada, impondo-se sua restaurao
para o perodo seco seguinte.
32

Salubridade que ocorria em detrimento da


potencial poluio do aqfero subjacente
cidade e que ainda hoje a atende, a despeito
GDHYLGrQFLDGHVXDFRQWDPLQDomR

Sistema Condominial

Figura 50
Os sistemas espontneos, em Goianinha, e a
sua facilidade de negociar espaos privados:
ora para valetas a cu aberto bastante
precrias, ora para uma canaleta-tronco,
mais protegida
Fonte: CAERN

33

Evidente que a equipe da CAERN no foi


convencida da dispensa dessas unidades
num sistema de esgotos, mas tambm no
deixou de conjecturar sobre a quantidade
desses poos (e seus custos) espalhados
pelas cidades do mundo inteiro e que nunca
foram sequer acionados...

nascente modelo condominial e, se no uma unidade de tratamento dos seus


efluentes, mas com certeza o seu reaproveitamento.
A coleta abrangia metade de sua populao de 30.000 habitantes e tinha
caractersticas sui generis, pela sua capacidade de respeitar o meio fsico,
evitando todo tipo de escavao. As tubulaes, cermicas e de fabricao
caseira at os 150 mm, e de concreto da por diante, eram tarefas da
populao nas proximidades das casas e nos menores dimetros, e de
responsabilidade da municipalidade, nas ruas e at o seu afastamento das
reas urbanas; os reaproveitamentos ficavam com a iniciativa privada.
As canalizaes coletoras tinham vrias caractersticas comuns: passar por
onde fosse mais fcil, fugindo das escavaes (todos abriam mo de seus
espaos particulares para que isso fosse possvel); valer-se das declividades
naturais, por sinal muito favorveis; embutir-se em caladas para protegerse do trnsito de veculos; dispensar os poos de visita (primeiro pelo
seu desconhecimento, e depois, por julg-los desnecessrios), j que as
desobstrues eram facilmente realizadas pela simples quebra (e posterior
reparao) da canalizao nos pontos acidentados 33. Foi um pulo, como
se diz vulgarmente, da para a sistematizao da coleta condominial, com
seus ramais intramuros e sua rede bsica, caixas de inspeo e quase nenhum
poo de visita; com a participao da comunidade e de sua prefeitura, a esta
poca com um prefeito, Sr. Jos Dantas, fcil para se empolgar.
O reaproveitamento, por seu turno, era o bvio: a irrigao do pasto para
alimentao do gado dos proprietrios rurais localizados nas aluvies secas
dos rios que margeiam a cidade e que so seus receptores naturais, conforme
as fotos da poca, postas na figura 51. Mais uma vez estava desenhada a
soluo do futuro: as lagoas de estabilizao volta da cidade em nmero
que dispensasse a necessidade de estaes elevatrias numa fase inicial, e
159

Empreendimentos condominiais de esgotos no Brasil

o reuso ento aperfeioado dos efluentes agora tratados. Uma melhora


considervel em relao ao estado anterior, para o homem, para o gado, para
o meio ambiente... E outro interessante negcio mais uma vez presente: a
cesso das reas para o tratamento, sem nus para a CAERN, e em troca
dos efluentes.
Com as experincias at ento desenvolvidas e que foram tendo seguimento
inclusive noutras cidades, sobretudo aquelas para as quais se dispunha de
recursos para sistemas de esgotos; com a adeso de prefeitos que sequer
demandavam recursos financeiros da CAERN, mas to-somente a sua
assistncia tcnica; com o crescimento do reconhecimento nacional pelos
servios desenvolvidos pela CAERN, era chegado o momento de uma maior
ousadia: o esforo de construo do que poderia vir a ser um Programa
Estadual de Esgotamento Sanitrio. Ele se lastreava nas idias ento
consolidadas em torno do modelo condominial, na conduo dos processos
a nvel local pelos prefeitos, na participao das comunidades e na assistncia
tcnica e alocao de potenciais recursos financeiros pela CAERN e pelo
Governo do Estado.
O citado programa se voltava para as municipalidades e o acesso a ele seria
obtido por concurso entre os prefeitos, no atendimento, mais, melhor e
mais rpido de regras to simples como as seguintes:
t PQSPHSBNBTFEFTUJOBWBJNQMBOUBPEFTJTUFNBTEFFTHPUPT
sanitrios nas cidades do Rio Grande do Norte, segundo o modelo
condominial;
t BTNVOJDJQBMJEBEFT DPOKVOUBNFOUFDPNBTTVBTDPNVOJEBEFT 
realizariam a implantao e a operao dos ramais condominiais, sob
o regime da participao destas nas decises e nas aes;
t TNVOJDJQBMJEBEFTDPNQFUJSJB BJOEBBNPCJMJ[BPDPNVOJUSJB 
a viabilizao, sem nus para a CAERN, de todos os terrenos
necessrios s unidades de tratamento e de elevao mecnica dos
sistemas e, a depender do interesse de cada uma, a execuo das
redes bsicas, mediante convnio com a CAERN que garantisse
a elaborao de projetos, assistncia tcnica e fornecimento de
tubulaes;
t B$"&3/ OBMNFOUF BTTVNJSJBBSFTQPOTBCJMJEBEFQFMBJNQMBOUBP
das unidades de tratamento numa forma gradual (e, eventualmente,
implantao das redes), e pela operao, manuteno e cobrana pela
prestao dos servios.
Observe-se que um programa como este eliminaria a disseminao de
sistemas de drenagem para uso, tambm, para coleta de esgotos, e constituiria
substancial ajuda CAERN para o mais rpido alcance do atendimento pleno
da populao urbana do Estado.

160

Sistema Condominial

Figura 51
Flagrantes de duas reas de irrigao de
SDVWRVFRPHXHQWHVGHHVJRWRVQDFLGDGH
de Currais Novos - uma ao de elevado
risco, porm sinalizando uma correta soluo
para o futuro
Fonte: CAERN

12.4 UMA VISO PANORMICA (E CRTICA) DOS


SISTEMAS CONDOMINIAIS NO ESTADO
Os relatos anteriores, neste captulo, reconstituindo o desenvolvimento
dos sistemas condominiais no Rio Grande do Norte, so de situaes
vivenciadas h pelo menos 25 anos. Interessa bastante, portanto, que agora
se consiga traar uma viso panormica sobre a situao atual desse modelo,
no Estado, seja no que tange ao que foi realizado naquela poca, seja no
que teria sido continuidade queles empreendimentos. Para que isso fosse
possvel, o autor visitou a CAERN e l entrevistou alguns funcionrios que
hoje lidam com a operao dos sistemas, colheu informes mais numricos
sobre eles e finalmente ouviu alguns dos membros daquela equipe dos
primeiros tempos. Em funo do curto espao de tempo dedicado ao
assunto, as impresses obtidas no so definitivas, mas oferecem uma viso
panormica da condio atual. Uma deciso recente da direo daquela
empresa, posterior, inclusive, visita realizada, se mostra bastante auspiciosa
quanto ao aprofundamento dos conhecimentos sobre o modelo condominial:
foi a criao de um grupo de trabalho voltado para a anlise da questo
e proposies a respeito de medidas e procedimentos sobre os trabalhos
futuros da empresa no campo do esgotamento sanitrio. Talvez, quem sabe,
no venha o relatrio final desse grupo constituir mais um caderno dos
sistemas condominiais.
Primeiramente, ento, conheam-se os nmeros do atendimento atual,
significativamente favorveis aos condominiais, sobretudo quando se fica
sabendo que desde aqueles primrdios foram muito poucas as intervenes que
fugiram da sua concepo. Em maro de 2007 eram 137.000 as economias do
Estado atendidas por sistemas de esgotos, que correspondiam a uma populao
da ordem de 700.000 habitantes, sendo 61% desse total na Capital do Estado e
os restantes 39 % nas cidades do interior. Desdobrando a informao segundo
a natureza dos sistemas, pode-se constatar que o modelo condominial j era
majoritrio no Estado, com 54 % daquele total, principalmente, no interior
do Estado, quando as 44.500 economias por ele servidas so mais de 4 vezes
superiores quelas do sistema convencional.

161

Empreendimentos condominiais de esgotos no Brasil

A tabela 3, adiante apresentada, resume esta situao mais geral.


Os fatos curiosos nesse atendimento pelo sistema condominial, na Capital
e no interior, so, sucessiva e cumulativamente, os seguintes: todas as suas
ligaes esto realizadas por ramais condominiais internos aos lotes
(como se esta fora e como de fato tem sido no Estado, a alternativa nica); a
partir de 1996, com a disperso da equipe at ento voltada para as atividades
tipicamente condominiais, no mais foram realizados os trabalhos de
mobilizao comunitria, e, apesar disso, os ramais internos continuaram
a ser os nicos realizados; em todas as pocas de construo dos sistemas
condominiais, no h registro de defeces no atendimento por conta da
oferta dessa nica alternativa.
Nessas circunstncias, parecem cabveis duas questes para a CAERN: uma
sugesto, no sentido de que cogite da ampliao do leque de opes para
os ramais condominiais e uma indagao sobre o porqu (por parte da
populao) da tcita aceitao da alternativa nica. Estaria ela aculturada?
Como teriam procedido os executores no momento da obra? Somente
surgiram quadras onde este tipo de ramal parecia o mais indicado? O atrativo
da menor tarifa?
Pormenorizando a situao nas cidades do interior do Estado, no que tange
aos sistemas condominiais, so atualmente 37 as cidades que possuem
esse sistema e so operadas pela CAERN, das quais pelo menos 11 esto
com o atendimento quase universalizado 34. Este nmero aumenta mais
uma dezena, pelo menos, quando se consideram as cidades operadas pelas
municipalidades. A respeito das trs cidades que foram objeto, mais atrs,
de consideraes especficas, interessante constatar que os seus servios
seguiram os prognsticos iniciais: Parnamirim, apenas 47 ligaes, pela
forte presena das fossas; Goianinha, fragilidade social, 676 ligaes; Currais
Novos, chegando universalizao.
No aspecto operacional, no desempenho propriamente dito dos servios,
parece no haver dvidas de que no foi nada significativa a transio
da fase de implantao dos sistemas onde todos os compromissos
so firmados para esta de operao, quando os compromissos
haveriam de ser eternamente cumpridos. So agravantes nesta ausncia
de transio a distino absoluta das equipes de cada uma das duas
fases e o desconhecimento, pelos que fazem parte da operao, do como
teriam caminhado os novos sistemas. Esta questo parece ter refletido
diferentemente nas cidades do interior do Estado e na sua Capital, por razes
que tm a ver, por certo, com as dimenses e a cultura em jogo 35.
Com efeito, em Natal, ao que tudo indica, foi sendo rompido
progressivamente o acerto para a manuteno dos ramais condominiais
pelos usurios. Hoje uma considervel parte dos problemas ocorrentes
tem seus reparos solicitados CAERN e por ela vm sendo atendidos,
atitude que, assim passivamente, anima a continuidade da transferncia
de responsabilidades, mais ainda quando j no existe o processo de
pactuao durante a implantao. Por outro lado, na absoro dessa tarefa
pelas equipes operacionais da empresa situao que apontada como
catica no estaria havendo um tratamento adequado s ocorrncias,
162

34

Macaba, Caiara do Rio dos Ventos,


So Paulo do Potengi, Lajes*, Riachuelo,
So Tom*, Mossor, Caic, So Jos do
Serid*, Parelhas*, Santana do Serid,
Currais Novos*, Acari*, Lagoa Nova*,
Flornia*, Jucurutu, So Jos do Mipibu,
Goianinha, Pipa, Monte Alegre, Parnamirim,
Pedro Velho, Santo Antonio, Esprito Santo,
Tangar, So Bento do Trairi, Campo
Redondo, Dr. Severino, Jos da Penha,
Lucrcia*, Antonio Martins, Alto Rodrigues,
Carabas, So Rafael*, Afonso Bezerra*,
Pedro Avelino e Macau. As assinaladas so
as que esto prximas da universalizao.

35

Quanto maiores as cidades parecem


menores as relaes de vizinhana, menor o
HVStULWRFRRSHUDWLYRPDLRUHVDVH[LJrQFLDV
em relao ao sistema institucional.

Sistema Condominial

Tabela 3
Economias atendidas, segundo a natureza
dos sistemas

dado que so comuns os relatos de reparos realizados (e muitas vezes


repetidos) em situaes que mereceriam intervenes radicais de
alterao do prprio ramal 36.
No interior do Estado, bem ao contrrio, conforme relato de um dos
responsveis pela operao, a manuteno dos ramais condominiais teria
encontrado um modus operandi bastante interessante e que tem resolvido
os problemas. o que rene esperteza, um pouco de subverso da ordem e
competncia tcnica, j que consiste para aqueles usurios que no desejam
meter a mo na massa na contratao dos operadores da prpria empresa,
particularmente, para a resoluo do problema, por certo que nos seus
perodos ociosos e mediante uma justa remunerao.
Um ltimo comentrio, ainda, h de ser sobre a problemtica institucional
dos sistemas condominiais na CAERN e no Rio Grande do Norte, que
advm dos primrdios da formao da sua equipe bsica e do prprio
desenvolvimento inicial do modelo. O confinamento dessa equipe e sua
superproteo em relao ao que seriam a cultura e o conservadorismo da
empresa, hoje talvez se possa ver melhor, ofereceram resultados nos dois
lados da mesma moeda. De bom, a tranqilidade e o conforto assegurados
para a melhor produo tcnico-cientfica na ocasio. De ruim, a falta
de percepo da regular e competente operao como requisito maior de
todo e qualquer sistema pblico ou, ainda melhor, o sistema precisando
ser visto como eterno a partir de sua operao. A preparao de quem a
assuma , portanto, no apenas fundamental como imprescindvel. Com
o desmanche da Gerncia de Pesquisa e Desenvolvimento da CAERN, na
realidade o reduto dos sistemas condominiais, estes ficaram por conta da
inrcia acumulada nos tempos de sua criao. E estagnaram.

36

Em Rocas e Santos Reis esto exemplos


tpicos desses casos, como a constatao de
caixas de inspeo internas, que esto hoje
DSURIXQGLGDGHVLQRSHUiYHLV FRQVHTrQFLD
do aterro de quintais) e que ainda assim
no determinaram o exame do prprio
ramal; ou as mesmas caixas em estado de
decomposio (natural, aos 25 anos de uso
e construo em alvenaria de tijolos) e que
apenas so reconstrudas; ou trechos longos
de ramal que esto abaixo de construes
posteriores sua implantao, e que assim
permanecem.

163

Empreendimentos condominiais de esgotos no Brasil

13. PETROLINA
13.1 A CIDADE E SUAS CIRCUNSTNCIAS
Petrolina, em Pernambuco, est situada na regio do Sub-mdio So
Francisco, no Serto, na margem esquerda deste rio, numa altitude de 377
metros e distante 788 km a oeste do Recife. A aridez do clima a marca
principal da regio e pode ser avaliada pela mdia anual de precipitaes
pluviomtricas, inferior aos 400 mm. Graas ao Grande Rio, contudo, e
irrigao dele decorrente, notvel o seu crescimento econmico, o maior
de toda a Regio, e que tem seu esteio nos 70.000 hectares de fruticultura
suficientes para conferir ao Municpio, juntamente com o seu vizinho
Juazeiro, na Bahia, a liderana nacional na produo e exportao de frutas.
Esta rea tem estado permanentemente em expanso, e poder alcanar os
200.000 hectares que perfazem a potencialidade local em solos compatveis
com esta atividade.
O seu extraordinrio crescimento demogrfico um evidente corolrio
dessa fora econmica, tendo evoludo desde um pequeno contingente
de 4.500 pessoas, em 1940, at uma populao atual superior a 270.000
pessoas.
grande o seu poderio poltico, no contexto do Estado de Pernambuco,
historicamente marcado pela hegemonia da famlia Coelho, e agora
por uma expressiva luta poltica entre os dois lados antagnicos da vida
partidria. Isto no apenas impulsionou sua economia como tambm
assegurou um equilibrado desenvolvimento urbano, com a presena de uma
razovel infra-estrutura na cidade que tem acompanhado o seu crescimento
demogrfico e a ausncia de favelas, embora tenha muitos assentamentos
pobres. Nesse contexto, devem ser citados no apenas os seus bons servios
de natureza urbana como os sistemas virio, de abastecimento dgua,
esgotamento sanitrio e limpeza pblica, como tambm a presena de
considerveis obras da infra-estrutura econmica: um porto fluvial, um
aeroporto internacional, uma universidade, importantes estradas e uma
ponte sobre o So Francisco.
No incio dos trabalhos aqui relatados, 1982/83, a cidade tinha 100.000
habitantes e dispunha de um moderno sistema de abastecimento de gua
operado pela COMPESA 37 e atendendo a 90% de sua populao, de uma
extensiva coleta de lixo, mas com lanamento em lixo distante da sua rea
urbana, e de uma incipiente macrodrenagem - galerias de guas pluviais
limitadas sua rea mais central, conectadas a um canal a cu aberto,
verdadeira cloaca 38. Quanto ao esgotamento sanitrio a situao era
bastante precria. Uma rede convencional atendia apenas a cerca de 20%
da populao da cidade e os excludos dessa condio tinham algum tipo
de fossa que, em presena de um solo altamente impermevel, terminavam
por lanar seus efluentes nas poucas galerias ento existentes, nas linhas
dgua das ruas pavimentadas e nas valas negras de ruas sem este benefcio.
O lanamento de todos os efluentes se fazia no So Francisco: os da rede
coletora, diretamente e in natura; os outros, passando antes por verdadeiras
164

37

Companhia Pernambucana de
Saneamento, a estatal que at hoje a
concessionria dos servios de gua e de
esgotos do Municpio.
38

A respeito da drenagem importante


lembrar o regime pluviomtrico da regio,
caracterizado pela pequena precipitao
anual, cerca de 400 mm em mdia, e
sua forte concentrao, o que minimiza a
problemtica das inundaes por guas
pluviais.

Sistema Condominial

lagoas de estabilizao formadas naturalmente em depresses naturais do


terreno, em pleno meio urbano.
Nesse contexto, aquela mesma fonte financiadora do Projeto Rocas e Santos
Reis, antes referido, tambm se fazia presente na Prefeitura de Petrolina,
com uma parte de seus recursos, pequena, destinando-se ao esgotamento
sanitrio. A boa repercusso dos condominiais no Rio Grande do Norte
tornara-se razo para que o autor destes cadernos fosse chamado a
levar aquelas novas idias para esta cidade, agora como consultor de sua
municipalidade. Esta forma viria a ser excepcionalmente favorvel
produo criativa que ali se realizaria.

39

A representao do Ministrio do Interior


responsvel pelo Programa das Cidades de
Porte Mdio.

40

Este momento, alm do mais, permitiria o


exerccio simultneo do novo modelo a partir
de dois distintos mbitos administrativos, que
KDYHULDPGHSURSLFLDUVLJQLFDWLYRVJDQKRV
na construo do processo - um estadual,
com a CAERN, e outro municipal, com a
Prefeitura de Petrolina.

41

No incio, o Ministrio, representado pelo


projeto CPM, e a Prefeitura, combinaram-se
a respeito; em seguida, foi a vez do teste
das idias com alguns condomnios, bem
sucedido; depois, a exposio e discusso
das regras em seo informal da Cmara,
com aprovao unnime; e por ltimo, o
mais difcil entendimento com a COMPESA,
justamente por alterar-lhe o sistema tarifrio
na forma como at hoje est mantido. Esse
evento, pela quantidade de agentes e pelo
inusitado das idias h de ter sido pioneiro
no Pas, e por certo no teria ocorrido no
fora o denodo e a fora poltica local.

As assumir essa nova responsabilidade, a prefeitura j tinha uma viso


bastante crtica a respeito da eventual conduo da questo sanitria da
cidade pela via tradicional, conforme era o projeto disponvel na prestadora
dos servios. Pelos seus altos investimentos e pela prpria realidade da
ocasio, que j evidenciava um flagrante imobilismo, da porque no foi
difcil a deciso de algum sensvel como o prefeito, o mdico Augusto
Coelho, a favor das novidades. Em primeiro lugar, por no haver na
municipalidade um setor especializado na matria e que certamente
seria contrrio mudana para postar-se a favor da segurana; em
seguida, por ouvir as opinies favorveis dos prprios financiadores 39; e,
por fim, por ter ido conhecer, antes, pessoalmente e meticulosamente - o
que se passava no Rio Grande do Norte. Dessa forma, portanto, teve incio a
histria do sistema condominial em Petrolina, a qual viria a ser desdobrada
em sucessivas etapas at o alcance da situao atual, onde o atendimento da
populao um dos maiores do Nordeste 40. As etapas aqui observadas foram
as iniciais, justamente por terem tido a participao direta do autor, tendo
sido marcante, nelas, a mais completa liberdade com que se pode produzir
e criar exercitando a novel metodologia. Condio essa assegurada pelo
entusiasmo e firme deciso do prefeito e pela competncia tcnica e grande
dedicao da equipe criada para esta experincia, frente o engenheiro
Natanael Ramalho. Ela transcorreu ao longo de dois anos, inteiramente
assumida pela municipalidade, centrou-se numa experincia-piloto e nos
seus desdobramentos imediatos e foi regida pelas regras abaixo transcritas,
e que aliaram, alm daquela instncia local, os financiadores, a Cmara de
Vereadores, a COMPESA e, evidentemente, as comunidades que foram sendo
abrangidas 41:
t BTPCSBTTFSJBNUPEBTSFBMJ[BEBTQFMBNVOJDJQBMJEBEF TFOEPRVFos
ramais condominiais, escolhidos pelos respectivos condomnios,
teriam seus custos absorvidos pelos usurios;
t BPQFSBPTFSFBMJ[BSJBQFMB$0.1&4" DPNPTVTVSJPTBCTPSWFOEP
a manuteno dos ramais condominiais internos aos lotes, no que
contariam com o apoio necessrio da prefeitura (orientao tcnica e
resoluo dos casos menos simples);
t BTUBSJGBTTFSJBNDPCSBEBTQFMB$0.1&4" DPNPQFSDFOUVBJTEBT
contas de gua: 40 % de seu valor quando fossem internos os ramais
165

Empreendimentos condominiais de esgotos no Brasil

e 80 % quando dispostos nos passeios, j que nessa posio seriam


necessariamente mantidos pelo prestador do servio;
t FNDBEBVNEPTNJDSPTJTUFNBTDPNBSFEFCTJDBDPOTUSVEB 
a ordem de construo dos ramais condominiais seguiria a
ordem de adeso das quadras, ento associadas a condomnios, e
correspondentes aportes dos valores relativos aos investimentos de
sua responsabilidade.
Sobre essas regras, a bem da verdade, o autor do trabalho no tem at o
momento qualquer reparo a fazer-lhes, de tal modo que podem ser elas
consideradas como exemplares na perspectiva em que se colocou, desde a sua
origem, o modelo condominial. Com efeito, elas constituram uma salutar
aliana entre municpio, prestador de servio e comunidade. Reuniram
o mximo esforo de cada um a favor da soluo e foram indutoras da
166

Figura 52
Vista area da cidade, banhada pelo
Rio So Francisco, denotando a
sua organizao urbana

Sistema Condominial

conscientizao da populao quanto ao uso do servio - quem escolhe o


ramal e arca com o seu investimento com certeza ir melhor conhec-lo e
melhor cuidar dele.

13.2 A EXPERINCIA-PILOTO
Aceitas as idias gerais do novo sistema, o passo seguinte do processo
foi a proposio municipalidade de inici-lo com a realizao de uma
experincia-piloto, assim entendida a implantao da soluo em verdadeira
grandeza, porm numa rea restrita, com objetivos bem definidos: o
seu teste nos aspectos tcnicos e sociais, o seu aprendizado por parte da
municipalidade e a sua divulgao local na busca de um natural efeitodemonstrao. A idia foi aceita de pronto, alm do mais porque esse
procedimento preencheria da melhor forma a utilizao dos limitados
recursos oferecidos pelo financiador para o segmento do saneamento local.
A rea escolhida com esta finalidade, apresentada na figura 53,
justificou-se por reunir uma certa diversidade urbana no seu interior,
bastante representativa da cidade, tais como, por exemplo, a Vila Moc,
um assentamento urbanizado, mas de casas pobres nas suas 25 quadras
e, ao contrrio, o Jardim Paulo Afonso, com as suas 11 quadras ainda em
construo, com edificaes de alto padro construtivo. Alm disso, havia
ainda em sua poro de jusante uma lagoa natural que de antemo foi vista
como passvel de ser transformada numa lagoa facultativa para tratamento
dos esgotos da rea.
Os pontos mais relevantes da cidade e que vieram a instruir as tarefas do
seu plano piloto, alm, evidentemente, dos conceitos e diretrizes do modelo
condominial e das tcnicas usuais da hidrulica e da engenharia sanitria,
foram os seguintes, sados de sua realidade local:
t a aridez climtica, caracterstica fundamental do Serto
Sanfranciscano;
t a limitao dos recursos financeiros ofertados e a deciso
municipal pelo seu emprego o mais til possvel;
t o baixo nvel de renda da populao-alvo a ser atendida num
primeiro momento a Vila Moc;
t BTincipientes instalaes sanitrias das casas pobres a serem
atendidas e a sua localizao majoritria na suas partes de trs,
portanto distantes das ruas;
t Bforte presena de rocha no substrato da rea urbana, o que
impunha fugir-se das escavaes mais profundas;
t Pgrande desejo das comunidades beneficirias quanto
implementao de uma soluo;
t Bocorrncia daquela lagoa natural, na rea, passvel de ser
transformada em lagoa de estabilizao.

167

Empreendimentos condominiais de esgotos no Brasil

A rede bsica dessa experincia no trouxe maiores novidades ao mtodo,


alm do que j havia sido firmado no Rio Grande do Norte, e est ilustrada
na figura 55. Apenas, como no caso, era devida a apresentao de um
documento formal que contemplasse todo o sistema, os estudos a ela
relativos foram chamados de projeto indicativo, com o intuito de diferenci168

Figura 53
9LVWDDpUHDDWXDOGDiUHDGDH[SHULrQFLD
piloto, vendo-se ao fundo a sua lagoa; e em
escala maior, os seus diferenciados bairros,
Jardim Paulo Afonso e suas manses, (foto
2), e a popular Vila Moc (foto 3), agora bem
mais adensados

Sistema Condominial

3DOLDWLYRVFRPRVHXHQWHV

Figura 54
$VGXDViUHDVGLVWLQWDVGDH[SHULrQFLDSLORWRQDVKDELWDo}HVQRQtYHOGHUHQGDQRVUDPDLVFRQGRPLQLDLV

169

Empreendimentos condominiais de esgotos no Brasil

Figura 55
$UHGHEiVLFDGDH[SHULrQFLDSLORWRHVHXVUDPDLVFRQGRPLQLDLV

170

Sistema Condominial

$LQWHJUDomRFRPDGUHQDJHP
Petrolina, j foi dito, est no semi-rido
nordestino, onde a pluviometria mdia
anual da ordem de 400mm e ocorre
concentradamente em pequeno perodo
do ano. Mas na sua micro-bacia que
abranje o centro da cidade, por ocasio da
H[SHULrQFLDSLORWRGRVHVJRWRVRWUHFKR
QDOGRVHXUHJDWRHVWDYDMiFDQDOL]DGR
em concreto armado, e chamava a
ateno de todos pela vista desagradvel
HDSDUrQFLDGHLQXWLOLGDGH(UDR&DQDO
do Cheiroso, uma estrutura de certo
porte e que raras vezes, durante o ano,
cumpria a sua funo de escoar guas
de chuva, mas, diuturnamente, coletava
de esgotos, in natura, de sua bacia, na
IRUPDGHXPOHWHHPVHXIXQGRIHLRH
mal cheiroso, contraditando o seu prprio
QRPH(QRSURJUDPDGHQDQFLDPHQWR
que estava permitindo a construo do
sistema condominial de esgotos, estava
tambm arrolada a construo do trecho
de montante do referido canal, j projetada
segundo a mesma feio, com o fato
FRQJXUDQGRXPDUHSHWLomRLQDGHTXDGD
Da que os conhecimentos acumulados
com a elaborao da proposta de
Solucionamento dos Esgotos da cidade
- o seu Plano de Ordenamento conforme
hoje chamado - ensejaram que fosse
concebida, pela mesma equipe, uma
alternativa para aquela obra, a qual foi
levada Prefeitura e no custou a ser
DSURYDGDSRUHODHSHORVQDQFLDGRUHV
e logo construda. Tratava-se da sua
transformao, com grande economia
HGXSODQDOLGDGHQXPDDYHQLGDFDQDO
avenida para o trnsito, quase sempre,
canal para as guas de chuva, poucos dias
do ano. Alguma habilidade foi necessria
no seu projeto, para que no apenas
fosse como efetivamente parecesse: uma
avenida, na estiagem, e um canal, durante
as enxurradas.
Se a idia valia para o Canal do Cheiroso,
por que no valeria para toda a cidade? E
assim foi elaborado o Plano de Drenagem
Geral do Cidade de Petrolina (ainda a
Acqua-Plan, ainda o mesmo coordenador),
e que inusitadamente oferecia as condies
para a utilizao apenas de linhas dgua,
ruas e avenidas, ruas e avenidas para o
escoamento de guas pluviais, abolindo-se
o elevado custo de construo de galerias
enterradas (muitas vezes na rocha) e de
sua complicada manuteno. O referido
SODQRSURS{VXPDWLSRORJLDGHSHUVSDUD
esses interessantes canais, varivel com
as vazes, e obedecendo aquele mesmo
requisito do disfarce - ruas de veculos na
falta de chuva, canal durante as grandes
chuvas. Tem-se a notcia de que Petrolina
desfruta razoavelmente desse plano at os
dias atuais.

los daqueles usualmente denominados projetos executivos. Continham,


como visto no Caderno 2, o dimensionamento hidrulico e o desenho
em planta, para que o seu detalhamento fosse realizado uma nica vez,
durante a execuo da obra. Esta rede bsica teve uma extenso equivalente
a cerca da metade da extenso das ruas a que atende, as suas declividades
seguiram o mais possvel as declividades naturais do terreno e por isso suas
profundidades quase nunca superaram 1 m e a substituio de poos de visita
por caixas de passagem permitiu assegurar que o seu custo fosse inferior
metade daquele correspondente ao sistema tradicional antes projetado.
Com os ramais condominiais, por seu turno, a grande novidade e notvel
contribuio de Petrolina construo do modelo foi o surgimento dos
ramais de passeio, e que se voltaram, na cidade, para o atendimento da
populao de mais alta renda, justamente a que no tinha por que reclamar
do maior investimento desse ramal ou da sua tarifa mais elevada, conforme
as regras anteriormente expostas, que foram cumpridas rigorosamente.
J com os ramais condominiais internos, escolhidos pela populao em
funo de seus menores custos, foi necessrio proceder-se aos levantamentos
referidos no Caderno 2 para a emisso das respectivas ordens de servio 42,
com uma delas sendo mostrada na figura 56.
A posio do ramal, externa ou interna ao lote, confirmou, em Petrolina,
a teoria do Caderno 1: ela deve atender ao critrio tcnico-econmico e,
sobretudo, vontade e disposio de investimento dos seus respectivos
usurios. De um modo geral, os ramais internos, quando no so obrigados
pela topografia local ou pela geminao das casas vizinhas (condio que
exige grande quebra de pisos para a passagem de tubulaes) se mostram to
mais adequados quanto mais internas so as instalaes sanitrias prediais e
menos desenvolvido o estado dos prdios, j que, a, contribuem para uma
grande economia nas interligaes, a si, das instalaes internas. Os ramais
externos, ao contrrio, situados nos passeios, so prprios s edificaes mais
desenvolvidas, com menos espaos internos e menores restries de custo
para aquelas interligaes, mas a forma como as regras tratam estes diversos
modelos quase sempre decisiva na escolha dos usurios.
Todos os ramais condominiais e as suas respectivas ligaes intradomiciliares
(conexo das peas sanitrias das casas aos ramais) foram realizadas pelo
mesmo esquema operativo utilizado para a rede bsica. A sua ordem de
construo acompanhou, rigorosamente, a ordem em que ocorriam as adeses
e os respectivos pagamentos, por parte dos condomnios, de suas quotas
relativas aos investimentos em seus ramais. Nas cinco primeiras quadras do
rol das delimitadas para essa experincia-piloto os ramais condominiais foram
localizados no interior dos lotes, quase sempre nos seus fundos, condio que
mais economia traria aos moradores em face da localizao de suas instalaes
domiciliares (um deles est apresentado na figura 56).
Na execuo das obras dessa experincia, simultaneamente aos
procedimentos de mobilizao comunitria, a organizao dos trabalhos
foi a mais simples e econmica possvel. Contou-se com a contratao,
pela Prefeitura, dos profissionais adequados, sob o comando direto da sua

171

Figura 56
Um tpico ramal condominial de fundo de lote, na Vila Moc

Empreendimentos condominiais de esgotos no Brasil

172

Sistema Condominial

3DOLDWLYRVFRPRVHXHQWHV
$IDOWDGHUHFXUVRVQDQFHLURVQmRSRGHVHUUD]mRSDUD
que nada se faa diante de um problema que afete
diretamente o meio urbano e a sua populao. Situao do
JrQHURDFRQWHFHXHP3HWUROLQDTXDQGRIRUDPHVJRWDGDV
DVSULPHLUDVTXDGUDVGDH[SHULrQFLDSLORWRHDVYDODV
negras no sumiram de suas testadas, porque estavam
alimentadas por reas de montante ainda no resolvidas.
Adotou-se, ento, uma soluo efetivamente paliativa, mas
que trazia consigo somente efeitos favorveis em relao
situao imediatamente anterior.
Foi ela o desvio desta vala negra para o interior de um
canteiro central, extremamente rido, de importante
avenida cortada pelo seu caminhamento, com o
intuito de, atravs da irrigao, tornar possvel a sua
arborizao e algum ajardinamento. Isto foi possvel com a
FRQMXJDomRGHWUrVHQJHQKRVXPHVWUHLWRUHJRFRUWDQGRD
pavimentao da avenida
TXDVHLPSHUFHSWtYHO HTXHSDVVRXDOHYDURVHXHQWHV
do valo, montante, at o canteiro central e livre de
contacto com o trfego de veculos; uma tubulao
VXSHUFLDOFRPSHUIXUDo}HVDGHTXDGDVjLUULJDomRQR
WUHFKRGRFDQWHLURTXHRIHUHFLDFRQGLo}HVWRSRJUiFDV
SDUDHVWDLUULJDomRHQDOPHQWHDVXDFRQH[mRQDO
ao coletor-tronco do micro sistema (ento iniciado nesta

avenida), a que se ajustou, contudo, um pequeno vertedor


para o desvio das guas de chuva
(espordicas e concentradas). E os objetivos foram
plenamente alcanados: eliminao do problema sanitrio
de jusante nas quadras j atendidas, restingindo-os
DRVSRXFRVGLDVGHFKXYDRUHVFLPHQWRGHH[XEHUDQWH
vegetao no canteiro, amenizando a paisagem e o
clima desse trecho da cidade, a ponto de outras parcelas
da mesma avenida reivindicarem o mesmo tratamento;
e, por ltimo, evidenciar a possibilidade da extenso
dessa prtica a vrios outros logradouros, desde que
ajustadas, as suas solues a procedimentos sanitrios
mais exigentes. O custo desse arranjo foi efetivamente
desprezvel, sobretudo, quando se considera os seus
benefcios.
As rvores que tiveram este impulso inicial cresceram e
continuam exuberantes, mas a irrigao foi interrompida
por ocasio da continuao das obras na bacia, justamente
quando tudo teriam para serem aprimoradas e efetivadas.
De qualquer forma, a memria da pequena obra parece
ter permanecido, j se est sabendo das intenes da
municipalidade de repetiir a soluo, agora, em parte
da avenida que leva ao aeroporto, com a utilizao de
HXHQWHVGHODJRDVGHHVWDELOL]DomRVLWXDGDQRSHUFXUVR

prpria equipe de coordenao. Criavam-se, assim, as condies para que aos


objetivos estabelecidos para a experincia se juntasse mais um, e que viria
a ser fundamental para a cidade: o de dot-la de um ncleo tcnico capaz
da implementao de um processo permanente de enfrentamento da sua
questo sanitria.
42

Destaque-se, aqui, a necessidade dos


meticulosos levantamentos das quadras,
contemplando as suas construes internas,
suas reas pavimentadas e, sobretudo,
suas instalaes sanitrias e fossas, estas
ltimas apontando os locais de origem das
futuras ligaes, alm de dados altimtricos
importantes em alguns casos.

Tambm na escolha dos materiais para composio da rede e dos ramais


continuou a prevalecer o critrio de mxima economia, da a opo pela
utilizao dos tubos cermicos de 100 e 150 mm de fabricao regional,
com preos inferiores aos dos tubos normatizados. A implantao das obras
correspondentes parcela pblica do sistema ficou restrita, nesta ocasio,
rede bsica, j que a lagoa preexistente (conforme sua foto na figura 57 173

Empreendimentos condominiais de esgotos no Brasil

que j servia recepo das guas de lavagem dos filtros da ETA) tinha
dimenses suficientes para acumular o tratamento dessas guas e dos
efluentes das residncias atendidas nesse micro sistema que constituiu a
experincia-piloto.
Quanto ao processo de mobilizao social, o seu desenvolvimento obedeceu
sistemtica das reunies especficas em cada quadra, sempre noturnas e
realizadas no prdio pblico mais prximo, com as suas convocaes sendo
realizadas casa a casa, com a antecedncia devida. A freqncia, sempre
superior a 70% dos moradores, deveu-se principalmente ao fato novo
que constitua para a cidade, inclusive como nova prtica da administrao
municipal. Deveu-se ainda vontade explcita da populao local quanto
ao enfrentamento do grave problema sanitrio, muito bem visualizado na
presena marcante das valas negras nas ruas e efetividade das solues, que
viria quase de imediato, trazendo consigo um magnfico efeito-demonstrao.
Nessas reunies, as informaes repassadas e as respectivas discusses
consumiam uma nica reunio para cada grupo de vizinhana, aps a qual se
processavam, naturalmente, os debates internos e as decises requeridas, com
as adeses sendo configuradas num simplrio termo de concordncia, cujo
modelo viria a se consolidar em quase todos os empreendimentos do gnero
que se seguiram noutras localidades. As questes fundamentais abordadas
eram as seguintes:
174

Figura 57
$ODJRDTXHVHUYLXjH[SHULrQFLDSLORWRQD
forma como existia poca

Sistema Condominial

t reflexes sobre a gravidade da questo sanitria na rua, no bairro e


na cidade e suas conseqncias para a sade dos moradores;
t demonstrao minuciosa das vantagens tcnicas e financeiras do
sistema condominial, e a informao de seu xito em vrias cidades
do Rio Grande do Norte 43;
t assumia-se, em cada reunio, o compromisso de somente encerrla quando nenhuma dvida persistisse em qualquer dos presentes;
t apresentao, discusso e votao da proposta institucional,
sintetizada num novo pacto de diviso de responsabilidades: custos
para os usurios (investimento dos ramais e tarifa mensal) e tarefas
para a Prefeitura (construo e apoio manuteno dos ramais
internos) e COMPESA (operao da parte pblica do sistema);
t discusso (e validao) do direito das decises de maioria nas
questes condominiais;
t escolha, numa forma atenuada de eleio, do representante do
condomnio, espcie de sndico, de quem se desejaria, muito
mais do que exigiria, um apoio no condomnio para as discusses
suplementares, para a coleta das adeses e para uma relao mais
estreita com os executores, capaz de prestar-se como veculo de
informao entre as partes.

43

Cumpre relembrar, a respeito, que o


Prefeito Augusto Coelho, anteriormente
sua deciso pelo Sistema Condominial,
tomou a iniciativa de visitar algumas
cidades do Rio Grande do Norte, inclusive
a sua Capital, ocasies em que procurava
comprovar, junto aos prprios usurios, os
bons resultados ali obtidos

44

Observe-se a diferena entre os dois


estratos de renda ento contemplados na
H[SHULrQFLDHQTXDQWRRVXVXiULRVSREUHV
contribuam parceladamente e com notrios
sacrifcios para a quitao de suas parcelas
no investimento dos ramais, os usurios de
renda superior realizavam suas contribuies
atravs de depsitos bancrios, vista,
portanto.

O interesse desses moradores e a sua capacidade de mobilizao foram to


grandes que, j numa primeira reunio realizada com os mesmos, ficavam
definidos os ajustes a serem feitos nos procedimentos at ento adotados
(e que correspondiam aos mais pobres), sem qualquer alterao, contudo,
das linhas gerais caractersticas do modelo condominial. Dessa forma,
foram mantidos os conceitos da coleta condominial, com a rede bsica
apenas tocando cada quadra e sendo ela uma responsabilidade do poder
pblico. Os ramais condominiais foram sendo escolhidos e remunerados, na
construo e na operao, pelos respectivos condminos. Foram ajustados
alguns procedimentos que levavam em conta a nova condio social, dentre
os quais a elevao da tarifa de 40% para 80% do valor da conta dgua nos
casos de escolha dos ramais de passeio e a ordenao na construo dos
ramais em obedincia cronologia da efetivao dos depsitos bancrios em
valor correspondente ao oramento de cada condomnio 44.
Na maioria das quadras com aquela populao de maior renda as reunies
no chegaram a ser realizadas na decorrncia da sua elevada motivao, o
que levava iniciativa de obteno da adeso e da respectiva contribuio
financeira para fazer face ao investimento com os ramais condominiais, antes
mesmo da convocao.
O sucesso dos resultados alcanados nas primeiras quadras saneadas pode
ser apontado como extraordinrio e foi expresso no apenas pela euforia
da populao beneficiada e que acabava de sair da lama, mas, sobretudo,
pelo novo visual das ruas, agora sem as valas negras e j motoniveladas
175

Empreendimentos condominiais de esgotos no Brasil

(um compromisso da Administrao para animar o projeto) - conforme o


evidenciam as fotos da figura 58.
Ele contagiou no apenas a vizinhana mais imediata, aquela de mesmas
caractersticas socioeconmicas e habitacionais e que, alis, j tinha seu
ingresso assegurado no projeto, mas tambm os residentes de maior poder
aquisitivo da mesma bacia, dispostos em bairro onde comeavam a surgir,
naquela poca, as residncias mais modernas e luxuosas da cidade.
Os passos seguintes nesta rea, de execuo das obras e entrada em
funcionamento do novo servio, pelos seus exitosos resultados, multiplicaram
os fatores de aprovao da soluo, reconhecidamente insuperveis:
excelncia de atendimento nos vrios estratos sociais, universalizao do
princpio de remunerao pelo custo, investimentos alcanando menos
da metade daqueles que corresponderiam aos sistemas convencionais
e plenitude de atendimento nas reas abrangidas pela coleta; alm,
evidentemente, da oportunidade de alguma prtica de organizao e
desenvolvimento sociopoltico e ambiental nos embrionrios condomnios.
Um outro fato marcante da experincia-piloto foi o feliz acerto realizado
entre a municipalidade e a COMPESA, expresso em pioneiro convnio
celebrado entre as duas partes e que estabeleceu as tarifas para o novo
176

Figura 58
Antes, a lama nas ruas, como um importante
fator de mobilizao; e depois, a rua limpa
como propaganda da nova soluo

Sistema Condominial

sistema, a sua cobrana atravs das contas do servio de gua e o


compartilhamento da operao, nos termos das regras expostas no
item inicial deste captulo. Para a ocasio, incio dos anos oitenta, pode
ser considerado uma proeza, dado o inusitado da reduo nas tarifas
(verdadeiramente a quebra de um tabu) e a aceitao da realizao de obras
pela Prefeitura. Isto tudo foi conseguido graas racionalidade da proposta
(o quanto de irrecusvel ela continha), porm, no deixou de bem utilizar o
peso poltico de Petrolina no contexto do Estado.

13.3 A LAGOA DE ESTABILIZAO (E UM PARQUE


AQUTICO?)
O processamento final que serviu experincia-piloto extrapolou bastante do
seu objetivo precpuo e constituiu um bom exemplo do exerccio de algumas
daquelas idias bsicas j vrias vezes referidas: o gradualismo, a adequao
realidade e, principalmente, a integrao de aes. Alm disso, lanou
a semente da descentralizao desse processamento final no sistema
condominial de esgotos da cidade.
Trata-se da reverso de papis de uma lagoa existente na rea urbana e que
constitua, poca, um magnfico espelho dgua muito bem acolhido na
aridez da paisagem local, contribuindo, inclusive, para a valorizao do
bairro. Ela se fez a partir de uma barragem formada por uma das avenidas
locais sobre o riacho que o principal dreno da cidade, com a perenidade
do seu nvel mximo de gua sendo garantida, menos pelas guas de chuva,
escassas e concentradas, e mais, muito mais, pelas guas de lavagem dos
filtros da estao de tratamento dgua da cidade e, de resto, pelos prprios
esgotos de sua bacia que lhe afluam atravs de valas negras. Era a lagoa
apresentada, anteriormente, na figura 57. jusante da citada barragem,
uma outra lagoa se formara pelos efluentes da primeira. Para todos os
efeitos, portanto, estavam a, j, duas lagoas de estabilizao de esgotos,
como que dimensionadas pela natureza e pelas circunstncias.... A soluo
para o tratamento, portanto, estava ensinada, faltando apenas o seu
enquadramento na tecnologia disponvel.
A formalizao dessas lagoas como unidades de tratamento lagoa
facultativa seguida por lagoa de maturao seria ento possvel graas aos
desvios de duas de suas fontes de alimentao, tornando os esgotos seus
nicos afluentes. O desvio das guas de chuva foi realizado atravs de uma
rua-canal construda em seu permetro, conectada com o extravasor sob a
avenida; e o das guas da lavagem dos filtros pelo seu direcionamento, com
magnfico proveito, para a irrigao do grande parque da cidade, local do seu
antigo campo de pouso, onde lhe garantiria uma permanente paisagem verde.
A lagoa aqui referida haveria de comportar alguns aspectos, ainda, que a
distinguiriam das situaes usuais, a saber:

177

Empreendimentos condominiais de esgotos no Brasil

t BTTVBT formas seriam aquelas naturalmente modeladas no terreno,


compensando-se algumas perdas por eventuais irregularidades dos
fluxos internos, atravs dos maiores tempos de deteno garantidos
por seus espaos;
t BTVBalimentao seria varivel com o processo de incorporao
de novas demandas ao sistema, desde uma situao onde todas as
guas de lavagem dos filtros permaneceriam afluindo mesma, at
aquela, final, onde esta contribuio seria voltada para aquele outro
destino;
t PTFVQFSNFUSP RVFBGPSBPUSFDIPDPJODJEFOUFDPNBBWFOJEB OP
tinha qualquer impedimento ao ingresso de guas pluviais, passaria a
ser dotado de uma mureta de proteo, capaz de delimitar, sua volta,
um canal com dupla funo: a de escoamento das guas pluviais e a de
espao de recreao e lazer, nos largos perodos sem chuvas;
t Pacesso ao seu interior, ento franco e permanente inclusive para
a pesca em suas guas contaminadas, seria impedido por trs aes
simultneas: a construo de um adequado alambrado, campanhas de
esclarecimento aos usurios contumazes e a competente fiscalizao;
t PMBHPEFNBUVSBPQPEFSJBFWFOUVBMNFOUFDPNQPSUBSPMB[FSEP
tipo pedalinhos, de tal forma que a cidade passasse a desfrutar de
um inusitado parque aqutico para os padres dessa rida regio;
t QPSN FTFOEPFTUBMBHPBBQSJNFJSBEFVNBTSJFEFTVDFTTJWBT
lagoas que tratariam efluentes de sub-bacias contguas, conforme se
ver adiante, o riacho a existente poderia ser perenizado por esses
efluentes, ensejando a formao de interessante bosque nas suas
margens imediatas, conferindo notvel transformao da paisagem
urbana.
Este conjunto de obras simples, econmico e principalmente de benefcios
mltiplos foi implantado parcialmente e funciona com altos e baixos,
menos por suas caractersticas e mais pelas circunstncias administrativas e
operacionais.
A primeira das lagoas chegou a ser inteiramente implantada conforme
o seu projeto, mas teve sua obra complementar de drenagem bastante
afetada por uma enxurrada, e at hoje no foi devidamente reparada.
Estas etapas esto razoavelmente retratadas na figura 59. A lagoa de
jusante, por seu turno, funciona na sua forma natural, nada tendo sido
feito que enquadrasse tecnicamente o seu desempenho e proteo. Ambas,
contrariando a prpria legislao, no tm qualquer controle sobre a sua
operao, e apenas sugerem um razovel desempenho por conta do aspecto
bastante favorvel, aprazvel, e da ausncia de odores ou flutuantes.

178

Sistema Condominial

Figura 59
A transformao da lagoa: na construo
de suas obras complementares (1), liberada
ao trnsito (2) e com sua urbanizao
degradada (3)

Acompanhando a implantao do parque, somente concluda h cerca de seis


ou sete anos, foi realizada a instalao do seu sistema de irrigao, naquela
forma proposta inicialmente, conforme se pode ver na foto da figura 60, da
poca dessa instalao. Encontra-se, todavia, paralisada, em conseqncia
da presena de areia nos efluentes (indicativa de sua origem, nos filtros da
ETA) e que incompatvel com o objetivo a que se destina. Estuda-se, no
momento, a forma mais interessante de resolver a questo.
179

Empreendimentos condominiais de esgotos no Brasil

Figura 60
Plantio do Parque da Cidade com apoio
da irrigao com guas de
ODYDJHPGRVOWURVGD(7$

13.4 O PLANO DE ORDENAMENTO


Este plano originariamente chamado Proposta de Soluo, continha as
informaes mnimas necessrias extenso do modelo condominial a
toda a cidade de Petrolina e suas previsveis reas de expanso urbana. Ele
se distinguia bastante do que eram os planos diretores caractersticos da
poca 45, sobretudo, porque ao contrrio deles, buscou acrescentar s suas
indicaes de carter fsico por sinal bastante mais leves - uma filosofia e
uma estratgia para sua implementao. Apoiou-se, nesse sentido, nas idias
bsicas que do sustentao ao modelo, ensejando: o estabelecimento de um
processo de implementao do sistema numa forma to progressiva e gradual
quanto certamente seria a viabilizao dos investimentos; a participao
comunitria como condio de garantir a efetividade do atendimento; a
integrao de agentes e aes capaz de reunir energias a favor da soluo; e a
adequao do sistema fsico realidade local, seja nas suas extremidades que
tocam a populao, seja naquelas que realizam o lanamento dos efluentes
coletados.
A partir dessa orientao de carter filosfico, o citado Plano de
Ordenamento se constituiu num instrumento bastante simples, porm,
objetivo e completo o suficiente para ter sido capaz de orientar a
expanso do sistema de esgotos da cidade at o momento atual, quando
o atendimento j alcana uma populao da ordem de 190.000 habitantes.
180

45

Quase sempre instrumentos complexos


e ambiciosos, contemplando solues
prontas e acabadas porque pouco ou nada
comprometidos com a realidade local,
sobretudo, quanto s disponibilidades de
UHFXUVRVQDQFHLURVSDUDRVLQYHVWLPHQWRV
assim concebidos.

Sistema Condominial

Nesse sentido, ele contemplou, quase que exclusivamente, trs componentes


fundamentais, relativos, respectivamente, coleta dos esgotos, organizao
espacial do sistema e conceituao do processo de tratamento.
No que tange coleta dos esgotos, ele retificou aquilo que a experinciapiloto evidenciou em carter mais que suficiente para exemplificar o que
precisaria vir a ocorrer em todas as outras reas da cidade, nos vrios
aspectos a includos: os componentes fsicos da rede bsica e dos ramais, a
adequao destes diversidade das quadras locais, o processo de mobilizao
da comunidade e, finalmente, os procedimentos mais indicados para a
construo das obras. Certamente que o desenvolvimento tecnolgico (de
materiais, de equipamentos e de processos construtivos), e bem assim o
volume e a distribuio temporal dos recursos destinados aos investimentos
haveriam de modelar cada interveno de conformidade com as suas
circunstncias.
Para a organizao espacial do sistema, numa forma que at mesmo
independesse da evoluo espao-temporal da demanda, a proposta de
descentralizao do processo de tratamento, que uma caracterstica
do modelo condominial, foi exercitada na sua plenitude. Definiu-se,
ento, para uma rea que pudesse corresponder mais exagerada expanso
da cidade em prximos anos, as sub-bacias de tamanho compatvel com
a presena descentralizada do tratamento e os respectivos locais para a
implantao destes, sempre que possvel correspondendo a depresses do
terreno sem valor imobilirio e que inclusive ensejasse, eventualmente, a
dispensa de estaes de recalque 46. Observe-se que uma tal concepo, a
par de eliminar as grandes estruturas de transporte do sistema onde quase
sempre esto os maiores investimentos ofereceria ainda uma extraordinria
flexibilidade implantao de obras diante de qualquer oferta de recursos
financeiros. Quando forem eles menores que os investimentos requeridos
para uma nica sub-bacia, que se implante a coleta parcial e se fracione o
tratamento; em caso contrrio, que se estude, pelo lado tcnico-econmico,
a juno de duas bacias para um tratamento nico ou a preservao da
disposio original.

1RFDVRGH3HWUROLQDDVXDWRSRJUDD
natural favoreceu bastante este tipo de
FRQFHSomRQDGHFRUUrQFLDGDVVXDYHV
declividades sempre presentes.

46

47

Esta condio, quando no se tem como


certo a regular operao de unidades
de tratamento de esgotos, sobretudo, no
Nordeste (at mesmo, talvez, pelo quanto
so elas afastadas do meio urbano)
poderia at mesmo favorecer a melhoria de
desempenho dos prestadores do servio, em
face das presses da populao.

Quanto ao processo de tratamento, os fatores locais sugeriam com clareza


a prescrio das lagoas de estabilizao: pela presena de seus espelhos
como amenizadores do clima semi-rido local; pelo aproveitamento dos
terrenos alagadios das depresses onde quase que invariavelmente seriam
localizadas essas unidades; pelos seus fracos requisitos operacionais, e assim
sintonizados com a limitada oferta local de recursos; e, evidentemente,
pela excelncia com que so consideradas essas lagoas para a sua finalidade
especfica. Considerava-se, por outro lado, que estando as mesmas situadas
no ambiente urbano, deveriam atender a dois outros requisitos essenciais:
a boa operao, no sentido de que jamais incomodassem a populao de
sua vizinhana com odores ou aspectos desagradveis 47 e a sua perfeita
insero paisagstica, atravs de uma modelao menos rgida para os
quadrilteros que usualmente as formam e de adequado paisagismo nas
suas imediaes. Acreditava-se, poca, que o conjunto dessas lagoas, com os
seus efluentes irrigando naturalmente o leito (quase) sempre seco dos drenos
181

Empreendimentos condominiais de esgotos no Brasil

da rea urbana, seria capaz de oferecer cidade importante componente de


amenizao climtica, atravs da formao de verdadeiros bosques ao longo
dos talvegues revitalizados, que atravessariam grande parte da trama urbana.
falta da planta original com esta concepo, apresenta-se, na figura 61,
como simples ilustrao da idia original, expressa numa planta em escala
bastante reduzida, a indicao das sub-bacias que j tiveram os seus sistemas
de esgotos implantados, cada uma delas com a sua lagoa de estabilizao
(indicadas pela cor azul). As diferenas entre esta e aquela original, se
ocorrerem, ficam to-somente por conta de certa redefinio geogrfica que
o traado urbano real sempre capaz de proporcionar. Em nada, contudo, a
representao altera a idia original.

13.5 DESDOBRAMENTOS IMEDIATOS


Viria a ser uma caracterstica das experincias-piloto bem sucedidas, nos
sistemas condominiais, saber-se precisamente onde e quando se iniciam,
perdendo-se de vista, por outro lado, onde terminariam... para que a,
ento, comeasse o que seria a massificao das obras. Em Petrolina,
para os objetivos desse relato, considerou-se como sua experincia-piloto
aquela que atendeu a Vila Moc e o Jardim Paulo Afonso, como descrito
anteriormente. O seu xito pode ser configurado no atendimento pleno
da populao atingida pela sua rede e no efeito-demonstrao da
decorrente para a cidade, particularmente para os seus setores com maiores
dificuldades com os esgotos. Subsidiariamente, tambm foi parte desse xito
o entusiasmo da estrutura poltica municipal com aes to prximas da
populao e num setor onde o Estado h muito nada realizava, o que tambm
entusiasmou a pequena e competente equipe tcnica local. Naquela altura
dos acontecimentos, pois, 1985, experincia-piloto exitosa e expandida,
populao e Prefeitura informadas e treinadas na soluo, planejamento
disponvel e resultados fortemente ecoados, e aplaudidos, haveriam de se
sucederem as obras do esgotamento, ao tempo em que se remodelavam
naturalmente algumas de suas caractersticas iniciais, sobretudo aquelas que
eram ditadas pela escassez inicial dos recursos financeiros.
Em termos de expanso do sistema, a primeira conseqncia desse vitorioso
empreendimento ocorreu logo nos idos de 1985, quando recursos do BNDES
e do Estado se juntaram para a implantao do sistema condominial no
bairro Gersino Coelho 48, evento que trazia consigo, assim, estes outros
apoios para o novo modelo. Era um micro sistema contguo ao inicial e
que abrangia, na ocasio, cerca de 4.000 habitantes de uma tpica classe
mdia baixa e que convivia com muito esgoto a cu aberto. Mesmas regras,
mesmos trabalhos comunitrios, ramais condominiais definidos pelos
condomnios 49, mesma metodologia de projeto e de obras e uma diferena
significativa em relao rea-piloto. Foi mais um avano, salutar, na
diviso de responsabilidades entre a COMPESA e a Prefeitura, desta feita na
execuo das obras, cada qual assumindo aquilo que lhe era mais prprio: a
primeira com as obras pblicas, aquelas mais gradas e a segunda com tudo

182

48

O Banco Nacional de Desenvolvimento


Econmico e Social (BNDES) empregou
recursos do seu fundo de pesquisas, sem
nus para o Municpio, ao passo que o
Governo do Estado alocou recursos que lhes
IRUDPQDQFLDGRVSHOD&DL[D(FRQ{PLFD
Federal.
49

Os ramais condominiais foram todos eles


internos em razo das suas vantagens para
o pblico usurio local: instalaes sanitrias
nos fundos das casas e menor custo do
ramal, em presena do menor nvel de renda
dessa populao.

Figura 61
A descentralizao do tratamento em Lagoas de Estabilizao, que tambm amenizam a paisagem

Sistema Condominial

183

Empreendimentos condominiais de esgotos no Brasil

o que ocorreria dos muros para dentro das casas - a mobilizao social e os
ramais condominiais. Uma diviso, sem dvida, adequada para as dimenses
em jogo dos dois rgos envolvidos, e que inclusive poderia apontar para
a sua extrapolao s demais cidades do Estado, sob a responsabilidade
da COMPESA. A presena desta frente das obras mais pesadas e mais
distantes da comunidade introduziu uma feio mais especificamente
empresarial ao empreendimento, representado pelas formalidades que
constituem a praxis na construo de sistemas de esgotos.
Esta etapa do sistema tambm contou com um tratamento especfico
atravs de lagoa de estabilizao, por sinal a primeira construda na cidade
(a que serviu experincia-piloto fora reaproveitada), destacando-se que a
combinao da topografia favorvel da rea com o traado caracterstico do
modelo condominial conseguiu realizar toda a coleta por gravidade, tal como
na experincia-piloto, com o que se evitaria, mais uma vez, o uso de estaes
de recalque. Para que esta situao fosse alcanada, foi necessrio uma
interessante inveno: a interposio de uma fossa sptica em determinado
ponto da rede bsica e que permitiu que o coletor da efluente fosse
dimensionado como canalizao de gua, j que esse pr-tratamento tinha
tambm a funo de decantao.
As obras foram concludas, o servio foi posto em operao e as valas
negras foram eliminadas: mais um xito configurado para a soluo, novas
oportunidades de financiamentos para a continuidade, perspectiva de uma
interessante parceria entre Estado, Municpios e comunidades em prol do
saneamento bsico do Estado de Pernambuco.
Nesse caso, os atendidos foram as 7.000 pessoas que perfazem, hoje, a
populao dessa sub-bacia, sendo que, destes, cerca de 4.000 foram os
atendidos naquela primeira etapa aqui relatada; os demais foram sendo
inseridos noutras expanses do processo que acompanharam a prpria
ocupao.
Em resumo, o novo micro sistema universalizou o atendimento e eliminou
as valas negras, dispensou mais uma vez o uso de estao de recalque e
veio a contar com uma lagoa de estabilizao segundo modelo tpico
da engenharia sanitria localizada conforme as indicaes do Plano
de Ordenamento. Com isso, consagraria no apenas esse plano e a
descentralizao que lhe caracterizava, como tambm a importante idia
de que a cada rede construda haveria de corresponder uma estao de
tratamento - preceito bvio, mas pouco obedecido, at hoje, no Brasil.

13.6 OS OUTROS SALTOS DO SISTEMA E AS


SUAS MUDANAS
A partir de 1990, o curso do sistema condominial na cidade viria a passar
por modificaes, ditadas por circunstncias das diversas fases e vrias
administraes municipais, mantendo intactos, contudo, o desenho do sistema
fsico, o sistema tarifrio diferenciado e a operao das suas parcelas pblicas
184

Sistema Condominial

pela COMPESA e dos ramais condominiais internos pelos seus usurios. Elas
foram introduzidas, progressivamente, no modus faciendi do empreendimento,
apesar de justificadas como desejo da comunidade, trouxeram consigo duas
conotaes do lado institucional: a facilidade com que os recursos financeiros
estavam sendo aportados, em conseqncia, justamente, dos bons resultados
alcanados; e uma sugestiva maior operacionalidade do processo construtivo
e de manuteno do sistema. Ambas trazendo consigo um certo vis
conservador. As mais importantes foram as trs seguintes, pelos seus efeitos
na economia da obra, no nvel de mobilizao e de formao da populao
usuria para o servio e na prpria qualidade da operao:
t B execuo de todas as obras por parte da Prefeitura, na sua
condio de mobilizadora dos recursos para os investimentos, o
que no apenas afastou a COMPESA do processo construtivo e da
prpria dinmica do empreendimento - como certamente veio a ser
fator de sua desmotivao frente ao servio;
t a adoo dos ramais condominiais de passeio como padro para
toda a cidade, a partir do pressuposto da maior preferncia por parte
da populao por essa soluo, a que se somaram, igualmente, as
maiores facilidades de execuo por parte da municipalidade; pelos
seus maiores custos em presena da diversidade da renda da populao
usuria, essa medida trouxe consigo a gratuidade dos ramais para toda
a populao, independentemente de sua capacidade financeira;
t QPSMUJNP FRVBTFDPNPVNBDPOTFRODJBEJSFUBEBBOUFSJPS 
deixou-se de realizar a mobilizao da comunidade, cuja razo
maior residia na busca de sua adeso ao programa atravs de
fatos to concretos quanto a escolha dos ramais e a absoro das
responsabilidades implcitas 50.

1mRUHVWDPG~YLGDVGHTXHWDLVH[LJrQFLDV
FRQFUHWDVFRPUHH[RVDVVLPGLUHWRVVREUH
cada morador, a par de constiturem o foco
principal do processo participativo, funcionam
tambm como bom pretexto para outras
importantes discusses que terminam sendo
muito valiosas para a formao das pessoas
enquanto usurias de um novo servio,
distinto daquele a que estariam culturalmente
adaptadas.

50

51

Nesse interior esto as instalaes


sanitrias prediais e as suas conexes
ao sistema de coleta, de cuja qualidade
ir depender, fundamentalmente, a futura
operao do servio, sobretudo, no que
WDQJHjJDUDQWLDGHDXVrQFLDGHiJXDV
pluviais e aos requisitos mnimos quanto
ao uso propriamente dito do servio.
4XDQWRPDLVKXPLOGHVDVUHVLGrQFLDVPDLV
importantes estes comentrios.

Essas medidas assumidas pela municipalidade, e que fizeram parte,


certamente, de ajustes que lhes pareceram indicados em face da realidade
local, sero comentadas com maior interesse nas concluses desse relato.
Daqui, todavia, antecipe-se to somente suas conseqncias de maior peso:
t BFMJNJOBPEPJOWFTUJNFOUPDPNVOJUSJPOPTSBNBJTDPOEPNJOJBJT F
que representa um mnimo de 30% do investimento total com o sistema;
t o afastamento da instncia municipal do interior dos prdios,
onde tem incio efetivo o sistema de esgotos, ao contrrio dos demais
servios da infra-estrutura urbana 51;
t GSBODBJOKVTUJBDPNBQPQVMBPRVFBUFOUPBTTVNJBPOVTQFMB
construo dos seus ramais.
A partir daquele ano (1990) e at os dias atuais vrios investimentos
foram realizados no sistema de esgotos da cidade, contando com recursos
financeiros conquistados pela Prefeitura de praticamente todos os programas
federais estabelecidos para o setor neste perodo, os quais alcanaram, hoje, a
marca de 190.000 pessoas atendidas.
185

Empreendimentos condominiais de esgotos no Brasil

13.7 A SITUAO ATUAL


O atendimento por sistema de esgotos em Petrolina, atualmente, abrange
cerca de 70% de sua populao com o servio de coleta, sendo que apenas
metade desse contingente tem seus esgotos tratados, condio que, no
Nordeste do Brasil, pode ser vista como das mais avanadas. Alm disso,
compromisso firmado entre a COMPESA e a Municipalidade estabelece
a meta de universalizao do atendimento, na sua forma mais completa,
para os prximos meses. Quanto condio desse atendimento atual, a
Agncia de Regulao de Pernambuco (ARPE) concluiu o seu relatrio de
inspeo aos sistemas de esgotos da cidade, em fevereiro de 2005, referindo
que... Todos os sistemas de coleta e tratamento de esgotos operados pela
COMPESA, em Petrolina, encontram-se em plena operao e atendem ao
que preceituam as normas tcnicas pertinentes. O estado de conservao
das instalaes bom e os servios de manuteno tm-se mostrado
eficientes. Recomenda-se especial ateno com as aes necessrias
preservao dos investimentos realizados, adotando-se medidas efetivas
para impedir furtos e vandalismo.
Indo um pouco alm desse cenrio mais formal, ser possvel uma apreciao
do servio segundo a sua composio, examinando-se mais particularmente
o seu vis condominial, sobretudo, na rea da experincia-piloto, quando j
decorrem 25 anos de sua implantao.
Nos seus componentes de feio mais especfica convencional sua
rede bsica, seus ramais de passeio e suas lagoas de estabilizao - os
procedimentos empregados na operao e manuteno so os
caractersticos do prestador do servio, sempre aqum da condio
desejvel, mas ainda assim suficientes conforme as referncias do regulador,
anteriormente citadas. Eles so invariavelmente limitados reparao e ao
concerto dos componentes avariados ou obstrudos, inexistindo qualquer
controle de qualidade sobre o tratamento ou manuteno preventiva nos
equipamentos eletromecnicos. A grande ressalva sobre essa questo fica
por conta do perodo de cinco a seis anos que antecedeu aquele relatrio
acima citado, o qual, na verdade, foi o seu prprio fator determinante (e de
tantos outros que o antecederam). que nesse perodo o prestador do servio
abandonou, na prtica, a manuteno do sistema, mantendo constantemente
um considervel estoque de obstrues no sistema coletor e instalando uma
condio de verdadeiro caos ao redor das suas nove lagoas de estabilizao
com alimentao dependente de estaes elevatrias (estas unidades
deixavam de funcionar medida que seus conjuntos elevatrios entravam
em pane, pela mais absurda falta de manuteno). At que os protestos da
Prefeitura, os autos da Promotoria e o clamor da populao sensibilizaram
a COMPESA e a levaram aos investimentos necessrios reparao dos
problemas mais agudos e celebrao de novo contrato de concesso com a
municipalidade.
No que tange, por outro lado, quele vis condominial de que se falou
acima e que pode ser sintetizado nos ramais condominiais, interessa
distinguir as duas pocas da implantao do sistema, antes e depois da
186

Sistema Condominial

ocorrncia da participao da comunidade. Na primeira com os ramais


sendo escolhidos e assumidos pelos condomnios, ocasio em que
prevaleceram os ramais condominiais internos aos lotes, com operao
a cargo dos usurios (e apoio da municipalidade) e tarifas reduzidas
(40% da conta da gua); e na seguinte, onde se manteve o desenho
condominial, mas eliminou-se a participao e padronizou-se o ramal
de passeio, sempre assumido pela Prefeitura e com a maior tarifa (80%
daquela conta) para o usurio.
Sobre estes ltimos os ramais de passeio nada h a distingui-los, na
manuteno, relativamente prpria manuteno da rede bsica. Apenas
a informao e a verificao in loco de que naquele perodo crtico da
operao citado, foi comum a ocorrncia de desobstrues realizadas pelos
usurios, mesmo que isso no fosse tarefa regular deles; foram movidos,
to-somente, pela inao do prestador do servio e pela necessidade da
eliminao do problema nos quintais e nas cercanias de suas casas.
Sobre os primeiros, sobretudo, os ramais internos, aqueles assumidos na
origem pelos usurios, no h nenhum registro de que tenham deixado
de ser mantidos durante todas as etapas da operao, mesmo quando
a municipalidade deixou (como at hoje) de realizar aquela ajuda
compromissada por ocasio das reunies condominiais. Naquele perodo
crtico da (no) manuteno, o seu perfeito funcionamento, determinante
da limpeza de quintais e arredores imediatos das casas, era bastante
contrastante com o caos em algumas ruas e nas cercanias de quase todas
as lagoas de estabilizao. Apesar dos seus 25 anos de funcionamento e de
sua constituio com tubos cermicos no normatizados, sem dvida que
de menor qualidade que os mais recentes tubos plsticos. Isto, contudo,
no deve ser visto como indicativo de satisfao por parte dos usurios. Ao
contrrio, uma grande parte deles reclama bastante dessa condio de seus
ramais, sendo que as suas razes so evidentes e justas, a saber:

&RPSURYRXVHDH[LVWrQFLDQmRDSHQDV
de edifcios de apartamentos no local,
como at mesmo a presena de um
abatedor clandestino de caprinos, revelando
condies estas naturalmente imprprias ao
modelo adotado de ramal.

52

t OB7JMB.PD QPSFYFNQMP PTMUJNPTBOPTUSPVYFSBNVNBSBEJDBM


transformao, particularmente nas suas casas, ampliando-se os
espaos construdos, evoluindo-se no seu padro ou alterando-lhe a
prpria funo 52, alm, evidente, da ocorrncia de considerveis trocas
de moradores; em conseqncia, os ramais internos que antes eram
adequados ocupao da poca 53, tornaram-se inconvenientes para
a condio atual, quando as canalizaes, e principalmente as suas
caixas de passagem, foram ficando subjacentes s reas construdas e,
dessa forma, imprprias para as operaes de manuteno;

53

Numa tal condio, as mesmas regras


DGRWDGDVSRURFDVLmRGDH[SHULrQFLD
piloto haveriam de levar esta populao,
agora, readaptao de seus ramais, em
atendimento a uma evoluo que ocorreu
nas suas prprias casas. Como mudou,
todavia, a orientao da municipalidade
com relao aos ramais agora assumidos
inteiramente por si dever ela prpria
providenciar a referida mudana, o que alis
j faria parte de suas decises.

t BBEPP QFMB1SFGFJUVSB EBnova postura relativa aos ramais


condominiais (sistematiz-los nos passeios e sem custos para os
usurios) configurou, para os usurios dos primeiros tempos, uma
grave injustia e um natural desejo de mudana, na busca da equidade;
t Pdesconforto quanto ao no cumprimento de duas promessas por
parte da municipalidade: uma nas origens do servio, quando se
garantia colaborar com os usurios (o que, alis, foi realizado em certo
187

Empreendimentos condominiais de esgotos no Brasil

perodo) nos casos mais difceis de sua manuteno de ramais internos; e


mais recentemente, quando prometeu reverter os ramais internos antigos
para os passeios, como o caso das construes dos ltimos 18 anos.

13.8 CONSIDERAES FINAIS


O interesse, aqui, o de comentar e destacar algumas questes tcnicas,
econmicas e sociais que pareceram mais relevantes nesses 25 anos
de sistemas condominiais em Petrolina, centrando-se a observao,
principalmente, a partir daquela experincia-piloto situada nas suas
origens. Nesse perodo, foi menos ou mais intensiva a explorao das idias
fundamentais de apoio ao modelo, sobretudo as da participao comunitria
e da adequao realidade; ou, melhor dizendo, essa explorao foi, na
realidade, decrescente.
Iniciando-se pelo seu sistema fsico entende-se ter sido ele adequado,
eficiente e econmico nas suas trs instncias; os ramais, nas suas diversas
alternativas, por terem sido capazes de se ajustar diversidade das quadras,
nas suas habitaes e respectivas instalaes sanitrias e, sobretudo, ao
nvel de renda dos seus moradores; a rede bsica porque, aproveitando
ao mximo o servio dos ramais, minimizou extenso, profundidade e
custos; o tratamento, no mbito local, alm de contemplar processo dos
mais eficientes, minimizou custos ao dispensar estruturas de transporte e
utilizar, para sua localizao, depresses naturais em reas pblicas; de resto,
constituiu significativa contribuio ao meio ambiente local.
A expanso que veio a ter esse sistema na cidade somente no repetiu todos
esses caracteres da experincia-piloto em alguns pontos especficos, tais como na
padronizao dos ramais, quando se trocou um menor custo e maior adequao
quela diversidade urbana pelo que justificado como mais operacional pela
Prefeitura; na mudana dos materiais das canalizaes, da cermica (de mnimos
custos e qualidade inferior) para o PVC, no que foram notrios os ganhos de
todas as ordens; e finalmente na formao das lagoas, quando passaram elas ao
formato mais engenharia e menos paisagismo onde os ganhos e as perdas so
evidentes, conforme a foto de uma delas, na figura 62.
Nesse processo de extrapolao ficaram patentes o papel da experinciapiloto como laboratrio na sua forma mais ampla (testando solues,
treinando equipes, exemplificando resultados, etc) e a plena suficincia dos
documentos tcnicos preparados na mesma poca, com nfase especial ao
Plano de Ordenamento, o qual viria a orientar todas as intervenes que se
seguiram experincia.
No plano institucional, por seu turno, alternaram-se papis, arranjos e
responsabilidades da experincia-piloto, nas fases que se seguiram, como
visto anteriormente. Sobre isso expe-se, abaixo, o que seriam prs e
contras nessa evoluo, salientando-se, de antemo, o respeito s posies
da municipalidade (e das municipalidades, de uma maneira geral) no mbito
de suas gestes e em face das carncias da populao. Afinal, ela (so elas)
o apoio, a assistncia, a indutora de tudo aquilo que venha a garantir o acesso
188

$OJXPDVLQWHUHVVDQWHV
FXULRVLGDGHVGXUDQWHD
H[SHULrQFLDSLORWR
Foi perceptvel, em todas as ruas
que passavam a ter resolvido o
seu problema de esgotamento, a
imediata mudana no estado de
nimo dos moradores, traduzida
em melhorias urbanas: perfeio no
colecionamento do lixo, pintura de
fachadas, melhorias habitacionais e
DXPHQWRGDVSUHVV}HVSRUPHLRRV
e pavimentao.
Nas quadras mais pobres que
aderiam ao processo, a comunidade,
no af de garantir o seu rpido
ingresso, valeu-se de mtodos to
criativos de arrecadao de fundos
quanto a realizao de bingos e
rifas entre amigos, com prendas
arrecadadas entre os prprios
vizinhos.
Um loteamento situado nas
imediaes da lagoa que serviria
H[SHULrQFLDSLORWRLQWHUIHULULDFRP
o coletor principal da sub-bacia,
a ponto de obrigar, ai, pelo seu
desenho, a introduo de uma
HVWDomRHOHYDWyULD8PDPRGLFDomR
no desenho do loteamento,
negociada entre proprietrios e
a prefeitura, sem qualquer nus
para as partes, foi capaz de abrir o
espao para o coletor e dispensar a
elevatria. A destacar aqui, portanto,
a importncia da proximidade e do
interesse da Prefeitura relativamente
obra, e em busca de melhores
condies para sua realizao.
Nessa mesma linha de proximidade
esto as escolhas dos locais de
tratamento dos esgotos na cidade,
todos em terrenos alagadios e
pblicos, grtis, portanto, para
o servio, a despeito de sua
localizao no meio urbano e s
vezes na vizinhanediata de reas
bastante valorizadas.
Numa das quadras abordadas na
H[SHULrQFLDSLORWRXPDGHVXDV
casas era de um padro bastante
acima de todas as demais do
conjunto, fato que denunciava,
naturalmente, a maior renda e as
maiores (continua)

Sistema Condominial

Figura 62
Uma das 11 lagoas de estabilizao da
cidade, desta feita conforme o desenho
convencional

54

A pesquisa se deu em amostra aleatria


de tamanho equivalente a 5% do total
de prdios da rea e serviu de base ao
documento elaborado pelo autor para o
Ministrio das Cidades, sob o ttulo Sistema
Condominial de Esgotos de Petrolina
Pequeno Relato, comentado, desde a sua
H[SHULrQFLDSLORWR

a todos os servios que caracterizam a plena normalidade da vida na cidade.


Nos sistemas de esgotos isto significa suficincia de instalaes internas e de
instrues para o uso, alm de adequada e justa atribuio de responsabilidades
na construo e na operao do sistema. Eis, ento, os tais pontos:
t OBFYQFSJODJBQJMPUP PBUFOEJNFOUPQFMPTJTUFNBBMDBOPVPT
da populao residente, ao tempo em que tambm se garantiu a plena
conexo de todas as peas sanitrias aos respectivos ramais, sem
qualquer participao das guas de chuva, resultados esses que foram
decorrentes, dentre outros fatores, da intensa participao da Prefeitura
na mobilizao e apoio da comunidade; em pesquisa direta realizada
em 2003 54 por ocasio desse estudo, estes feitos foram confirmados, da
mesma forma que se comprovou o pleno funcionamento dos ramais
internos, mesmo aps agosto de 2002, quando a Prefeitura deixou de
oferecer qualquer apoio aos condomnios; fica a convico, portanto,
da importncia da aproximao desse agente institucional em relao
comunidade carente;
t GB[TFOFDFTTSJP BRVJ SFMFNCSBSVNBQPTTWFMGBMIBOPT
procedimentos da experincia-piloto com relao COMPESA:
temendo-se uma posio conservadora quanto s inovaes
189

Empreendimentos condominiais de esgotos no Brasil

tecnolgicas e confiando-se, tambm, na fora poltica local, foi


aquela empresa marginalizada durante aquela fase inicial, fato que
talvez tenha contribudo para afast-la do sistema. Em situaes
similares, hoje, a busca do entendimento o mais aberto e negociado
com o organismo responsvel pela operao deve ser tomado como
uma recomendao irrecusvel 55.

FRQWLQXDomR H[LJrQFLDVGR
morador, esta ltima evidenciada
pela sua recusa ao ramal
condominial interno, conforme
era esse o desejo dos demais
condminos. Excepcionalmente,
at mesmo como teste sobre a
realidade, procedeu-se ai de forma
distinta daquela generalizada, j que
efetivou-se a construo do ramal
da quadra, excluindo do mesmo a
casa que o recusava. Meses aps o
sofrimento do morador desatendido
(ento com uma pequena lagoa de
esgotos na sua porta), concedeuse ao mesmo o direito de um ramal
HVSHFtFRH[WHUQRHSDUWLFXODUWRGR
ele construdo, todavia, s suas
expensas. Esta nova condio, a
despeito de vir a ser aceitvel como
parte das regras do servio, jamais
voltou, contudo, a ser novamente
solicitada, com este fato reforando a
aceitao comunitria, das decises
de maioria.

t EFJYBOEPTFEFMBEPBPQPEBNVOJDJQBMJEBEFQFMBQBESPOJ[BP
dos ramais condominiais, discorda-se, contudo, quanto sua
gratuidade para toda a populao, independentemente da condio
econmica, fato que esvaziou, tambm, o processo de mobilizao
comunitria. A recomendao, no caso, no sentido de manter-se a
cobrana dessas unidades aos seus usurios, ainda que com algum
subsdio para os segmentos mais pobres, seja para no perder-se esse
valioso aporte de no mnimo 30 % do investimento total, seja para
manter-se a razo mais objetiva daquela mobilizao social.
Por ltimo, a questo da participao da comunidade, sobre o que permanece
atual, para o autor, os procedimentos que a esse respeito foram adotados
na experincia-piloto aqui comentada, que redundaram em resultados to
concretos quanto o investimento realizado nos ramais condominiais; ou a
garantia, nesses vinte anos, do perfeito funcionamento dos ramais internos
(apesar de hoje inadequados para a nova realidade habitacional da rea);
ou ainda na aceitao e convivncia com as estaes de tratamento no meio
urbano, fator que se vem traduzindo em ampla economia para o sistema

2EVHUYHVHTXHRFRQYrQLRGLVFLSOLQDGRU
das responsabilidades entre a Prefeitura e a
COMPESA somente veio a ser estabelecido
em 1988, quando talvez j estivessem
radicados os procedimentos exclusivistas.

55

190

Sistema Condominial

14. BRASLIA
O programa de sistemas condominiais no Distrito Federal deve ser
visto, com certeza, como a mais completa obra desse modelo, no Brasil e
certamente no mundo. Conforme ser visto na seqncia, isso verdadeiro
por conta de sua dimenso 200 mil ligaes, 1 milho de atendidos, 7.300
reunies condominiais com 83.000 participantes, 2.000 km de ramais
condominiais e 1.000 km de rede bsica; e por conta de muitas de suas
caractersticas permanente perspectiva do atendimento pleno (em que
pese o dinamismo demogrfico da regio), alcance por igual e sob mesmas
regras de todos os estratos da populao (sociais, econmicos, locacionais),
dotao de estaes de tratamento de esgotos consentneas com os
requisitos legais, participao da populao nos investimentos dos sistemas
e qualidade da operao dos servios num bom nvel de institucionalizao.

14.1 AS CIRCUNSTNCIAS NO INCIO DO


PROCESSO
No incio dos anos noventa, o Governo do Distrito Federal empenhou-se em
um gigantesco programa habitacional, vindo a constituir verdadeiras cidades,
mediante a doao de lotes e a perspectiva de dotao de infra-estrutura de
servios urbanos. No tardou que os esgotos sanitrios nessas reas passassem
a constituir um srio problema para o bem-estar e a sade de seus moradores,
preocupando decididamente os governantes responsveis pela iniciativa. Este
empreendimento compreendeu cerca de dez assentamentos, 100 mil lotes de
terreno e viria a abrigar uma populao de mais de meio milho de pessoas,
toda ela situada no Distrito Federal, volta da Capital do Brasil.
nessa ocasio, 1991, que o insigne jornalista Washington Novaes, tambm
expoente na questo ambiental brasileira, na sua condio de Secretrio de
Meio Ambiente do Distrito Federal, usou a sua fora poltica no mbito do
Governo a que servia, na defesa da implantao dos sistemas condominiais
de esgotos como alternativa mais interessante para o enfrentamento daquele
novo e potencial grande problema. A sua estratgia nesse sentido contemplou
etapas sucessivas: primeiramente, o seu prprio convencimento sobre esta
proposta, em seguida, a conquista da adeso do seu Governo e do prprio
governador Joaquim Roriz, passando ao trabalho de informao e discusso
no interior da Companhia de gua e Esgotos de Braslia - CAESB sobre o
novel sistema, at conquistar a radical deciso do Governo favorvel
idia. Uma deciso que, sem dvida, veio de cima!
O autor dos cadernos foi partcipe desse processo desde a sua origem e atuou
como consultor da CAESB durante os dois anos iniciais do programa sua
verdadeira experincia-piloto - alm de ter elaborado, a ttulo de modelo, o
projeto indicativo do sistema condominial de um daqueles assentamentos, a
cidade de Santa Maria, ento projetada para 170.000 habitantes.

191

Empreendimentos condominiais de esgotos no Brasil

Nesse nterim, a CAESB vinha estudando a proposta, inclusive visitando a


cidade de Petrolina que lhe havia sido indicada como a mais interessante
para o intercmbio, bem como promovia debates a respeito, de sorte que a
tomada da deciso pelo Governo j a alcanou informada, e possivelmente
sensibilizada, embora no convencida.
Seguiu-se, ento, diante dessa realidade, a preparao da empresa para
a nova e desconhecida empreitada. E ela veio a contar com um fator
excepcionalmente favorvel iniciativa, que acabara de acontecer no seu
interior: a criao de uma Diretoria de Esgotos e que apartava os seus dois
sistemas operacionais 56. Diferentemente do que se fazia poca, e ainda hoje
o mais usual esta organizao levou os sistemas condominiais de esgotos
para o seu interior e, nas suas sucessivas fases, os projetos, a construo e a
operao. Apenas a promoo da mobilizao social implcita no modelo
e suas correspondentes tarefas na elaborao das ordens de servio dos
ramais condominiais vieram a exigir algo a mais, como se fora um anexo
na organizao, embora que comandado e preenchido pelos seus prprios
quadros 57, como assim permanece, alis, at os dias atuais.
Ficava bastante evidente, desde o incio desse processo condominial, no
Distrito Federal, aquela classificao adotada no Caderno 2, que distinguia
os componentes da engenharia (no sem as caractersticas do modelo) e os
componentes especificamente condominiais. Ou seja, os projetos das redes
bsicas e das unidades de tratamento ficaram com o Gerncia de Projetos
da citada Diretoria de Esgotos, e as obras desses componentes mais a dos
ramais condominiais, com a sua Gerncia de Obras. Diretoria e Gerncias
perfeitamente compenetradas de seus papis. Nenhuma dificuldade maior
alm da necessidade da adaptao aos novos requisitos.
Nos trabalhos especificamente condominiais, o mtodo de transmisso
de experincia foi do tipo aprender em processo, ou aprender fazendo,
onde todos os primeiros passos de todas as tarefas eram executados pela
consultoria sob as vistas da equipe aprendiz, com os passos seguintes
sendo ento dados pela equipe da empresa e sob superviso. Isso at que o
aprendizado se fez suficiente e a consultoria se resumiu apenas ao que de
novo surgisse ou simples superviso do processo. Nessa ocasio a empresa
contou tambm, para os trabalhos de engenharia dos ramais e rede, com a
colaborao do engenheiro Natanael Ramalho, responsvel pelo programa de
Petrolina, conforme visto anteriormente.
Nesse processo de formao e desenvolvimento da empresa no que tange
implementao dos sistemas condominiais, no pode deixar de ser referido
que quatro anos aps este incio que sempre contara com a dedicao
e a profissionalizao da Diretoria de Esgotos e seu quadro tcnico foi
considervel o reforo obtido no governo seguinte, quando foram eles
efetivamente consolidados aperfeioamento das regras de acesso, extenso
ao inteiro universo (inclusive aos Lagos Sul e Norte e suas manses),
definio de prioridades e firme deciso de universalizao.

192

56

Esta estruturao j no prevalece


atualmente na CAESB, que restaurou a
organizao mais tradicional que junta
seus objetivos e distinge funes. O autor
se permite saudar aquela diviso como
altamente salutar, no apenas porque na
CAESB veio a favorecer o desempenho
do programa de esgotamento sanitrio,
mas porque, em qualquer empresa de
saneamento, apartaria funes efetivamente
diferentes e que nessa forma poderiam
ser melhor especializadas. Principalmente,
SRUDEULUXPHVSDoRHVSHFtFRDRVHWRUGH
esgotos, que na organizao tradicional
tende a ser preterido pelo abastecimento
dgua em carter permanente.
57

E a mais um fator favorvel ao programa


HQHVWHFDVRXPDFRLQFLGrQFLDHVVH
anexo, uma novidade para a empresa,
FDULDVREDUHVSRQVDELOLGDGHGRGLOLJHQWH
Engenheiro Csar Risolli, do quadro
da CAESB e um entusiasta do modelo
condominial, desde as suas origens.

Sistema Condominial

14.2 A URBANIZAO E AS SUAS FACILIDADES


As consideraes anteriores foram para demonstrar a maneira acertada
com que os sistemas condominiais entraram no Distrito Federal, seja pela
fora da deciso adotada a seu favor, seja pelo modo atravs do qual a
CAESB se organizou para produzi-los. Agora a vez de considerar outras
facilidades, desta feita pelo lado do universo urbano que viria a ser atendido,
que foram principalmente as trs seguintes:
t a topografia dos assentamentos, de praticamente todos eles, pelos
seus declives suaves e contnuos, na medida, quase, do que so os
desejveis para qualquer sistema coletor de esgotos;
t a urbanizao deles, de dois pontos de vista principais: pela sua
adequada arrumao, juntava-se topografia para facilitar o sistema
coletor; e por ser recente, era quase ausente por completo de
pavimentao das vias e redes enterradas de outros sistemas da infraestrutura, o que tambm facilitador das escavaes e reaterros;
t F QPSMUJNP a tambm recente habitao, muitas vezes at
embrionria, por isso mesmo ainda isenta de outras solues
espontneas para os esgotos e que pudessem concorrer com a
soluo que se apresentava na ocasio, como, por exemplo, os
sistemas unitrios referidos largamente deste ponto de vista. Ao
contrrio, a ausncia de tais sistemas em presena de efluentes que j
comeavam a escoar pelas ruas e quintais constitua um facilitador da
chegada do novo sistema.
Por outro lado, no era apenas facilidades o que existia. Do lado institucional
a limitao de recursos financeiros para investimentos foi uma verdade
durante os primeiros anos do programa, vindo a ser alterada esta condio
quando ele j se havia imposto, pelas suas regras, como algo altamente
participativo pela comunidade usuria na repartio dos investimentos.
Pelo lado da populao, a grande pobreza de uma maioria, agravada pela
simultaneidade com que precisavam ocorrer desembolsos, bastante suados,
para a construo das prprias casas e suas instalaes sanitrias e para a
remunerao que veio a ser estabelecida para os ramais condominiais, de
conformidade com as regras adiante apresentadas.

14.3 AS REGRAS E A SUA FUNDAMENTAL


IMPORTNCIA
As informaes e discusses em Braslia que antecederam a tomada de
sua deciso favorvel utilizao dos sistemas condominiais, e sobretudo
o conhecimento que se tinha de como ele acontecia em Petrolina,
consubstanciaram uma primeira inteno quanto concepo de uma
regra bsica de mesma natureza, com a populao participando do custo do
sistema atravs do pagamento do seu ramal condominial e assumindo uma
tarifa de preo proporcional ao custo. Como foi em Petrolina, at porque isto
193

Empreendimentos condominiais de esgotos no Brasil

vinha ao encontro da escassez de recursos financeiros para investimentos,


na ocasio, para fazer face implantao dos sistemas. A par desse primeiro
ponto de vista, ento, relembrem-se aqueles fatores determinantes das regras
de acesso aos servios, mostrados no diagrama da figura 63 reproduzida do
Caderno 2, para em seguida resgatar-se a forma como foram trabalhados na
construo das regras bsicas do Distrito Federal.

3RVLomRGR5DPDO&RQGRPLQLDO
Quanto posio dos ramais condominiais, em primeiro lugar, com a
urbanizao regular presente em todos os assentamentos, lotes tambm regulares
embora pequenos (8 a 12 m de frente, 15 a 20 m de fundo) e obrigatoriedade de
recuos na frente, ficava evidente a possibilidade de utilizao das trs posies
clssicas para estas unidades, a depender, evidentemente, das habitaes
presentes em cada condomnio e da vontade de seus usurios, ou seja, os ramais
de passeio, os de frente e os de fundo de lote constituram o leque de opes, nas
regras bsicas, quanto a este item da questo.

0RGDOLGDGHVGHLPSODQWDomR
Quanto forma de sua implantao, o programa estipulou, inicialmente,
que seriam eles sempre executados pela CAESB, tendo-se evoludo,
adiante, para a abertura a outra modalidade, no caso aquela da
194

Figura 63
Diagrama das regras bsicas do modelo

Sistema Condominial

$DXWRFRQVWUXomRHP3ODQDOWLQD
Desde o incio do programa condominial
do DF a questo da autoconstruo
dos ramais condominiais esteve latente,
na empresa e na cabea das pessoas,
sobretudo na fase em que os recursos
QDQFHLURVSDUDLQYHVWLPHQWRVHVWDYDP
escassos. Assim que no assentamento
Parano vrias quadras foram facilmente
mobilizadas nesse sentido, aceitando de
SURQWRRGHVDRRTXDOFRQWXGRQmR
chegou a ser concretizado por deciso da
Diretoria da ocasio; e mais adiante uma
SHTXHQDH[SHULrQFLDGRJrQHURYLQJRX
no Varjo, abrangendo quatro quadras
com uma pequena ETE. Mas a grande
H[SHULrQFLDQHVVHVHQWLGRQR'LVWULWR
Federal, a mais relevante parceria para
construo de sistemas condominiais
de esgotos, foi em Planaltina, 100 mil
habitantes, onde em 1996/1997, alguns de
seus bairros, abrangendo 121 condomnios,
2.479 ligaes e 20.000 pessoas aderiram
a essa alternativa construindo os 35 mil
metros de seus ramais condominiais,
FRPGHVHPEROVRVTXHFDUDPQDFDVD
de US$43/famlia (apenas aquisio de
materiais) contra cerca de US$175 que,
poca, seria o custo da CAESB com a
instalao do ramal.Alm desses nmeros
outras marcas foram alcanadas, superando
expectativas, tais como a radical adeso,
TXDQGRQHQKXPDTXDGUDFRXGHIRUDRV
prazos terem sido equivalentes queles que
seriam dispendidos se os ramais fossem
executados por uma construtora (s no
foram menores pelos limites da equipe
tcnica de apoio); e a qualidade dos ramais
condominiais assim construdos resultou
muito boa, com acabamento at melhor que
o de muitas obras contratadas.Na operao,
outra boa notcia foi o menor nmero de
obstrues nesses sistemas relativamente
aos valores mdios das estatsticas da
empresa, o que evidencia que essa forma
avanada de participao naturalmente
estimulante da qualidade na construo
e no uso do sistema pelos seus usurios.
'iSDUDLQIHULUGHXPDWDOH[SHULrQFLDD
par do alcance do objetivo principal - a
soluo dos problemas de esgotamento
VDQLWiULRDRFRUUrQFLDGHXPVDOWRQD
cidadania da comunidade: produo de
uma nova relao, sua, com a CAESB,
desenvolvimento das relaes comunitrias
e de vizinhana e, por certo, crescimento da
fora da organizao social. Essa alternativa
de autoconstruo at hoje admitida como
uma das formas de execuo dos ramais
condominiais. Contudo, quando a CAESB
pde estabelecer o parcelamento para
pagamento dessas unidades quando por
si construdas, esta modalidade tornou-se
mais atraente para a populao e at hoje
a sua preferida.

autoconstruo pelos condminos, com a devida assistncia da empresa na


elaborao dos projetos e no acompanhamento e ensinamento da execuo
da obra. Esta condio decorreu de dois fatores facilmente constatados:
a da extrema facilidade dessa construo, e da sua exeqibilidade pela
comunidade, particularmente quando est ou esteve ela empenhada na
execuo integral da sua prpria casa, conforme foi o esprito do programa
habitacional local; e, de outro lado, o potencial barateamento da obra
nesta forma direta de execuo (ver, a respeito, a caixa de texto com a
autoconstruo em Planaltina).

0RGDOLGDGHVGHVHUYLoR
Quanto a este quesito prevaleceu o que de mais intuitivo e prtico possvel
considerar em presena das possibilidades oferecidas para a localizao
do ramal. Assim, estabeleceu-se que os muros dos lotes seriam divisores
naturais da responsabilidade pelos servios de operao e manuteno, j
que separam, tambm, as propriedades pblica e privada. Pelo lado de fora
deles os ramais de passeio a canalizao tem carter pblico e a sua
manuteno deve ser feita obrigatoriamente pela CAESB; no seu interior,
inverte-se a condio e a responsabilidade passa ao domnio privado,
com cada condmino assumindo o trecho contido no seu lote. Esta ltima
hiptese contempla a ressalva de que, a critrio do usurio, a manuteno do
seu ramal poder ser realizada pela CAESB, com ela sendo remunerada por
cada interveno nesse sentido.

7DULIDVHSUHoRVGRVVHUYLoRV
No Brasil, os sistemas de esgotos operados regularmente por prestadores
de servio so remunerados atravs de um sistema tarifrio acoplado
quele vigente para o abastecimento dgua, sendo quase generalizado nos
sistemas convencionais a conta de esgotos com o mesmo valor da de gua.
Os sistemas condominiais, por seu turno, conseguiram alterar os sistemas
tarifrios que vigiam antes de sua chegada, em todas as empresas a que
servem, mas, infelizmente, no chegaram a alterar a lgica ou a estrutura
de nenhum deles 58, apenas os adequaram para que, correspondendo a
menores custos (principalmente os investimentos) para os seus prestadores,
garantissem tambm menores preos para os seus usurios.
No DF, ento, um coeficiente redutor de 60 % aplicado sobre o sistema
tarifrio do abastecimento de gua, mas apenas para os usurios de
esgotos que tenham ramais condominiais internos (decorrncia do
pressuposto de sua manuteno por eles), ao passo que para os usurios de
ramais de passeio (manuteno pela empresa) no h qualquer reduo
e o preo o mesmo dos sistemas convencionais. Faz-se presente, nisso,
uma evidente injustia, j que os investimentos nas redes coletoras do novo
sistema so inferiores metade daquelas convencionais. Com relao aos
investimentos nos ramais condominiais so eles cobrados por um valor
proporcional aos respectivos custos mdios, conforme a localizao, onde
195

Empreendimentos condominiais de esgotos no Brasil

Tabela 4
Preos cobrados pelos Ramais
Condominiais (em reais, valores de abril de
2008
Fonte: CAESB

aqueles destinados s populaes de menor renda e internos aos lotes,


contemplam um subsdio. A tabela 4 dispe sobre estes valores, que inclusive
podem ser pagos parcelados em at 40 meses.
Os valores assim arrecadados constituem um fundo que exclusivamente
utilizado para as prximas intervenes de expanso do sistema.
Assim, portanto, e em resumo:
t os ramais condominiais so oferecidos nas suas trs posies
clssicas, para escolha coletiva do condomnio;
t cada modalidade de ramal tem seu respectivo custo, o qual
cobrado em parcelas mensais que acompanham a conta dgua, e cujo
produto constitui aquele fundo para novos investimentos do gnero;
t os ramais internos so mantidos pelos seus respectivos usurios
(os quais podero recorrer CAESB desde que assumam o nus de
cada recorrncia), ao passo que os ramais externos sero sempre da
responsabilidade da empresa;
t os ramais internos tm uma conta mensal equivalente a 60% do
valor da conta de gua, ao passo que os de passeio tm o seu
mesmo valor.

14.4 O SISTEMA SANTA MARIA, A TTULO DE


EXEMPLO
As metodologias praticadas no Distrito Federal para a implementao dos
sistemas condominiais, seja nos seus aspectos de engenharia, seja nos seus
segmentos especficos condominiais - na terminologia adotada no Caderno
2 - foi uniformemente praticada nos seus vrios empreendimentos. A
menos, claro, das variaes que decorreram de experincias com materiais,
da natural evoluo de procedimentos com o desenrolar do processo
ou de adaptaes a circunstncias especiais. Essa uniformidade foi uma
conseqncia da obedincia teoria do novo modelo, das prticas da CAESB
e da facilidade oferecida pelos stios e suas urbanizaes. Na engenharia,
particularmente, esta uniformidade se manteve inclusive quando se saltou
das urbanizaes populares para os sofisticados bairros dos Lagos Norte e
Sul, onde esto as mais ricas manses da cidade.
Dessa forma carece de sentido a considerao deste tpico em cada um
dos assentamentos, bairros ou cidades includos no programa condominial
196

58

Em Parauapebas, no Par, onde no havia


cobrana pelos precrios e limitados servios
de gua e de esgotos que antecederam seus
sistemas condominiais, o sistema tarifrio
ento concebido pode seguir uma outra
direo, mais justa e mais equilibrada, salvo
melhor juzo, conforme se ver no Caderno
4 desta srie, ao se abordar a aplicao
do modelo aos sistemas de distribuio de
gua.

Sistema Condominial

de esgotos, o que se constituiria, sem dvida, uma tarefa enfadonha e


desnecessria. Supre-se a lacuna, contudo, com a discusso do Sistema
Santa Maria, que pode representar perfeitamente todo o conjunto, alm
de ser a cidade onde foi maior o conhecimento de causa do prprio autor do
trabalho 59; razes, portanto para que a tarefa no apenas se tornasse mais
fcil, como sobretudo mais precisa. De certo modo o projeto do sistema
coletor desta cidade veio a servir como espcie de paradigma, tendo ele se
valido, to rigorosamente quanto possvel, de tudo o que est na essncia
do mtodo condominial. Uma novidade nele praticada foi a utilizao do
dimetro de 100 mm na sua rede bsica, evidentemente que dentro dos
limites estabelecidos pela hidrulica.
A cidade de Santa Maria est distante 40 km de Braslia e semelhante
s demais cidades criadas nessa poca, nas suas caractersticas fsicas e
urbansticas, todas favorveis a sistemas de esgotos: clima seco e espaos
disponveis que favorecem os mtodos mais naturais de tratamento de
efluentes; topografia com suaves e contnuas declividades e solos arenoargilosos que reduzem e facilitam as escavaes; urbanizao regular e que bem
aproveita a drenagem natural, ensejando uma melhor geometria da rede bsica;
e espaos disponveis no interior dos lotes que confirmam as alternativas de
localizao dos ramais condominiais. Ela foi projetada para uma populao de
170.000 habitantes e atualmente j atinge cerca de dois teros deste contingente.
As fotos da figura 64, anteriores construo do sistema, mostram flagrantes
da instalao do assentamento, j evidenciando um incio da formao de
valas negras que ajudariam a populao na sua busca de um sistema adequado
de esgotos. J as fotos areas, a primeira da poca da construo do sistema
e a ltima quase atual, do uma boa idia da urbanizao da cidade e do
extraordinrio dinamismo de sua ocupao. Isso foi retratado na foto area
da figura 65, da poca da construo de seu sistema de esgotos, na segunda
metade da dcada de noventa.

&RQWUDWDomRGHREUDVHVHUYLoRV

59

O projeto desse sistema foi elaborado pela


Condominium, tendo a frente o autor dos
Cadernos e contou, coincidentemente, com
o engenheiro Pery Nazareth, que viria a ser
o Diretor de Esgotos da CAESB, no perodo
1995-98, quando o sistema foi implantado
e maior foi o dinamismo da CAESB
no desenvolvimento do seu programa
condominial.

O projeto do seu sistema foi contratado com a Condominium, sendo que,


posteriormente, quando da implantao, as unidades de tratamento foram
reformuladas diretamente pela CAESB, j poca comprometida, como
hoje, com o desenvolvimento de tecnologias adequadas realidade local. As
ordens de servio da rede bsica e dos ramais condominiais, assim como a
mobilizao comunitria foram realizadas por equipes mistas de empresa
de consultoria, durante a prpria execuo das obras, e sob a coordenao
direta da prpria CAESB. As obras foram divididas em vrios lotes e
contratadas mediante licitao: uma empresa para cada micro sistema, uma
para cada ETE e uma para os interceptores e emissrios, exercendo-se a sua
fiscalizao diretamente pela contratante. A engenheira Maria Martinele, do
quadro da CAESB, e que hoje uma das especialistas brasileiras na matria
condominial, foi incansvel na conduo desse empreendimento.

197

Empreendimentos condominiais de esgotos no Brasil

Figura 64
Flagrantes da poca da construo das casas em
Santa Maria, com as primeiras valas negras que viriam
a impulsionar o novo sistema de esgotos

198

Sistema Condominial

Figura 65
Vistas da cidade de Santa Maria, na poca
da construo do seu sistema condominial
de esgotos e na atualidade

&RQFHSomRJHUDOGRVLVWHPD
Foi uma caracterstica desta e das demais localidades do Distrito Federal
a implantao, por inteiro, dos seus sistemas condominiais, da porque
no foi utilizado aquele conceito de Plano de Ordenamento que flexibiliza
a concepo de sistemas diante de qualquer disponibilidade de recursos.
Tampouco foram as cidades grandes o suficiente para que exigissem
a elaborao de planejamentos fsicos mais sofisticados, bastando-se,
todas, com estudos e concepo semelhantes aos caractersticos relatrios
preliminares.
Em Santa Maria, a sua concepo est ilustrada na figura 66 adiante
apresentada, de onde se pode perceber a ocorrncia de um divisor de
guas no seu interior, mediano, separando as duas sub-bacias e sugerindo
conforme as indicaes do mtodo - a descentralizao do tratamento
em duas unidades - uma na bacia do Rio Santa Maria; outra, na do Rio
Alagado. Dispensou-se a necessidade de estaes elevatrias e, alm disso,
ainda foi possvel a interligao das duas bacias por um interceptor que
funciona por gravidade, permitindo a transposio dos esgotos coletados
na primeira dessas bacias para a segunda. Este artifcio viria a permitir
uma primeira etapa de funcionamento do sistema com uma nica estao de
tratamento, no caso a do Rio Alagado.

60

Recorde-se que esta a designao de


uma unidade de coleta que rene seus
esgotos num nico ponto, compatvel
com a localizao de uma elevatria,
um tratamento ou simplesmente uma
interconexo com um tronco ou interceptor;
HVWH~OWLPRIRLMXVWDPHQWHRFDVRGDJXUD
apresentada.

$5HGH%iVLFD
A rede pblica, como chamada na CAESB a rede bsica, representada
por um dos seus micro sistemas 60, est constando da figura 67, na qual se
pode apreciar, em detalhes, a conceituao determinante do seu traado
- apenas tangenciando cada quadra, oferecendo-lhe um adequado ponto
199

Empreendimentos condominiais de esgotos no Brasil

Figura 66
Concepo geral do Sistema Santa Maria l
Fonte: Nazareth, Pery (1998). Sistemas Condominiais de
Esgotos e sua aplicao na Capital do Brasil

200

Sistema Condominial

Figura 67
Micro sistema(s) com rede bsica
Fonte: Nazareth, Pery (1998). Sistemas Condominiais de Esgotos e sua aplicao na Capital do Brasil

201

Empreendimentos condominiais de esgotos no Brasil

de coleta para garantir-se numa baixssima extenso que no atinge a


metade da extenso das ruas a que serve, neste caso oferecendo uma mdia
to pequena quanto 2,90 metros por ligao, que foi inferior media do
conjunto do Distrito Federal, salvo melhor juzo, de 3,40 m/ligao.
O seu investimento total, US$ 1.732.333,00 61, comparado sua extenso
de 91.444 m forneceu um valor mdio de apenas US$ 19,00/m, o qual, h
que se convir, deve ser visto como um verdadeiro recorde em se tratando
de um sistema para quase 200.000 pessoas. Este nmero ainda mais
surpreende quando se o decompe segundo suas trs parcelas bsicas: 13%
para inspees (poos e caixas), 19% para os materiais e nada menos que
69% para os servios de assentamento. Ele decorre, evidentemente, das
virtudes do modelo condominial (minimizao de extenso, de escavao
e de interferncias), as quais, neste caso, foram bastante reforadas pelas
facilidades da urbanizao local e da sua topografia, alm da aceitao da
CAESB a inovaes, tais como:
t utilizao, onde o permita a hidrulica, de coletores com o
dimetro mnimo de 100 mm, que, neste caso, alcanou a extenso
de 51.209 m, o equivalente a 56% do total; junto com a extenso
em 150 mm (26.519 m, 29%), este percentual alcanou 85% da
composio da rede, ao passo que apenas 3% representaram os
dimetros iguais ou maiores que 250 mm (2.743 m);
t localizao dos coletores nas caladas at a profundidade de
1,20 m, o que garantiu valores muito baixos dessa grandeza e
a substituio, nesses trechos, do que seriam poos de visita
tradicionais (elevadssimos custos) por simples caixas de inspeo;
t FTUBTDBJYBTEFJOTQFPSFQSFTFOUBSBNEPUPUBMEF
inspees que precisaram ser implantadas, as quais garantiram uma
mdia altamente confortvel de uma unidade para cada 24 metros de
rede.
Os aspectos acima mereceriam uma avaliao meticulosa de desempenho,
pois representam novidades de grande interesse e possivelmente sem
similares em qualquer parte onde esteja aplicado o sistema condominial.
61

2V5DPDLV&RQGRPLQLDLV
Os ramais condominiais foram rigorosamente padronizados quanto
localizao, ao dimensionamento hidrulico e especificao de materiais
e requisitos construtivos. A figura 68 representa um modelo desses ramais,
conforme a CAESB, localizado, no caso, nos passeios. Isto valeu, ento,
desde as quadras e habitaes humildes dos assentamentos mais simples
aos sofisticados bairros dos Lagos Norte e Sul, onde esto localizadas
as melhores manses de Braslia. Uma tal uniformidade de oferta e de
conduta institucional viria a ser determinante, com certeza, para o xito do
programa 62.
202

Esta informao, como as demais de


carter numrico que aparecem no texto
relativas Santa Maria, oriunda do
documento Sistemas Condominiais de
Esgotos e sua Aplicao na Capital do
Brasil (in Nazareth, Pery, 1998). Atente-se,
portanto, que os valores monetrios so
referidos ao ano de 1998.
62

Recorde-se, aqui, uma das diretrizes


mais importantes e justas do sistema
condominial: a de que uma mesma rede
bsica, calcada em mesmos princpios,
capaz de se adequar s mais diversas
urbanizaes e quadras, mediante a adoo,
em cada caso, do ramal condominial mais
apropriado.

Figura 68
Modelo do ramal condominial na CAESB
Fonte: CAESB

Sistema Condominial

203

Empreendimentos condominiais de esgotos no Brasil

Nos dimensionamentos e nas especificaes, praticamente nenhuma


alterao em relao s prticas, s normas e principalmente hidrulica;
vigentes no apenas na CAESB, mas, de resto, no prprio Pas.
Resumidamente: dimetro mnimo (e praticamente nico) de 100 mm,
declividade mnima de 0,005 m/m, tubos de PVC para sistemas de
esgotos, interconexes com a rede bsica atravs de caixas de inspeo
ou poos de visita; recobrimentos mnimos de 0,65 m e 0,30 m conforme
a tubulao esteja situada nos passeios ou no interior dos lotes. Alm
disso, com certeza, apenas especificidades muito localizadas e que esto
mais relacionadas ao meio fsico do que ao modelo condominial. Quanto
localizao dos ramais, a observncia das prescries do modelo condominial
foi a mais irrestrita, oferecendo-se as trs alternativas de localizao j
citadas, cada uma delas com o seu respectivo preo. A escolha final foi, como
continua sendo at hoje, de cada condomnio, e tomada a partir da reunio
realizada em cada um deles, sendo por fim assumida pela maioria dos seus
usurios, seno por consenso.
Nas suas vrias modalidades os ramais condominiais de Santa Maria
atingiram uma extenso de 192.176 m, o equivalente ao dobro da rede
bsica, e somaram um investimento total, de responsabilidade dos
usurios (privado, portanto) de US$ 2.849.115,00, valor que supera em
60% o investimento pblico na rede bsica. Consumiram, por outro lado,
23.350 caixas de inspeo, desta feita acarretando um confortvel ndice
de acesso ao sistema, para limpezas, de uma inspeo a cada 8 metros
de canalizao. Na prtica, uma inspeo por ligao. Esses nmeros,
menos pelos seus valores absolutos e mais pela sua relao, comprovam o
elevado significado do custo dos ramais condominiais no sistema de coleta,
realando, conseqentemente, a importncia da participao dos usurios
nos investimentos do empreendimento.

2WUDWDPHQWRGRVHXHQWHV
As duas unidades de tratamento do Sistema Santa Maria tm a mesma
capacidade 154 l/s, o equivalente a uma demanda de 85.000 habitantes,
cada uma delas e a mesma composio: reatores anaerbios, numa
primeira etapa, seguidos de lagoas de alta taxa numa etapa seguinte,
e ainda, numa etapa final, leitos de disposio no solo. Os reatores,
quatro em cada unidade, dispostos em paralelo, so do tipo UASB e foram
modelados na prpria CAESB, naquela perspectiva j referida de buscar-se
uma maior adequao s condies locais, no apenas quanto aos custos
mas tambm no que toca sua operacionalidade. As lagoas de alta taxa so
em nmero de doze por unidade e tm tempo de deteno de cinco dias. Os
leitos de disposio no solo ainda no foram dimensionados. Elas podem ser
visualizadas na figura 69.
Nesse campo de processamento final dos esgotos, deve-se mais uma vez
ressaltar o interessante trabalho que vem sendo realizando pela CAESB
nos ltimos quinze anos, seja na renovao de consagrados processos, seja
na operacionalizao das vrias unidades, podendo-se constatar, mesmo,
204

Sistema Condominial

Figura 69
Vistas areas das ETES Santa Maria e
Alagados em Santa Maria

que o espao de sua atuao nesse campo j se constitui num verdadeiro


laboratrio, em verdadeira grandeza e tempo real.

14.5 A EXTENSO DO PROGRAMA AOS LAGOS


O Lago Parano, artificial, a principal riqueza natural da cidade de Braslia
e fator fundamental na amenizao de seu clima seco. Os bairros Lago Norte
e Lago Sul esto situados de um e outro lado desse manancial. No seu padro
habitacional, eles fogem por inteiro do estilo residencial mais generalizado
na cidade os blocos de edifcios de apartamentos para abrigarem
exclusivamente manses com algumas caractersticas comuns: elevada renda
dos moradores, beleza e grandiosidade das construes e seus jardins e
uma sistemtica presena de piscinas. A vista area fornecida pela figura 70
permite formar uma boa idia sobre esses bairros.
Pelos seus maiores espaos verdes, a soluo adotada para os seus esgotos foi,
desde as suas origens, as fossas spticas com sumidouros, individualizadas
por residncia. S que o adensamento da rea acoplado aos elevados
consumos de gua foi progressivamente desfazendo esta soluo, em face da
saturao do seu subsolo, com o conseqente aporte, tambm crescente, de
excessos no infiltrados ao Lago Parano. Tudo que no poderia acontecer
aps a sua vitoriosa recuperao de um forte processo de eutrofizao, graas
ao perfeito funcionamento das estaes de tratamento da cidade e que nos
ltimos dez anos, em presena desse fenmeno, foram postas em regime de
excelncia na remoo de nutrientes.
Figura 70
Vista das manses, no Lago Norte de
Braslia, com suas piscinas e grandes
quintais

Impunha-se, portanto, tambm aqui, a implantao de sistema de coleta


para os seus esgotos, j ento numa poca onde o modelo condominial no

205

Empreendimentos condominiais de esgotos no Brasil

2VUHDWRUHVDQDHUyELRV
Com certa razo o engenheiro Pery Nazareth
tem dito que Braslia pode ser tida como a
disneylndia do tratamento de esgotos,
constituindo um grande parque temtico
nessa matria, num raio de apenas 50km,
com uma grande variedade de solues,
do mais simples ao mais complexo, tudo
funcionando. Um passeio e tanto para quem
gosta... E isto decorre de uma longa tradio
da CAESB nessa matria, e que teve, por
certo, seu momento mais expressivo quando
da reforma das suas grandes ETE do Plano
Piloto, voltada para a despoluio do Lago
3DUDQRiHQWmRTXDVHHXWUR]DGR(VWD
oportunidade, ento, somou importantes
YLWyULDVFRQJXURXXPH[SUHVVLYRVXFHVVR
na problemtica do lago, colocou a empresa,
decisivamente, no rol das melhor formadas
a respeito do tratamento - tendo frente o
seu engenheiro Klaus Dieter Neder e ainda
DEULXXPVLJQLFDWLYRFDPSRGHSHVTXLVDV
no DF. Este campo elegeu de sada sua
SUHIHUrQFLDSHORVSURFHVVRVQDWXUDLVH
econmicos, a combinao de modelos e o
uso intensivo dos reatores anaerbios como
primeira etapa do tratamento, caractersticas
estas que estiveram presentes na concepo
dos projetos de tratamento de esgoto na

206

empresa. No caso dos reatores anaerbios,


as condies locais favorveis, com solo
normalmente estvel e lenol fretico
profundo, favoreceram o desenvolvimento de
solues construtivas bastante econmicas
e arranjos inovadores de tratamento. Uma
soluo corriqueira, por exemplo, o reator
anaerbio escavado no solo, com taludes
acentuados em toda a volta e sem paredes
de conteno de concreto armado. Elas so
simplesmente protegidos com argamassa
armada (em alguns casos o foram apenas
com manta plstica); os separadores de fase
so telhas de alumnio, montadas sobre uma
estrutura geralmente de madeira semelhante
a uma estrutura de telhado; e o sistema de
GLVWULEXLomRGHYD]mRpVLPSOLFDGR&RP
LVVRWXGRDREUDFDPXLWRHFRQ{PLFDHD
construo facilitada. Esse tipo de reator
custa uma frao daquele convencional, com
tanque de concreto, e o seu desempenho
RSHUDFLRQDOFDGHQWURGRHVSHUDGRSDUD
TXDOTXHUXQLGDGHGRJrQHUR8PDUUDQMR
inovador de tratamento desenvolvido na
empresa o qual desperta muito interesse
o reator anaerbio incorporado lagoa
de estabilizao, conforme esquema da
LOXVWUDomRQDJXUDDEDL[RGD&$(6%

Sistema Condominial

Os Lagos e os seus ramais


FRQGRPLQLDLV
Os bairros dos Lagos Norte e Sul,
de Braslia, como j se sabe, se
caracterizam pela generalizada
presena de ricas manses com
SLVFLQDVTXDGUDVGHWrQLVH
churrasqueiras em seus jardins e
quintais.
O destaque a eles quando se fala de
VLVWHPDVFRQGRPLQLDLVVHMXVWLFD
pela importncia que viriam eles a ter
na histria desses sistemas, quando
WURX[HUDPDGHQLWLYDFHUWH]DGHTXH
seriam eles adequados a todas as
formas de urbanizao.
Desde que adequados fossem os
seus respectivos ramais condominiais
- evidenciando-se, alm do mais,
a ultrapassagem de eventuais
preconceitos com os ramais internos, j
que so eles majoritrios nessa rea de
elevada renda.
Assim, ento, se juntam a este
destaque algumas fotos que exibem as
mais diferentes posies dos ramais
condominiais: nas caladas, nos
jardins, nos quintais; driblando piscinas,
TXDGUDVGHWrQLVRXRXWURVREVWiFXORV
GRJrQHUR

deixava dvidas sobre seu excelente desempenho, mesmo onde as condies


de urbanizao e de uso seriam, sem dvida, inferiores quelas desses
sofisticados bairros. E veio a eles, o sistema condominial, com as mesmas
regras e mesmos procedimentos, variando apenas o preo cobrado pelos
ramais condominiais em face s maiores testadas dos lotes e maiores
obstculos a vencer (ver tabela 4, anterior), abrangendo uma populao
que supera os 30.000 habitantes e que dividiu sua preferncia entre as trs
modalidades oferecidas para a localizao dos ramais os passeios, os jardins
e os fundos de lotes.
Da mesma forma que nas outras localidades, no faltaram, aqui, as
reunies condominiais, a eleio dos sndicos e as escolhas pela maioria dos
condminos, sendo evidente que apenas a forma das reunies se ajustou ao
diferenciado padro sociocultural dessa populao,constando, por exemplo,
que algumas delas chegaram a ser regadas com usque e outras tiveram a
participao de importantes prceres da Repblica. Construiu-se, assim, mais
um importante passo na caminhada dos sistemas condominiais.
207

Empreendimentos condominiais de esgotos no Brasil

14.6 ALGUMAS CONSIDERAES SOBRE O


PROGRAMA
O programa de sistemas condominiais do DF est muito perto de alcanar
a sua maioridade, tendo sido desenvolvido continuadamente desde a sua
origem, no incio dos anos noventa, at o estgio atual. Hoje ele atende
mais de 1 milho de pessoas em pelo menos 23 cidades, j equivalendo,
em nmero de usurios, ao sistema convencional, conforme os nmeros
da tabela 5. E, muito importante, esse regime permanente de implantao
se constitui na garantia de alcance da perspectiva do atendimento
pleno crescente populao local aquele seu objetivo fundamental,
conceituado no Caderno 1 desta srie. Isso implica dizer que, desde
aquele j longnquo ramal condominial no Jardim Roriz, o primeiro
da histria, jamais outra modalidade de coleta de esgotos foi realizada
no territrio do Distrito Federal. Nessa sua j longa caminhada,
plenamente consolidada, importante destacar alguns aspectos que ao
autor pareceram importantes considerar sobre o programa e sobre a
empresa prestadora dos servios. Por exemplo:
t a universalizao do atendimento e sua grande escala de aplicao,
graas aos seus menores custos e ao seu compartilhamento com a
sociedade;
t o modelo nico atendendo aos mais diferentes estratos sociais,
econmicos e habitacionais, sob mesmas regras e sepultando um
potencial apartheid com sistemas de ricos e sistemas de pobres;
isto favorece a qualidade dos servios prestados aos pobres e d
credibilidade soluo aos olhos da populao como um todo;

208

Tabela 5
Os nmeros atuais dos sistemas de esgotos
no Distrito Federal

Sistema Condominial

$LUULJDomRHP6DQWD0DULD
Braslia pode ser vista como a
cidade dos parques, dada a
exuberncia de suas reas livres;
mas parques que nas duas metades
do ano se apresentam de cores
diferentes: verdes na estao das
chuvas, marrons na estao seca,
absolutamente seca. Braslia,
j se disse acima, bem poderia
ser, tambm, a disneylndia
das estaes de tratamento de
esgotos. Em tais circunstncias,
portanto, bem se poderia indagar se:
)UDQFDPHQWHWHULDPRVHXHQWHV
desses tratamentos funo mais
interessante do que esverdear
Braslia e seus parques o ano
inteiro, ao serem utilizados para uma
segura irrigao? Foi nesses termos
que ao ensejo do Projeto Indicativo
do Sistema Condominial de Esgotos
de Santa Maria, a Condominium
chegou a propor e a fazer um
primeiro desenho de uma pioneira
LUULJDomRFRPHXHQWHVDRUHGRU
dessa cidade. Ela ocorreria por
gravidade, alcanaria 500 hectares
HSURGX]LULDXPSyORGHRULFXOWXUD
capim para o gado das imediaes
e um pequeno campo experimental
para outras espcies, como embrio
GHRXWURVWDQWRVSDUTXHVGRJrQHUR
e do esverdeamento dos parques j
existentes de Braslia.
A idia chegou a deslumbrar setores
do Governo, o prprio Governador
Roriz, permanece at hoje latente,
mas no se mostra exeqvel,
com justia, do ponto da vista da
CAESB. que foraria caminhos
para a empresa situados alm das
suas obrigaes institucionais
DQDOOLPLWDGDVDRWUDWDPHQWRTXH
ela to bem pratica j que no
foram viabilizadas as parcerias
interinstitucionais que pudessem
atribuir as novas funes implcitas
neste campo a quem as tivessem
como parte de seus prprios
objetivos. Quem sabe um dia.

63

Considerao de um simples projeto


indicativo para ultrapassagem da burocracia
QDQFLDPHQWRVOLFLWDo}HVDTXLVLomRGH
materiais, programaes, etc) e substituio
dos complicados (e sempre inexequveis)
projetos executivos pela simplicidade das
ordens de servio j durante as obras
(momento que nico para ver tudo,
sobretudo no subsolo).

t comprovada qualidade dos sistemas implantados e dos servios


prestados, atestada pela satisfao dos usurios, pela normalidade do
desempenho em tantos anos de ocorrncia e pela naturalidade com
que so vistos e trabalhados pelos setores de operao e manuteno
da CAESB;
t feliz construo das regras que disciplinam o acesso dos usurios ao
servio e firme comportamento na sua generalizada aplicao longe
de privilgios ou diferenciaes entre setores;
No que toca, por outro lado, CAESB enquanto corporao, seu
comportamento face ao novo modelo, as consideraes que parecem mais
interessantes so as seguintes:
t a evoluo da empresa e de seu corpo tcnico ao longo desse
processo, desde uma posio de dvida e at de restrio ao
novo sistema, aos nveis atuais de sua aceitao, tida e havida,
simplesmente, como plenamente radicada nos procedimentos e na
cultura da empresa;
t OBJNQMBOUBPEPTTJTUFNBT I QPSQBSUFEPTUDOJDPT OPBQFOBTB
plena absoro dos novos procedimentos caractersticos do modelo, mas
a satisfao com a sua simplificao, sem qualquer perda de qualidade,
em relao ao que eram as prticas vigentes 63; e com a entrada das
atividades sociais, antes inexistentes, a compreenso do quanto so
elas as responsveis pela adeso do usurio e, em conseqncia, pela
universalizao do atendimento e melhor uso do servio;
t TPCSFBPQFSBPEPTTFSWJPT QPSPVUSPMBEP BPCTFSWBP
cabvel tem outra conotao e bastante curiosa: que passa
praticamente desapercebido o que sejam sistemas condominiais ou
convencionais, a ponto de ser at difcil uma anlise estatstica das
ocorrncias de uns e outros para avaliao de desempenho.
Especificamente sobre a operao dos sistemas, talvez a informao mais
desejada pelos interessados, precisa ficar bastante claro que em igualdade
de definies na hidrulica, no projeto, na obra, na qualidade do uso
do servio (pelos usurios) e nas atenes com a operao (por parte
do prestador do servio), apenas os ramais condominiais podem
ser distinguidos dos sistemas convencionais. No seu desempenho,
independentemente da posio que tenham na quadra, pelo fato de
apresentarem como novidade o uso de tubulaes de 100 mm para a coleta
de vrias casas (O que isto representaria de bom ou de mal para a operao?);
e na manuteno, no caso dos ramais internos pactuados para esta atividade
realizada pelos usurios (Estariam estes usurios realizando a citada
manuteno?).
Sobre esta ltima condio no h respostas a considerar, simplesmente,
porque nem a CAESB e nem qualquer outro prestador do servio a
estudaram a fundo (ou se o fizeram no tornaram pblicos os resultados,
o que seria a forma adequada para aferir a questo). Conforme se ver na
209

Empreendimentos condominiais de esgotos no Brasil

Tabela 6
Dados da manuteno dos sistemas de
esgotos no Distrito Federal
Fonte: CAESB

abordagem de Salvador, sabe-se quantas so as ocorrncias do gnero com


suas correes solicitadas ao prestador do servio, mas no se sabe quantas
de mesma natureza teriam sido diretamente realizadas pelos usurios 64. J
da primeira questo, relativa ao dimetro de 100 mm, foi possvel sacar da
CAESB algumas indicaes a respeito, uma pena que j antigas. Elas esto
na tabela 6, e dizem respeito ao ndice de 0,86 ocorrncias por quilmetro
nos ramais condominiais sejam quais forem contra 1,32 apontado para
os ramais convencionais, o que ainda se torna mais relevante quando se
considera que as anotaes dos condominiais incluem aquelas localizadas
nas suas intersees com os ts ou caixas das sadas das casas. Na mesma
tabela, o menor ndice de ocorrncias na rede convencional do que na rede
bsica condominial no deve ser visto como diferenciador dos modelos, j
que so eles, em princpio, equivalentes em todos os aspectos tcnicos. A
diferena, ento, dever decorrer de parmetros externos aos modelos, tais
como a forma de uso do servio dentro das casas e o patamar de qualidade
da infra-estrutura urbana que afeta os servios de esgotos, tais como a
pavimentao das vias, a drenagem e a coleta do lixo. No caso concreto
de Braslia, fato que os sistemas convencionais, os mais antigos, esto
predominantemente nas reas mais antigas, que so as de mais alta renda
(melhor uso do servio) e de melhor infra-estrutura (menos perturbadora do
sistema de esgotos). Uma criteriosa reflexo a respeito dessas nuanas de
fundamental importncia para o bom entendimento da problemtica.

14.7 O QUE FOI TIMO E O QUE PODERIA TER


SIDO MELHOR
Os sistemas condominiais no DF e na CAESB so, sem qualquer dvida,
as melhores referncias desses sistemas, no Brasil, conquanto tenham sido
poupados daquelas sabidamente mais difceis incurses do servio, que
se realizam em favelas, assentamentos e afins ausentes no seu territrio,
mas muito expressivos nas maiores cidades do Pas. A bem da verdade,
todos os seus espaos urbanos so amplamente favorveis a sistemas
coletores de esgotos.

210

64

Mesmo sem nenhuma indicao concreta


DUHVSHLWRGiSDUDGHVFRQDUFRQWXGR
que no deve ser pequeno este nmero,
simplesmente pelo incmodo que representa
uma obstruo no interior dos lotes (ou das
prprias casas) quando pode ser bastante
simples a sua operao imediata pelo
prprio usurio, para no se ter de aguardar
pelo prestador do servio por perodos que
costumam ser desconfortveis.

Sistema Condominial

Essa condio aponta para a necessidade de identificar os fatores (mais)


determinantes desse xito, como forma de estimular as condies para
a sua ocorrncia noutras paragens. Tambm se identifiquem, diante de
quadro to favorvel, aqueles outros aspectos que poderiam ter sido
melhorados, ou que at mesmo deixaram de ser profcuos.
Iniciando pelos fatores propulsores, parece mais objetivo e marcante que
sejam pontuados um a um, o mais resumidamente possvel, como a seguir,
salientando-se a importncia do primeiro deles e sua feliz interferncia nos
demais:
t a deciso poltica sempre firme de adotar o sistema, quando da
sua introduo, no governo Joaquim Roriz, e ainda mais vigorosa de
manter, aprofundar e desenvolver a sua aplicao no governo seguinte
de Cristovam Buarque 65; deciso essa que atravessou os governos
seguintes e se instalou como normalidade absoluta no Distrito
Federal;
t o seu estabelecimento como alternativa nica para todos os setores
urbanos, geogrficos e sociais - ricos e pobres, Plano Piloto, cidades
ou assentamentos - justamente pela sua condio de bem adequarse s mais diferentes situaes, o que confere elevada credibilidade
soluo e ao prestador do servio, perante a populao usuria;
t a boa arquitetura das suas regras e das condies de adeso ao
servio (coerentes, consistentes, objetivas, sustentveis, compatveis
com as condies locais), bem como a firme atribuio efetiva das
decises sobre os padres do servio ao condomnio (modalidades
de implantao e de manuteno e posio do ramal, seus preos e
tarifas, etc), que favoreceram os processos de adeso da populao ao
sistema;
t a criao do fundo de apoio construo acelerada dos sistemas,
alimentado pelos recursos advindos dos pagamentos dos ramais
condominiais pelos seus respectivos usurios (este fundo, alis de
substancial importncia como fonte de recursos financeiros foi,
tambm, pela forma como foi difundido, grande motivador da adeso
dos usurios);
65

Neste governo, sem nenhum demrito para


o anterior, cumpre realar fatos que foram
concorrentes no bom encaminhamento do
processo condominial: a simpatia do prprio
governador pela idia, a forte presena do
Engenheiro Hermes Matias de Paula como
Secretrio do Governo justamente da rea
que contemplava o saneamento (ele que foi
pioneiro, no Distrito Federal, como entusiasta
do condominial) e o grande compromisso
da diretoria da empresa com o programa,
particularmente dos engenheiros Marcos
Montenegro, diretor presidente, e Pery
Nazareth, diretor do Sistema de Esgotos.

t a qualidade dos sistemas implantados e dos servios prestados


(- qualidade fundamental independentemente da soluo!), que
reflete a competncia tcnica e gerencial da CAESB;
t a especial ateno conferida ao programa, de maneira inequvoca,
pela especfica Diretoria de Sistema de Esgotos como sua
condutora, desde a origem dos sistemas e durante todas as suas etapas
de consolidao; foi uma decorrncia dessa circunstncia a razovel
institucionalizao alcanada pelos sistemas condominiais, inclusive
na sua rea de manuteno;

211

Empreendimentos condominiais de esgotos no Brasil

t a objetividade (e a descomplicao) do processo de implantao


dos sistemas praticada pela CAESB, que compatibilizou prazos
e massificou o atendimento, evidenciando grandes facilidades
alcanadas pelo modelo tambm deste ponto de vista, em relao aos
sistemas tradicionais;
t desenvolvimento de aes voltadas para o aperfeioamento do
modelo, sobretudo nos seus aspectos fsicos e sociais, no que se
deve destacar pelo menos trs setores de atividades: a prtica da
autoconstruo como alternativa de forte mobilizao da populao e
de barateamento de custos;
t a otimizao de redes bsicas experimentada em alguns
assentamentos, atravs da utilizao, em grande escala mas em
obedincia hidrulica, de dimetros de 100 mm; a criativa
adequao de estaes de tratamento, particularmente reatores
anaerbios, s condies fsicas locais, com significativas redues nos
investimentos;
t FOBMNFOUF PTGBUPTFYQSFTTPTFNONFSPTFiDPOUSBPTRVBJTOPI
argumentos, conforme conhecido adgio popular: mais de 1 milho
de pessoas atendidas, todos os estratos de renda e de habitao,
70.000 condomnios, 70.000 reunies...
Quanto ao que poderia ter sido melhor, numa circunstncia to favorvel e
ainda h tempo para isto h que se convir que, em sua maioria, seriam de
certo modo dependentes de articulaes com outros agentes institucionais. Isto
uma considervel razo para que no se tenha realizado. As questes mais
relevantes, nesse sentido, seriam, por exemplo, as consideradas a seguir.
Talvez a mais importante, nesse sentido, seria o desenvolvimento
de pesquisas de processos naturais de tratamento de efluentes que
explorassem fatores presentes no meio fsico local e que parecem
preciosos como recursos para o processamento dos esgotos, tais como a farta
disponibilidade de terras pblicas potencialmente utilizveis, as baixssimas
umidades em presena da ausncia de chuvas numa metade do ano, alm
da ensolao e evaporao considerveis. No se tem dvida do potencial
tcnico da empresa nessa direo, haja visto o muito que j foi feito em
desenvolvimento tecnolgico aplicado ao tratamento de efluentes, aos quais
se buscou a maior adequao de suas unidades s condies locais.
Numa linha que desdobra a questo anterior vem a proposta do reuso de
efluentes para a irrigao de campos agricultveis e, sobretudo, parques e
jardins da Capital Federal. Como sabido, durante a metade do ano em que
no h chuva, esses espetaculares espaos (inigualveis, por certo, no mbito
mundial) permanecem secos e numa desagradvel colorao marrom, quando
poderiam, irrigados com os disponveis efluentes tratados nas suas dezenas
de estaes, estarem exuberantemente verdes durante todo o ano. Neste caso,
bvio que a CAESB funcionaria como uma fornecedora, demandando o

212

Sistema Condominial

preenchimento das atividades relativas utilizao dos efluentes por parte de


outras instituies do governo distrital setores da pasta de Agricultura, para
o aproveitamento na produo agrcola; setores com a responsabilidade pelos
parques e jardins, para a outra forma de irrigao.
A ltima questo fica como uma sugesto. No especificamente para a
CAESB ou mesmo para o prprio governo do Distrito Federal, os quais, de
resto, esto com os seus problemas de esgotos inteiramente resolvidos,
mas para o Governo Brasileiro, para as suas instncias que tm consigo o no
resolvido setor do esgotamento sanitrio. Seria a idia da considerao do
conjunto dos sistemas condominiais do Distrito Federal como um grande
laboratrio nacional do saneamento, com o apoio da Universidade de
Braslia, voltado no apenas para as questes do desenvolvimento tecnolgico
das unidades fsicas, mas tambm para o desenvolvimento operacional nas
suas vrias frentes e para a formao de pessoal. Que se preocupasse, por
exemplo, com o conhecimento do que se passa no interior das casas com
relao ao uso dos servios de gua e de esgotos, particularmente no que
tange aos desperdcios do abastecimento e ao ingresso de guas pluviais
nos sistemas de esgotos, j que esses problemas esto situados dentre os
no resolvidos do saneamento do Brasil, e como tal so responsveis por
considerveis prejuzos. Que extrapolasse tambm o seu territrio na busca
de assentamentos pouco ou nada urbanizados e favelas e que neles buscasse
o aprendizado para melhor operar os seus servios, j que este , sem dvida,
um ngulo vergonhoso do saneamento, desta feita pelo absurdo da injustia
social que atinge os mais pobres com o mais que precrio atendimento.

213

Empreendimentos condominiais de esgotos no Brasil

15. RECIFE
15.1 O PLANO DE ORDENAMENTO DOS SEUS
ESGOTOS
Recife 66, capital de Pernambuco, tem 1.400.000 habitantes e situa-se numa
plancie que contm os esturios dos rios Capibaribe, Beberibe e Tejipi,
completando-se nos morros que desenham uma ferradura sua volta e em
cuja abertura est a Praia da Boa Viagem. Mais da metade da sua rea de
plancie foi conquistada por aterros que quase nunca tiveram as obras de
drenagem que compensassem os espaos perdidos pelas guas, com o que
a cidade se tornou extremamente problemtica deste ponto de vista. O seu
sistema de esgotamento sanitrio regular, separador absoluto, remonta ao
incio do sculo passado, foi discretamente expandido nos anos sessenta
e hoje no atende, sequer, quarta parte da cidade. Pode-se depreender,
assim, a gravidade do problema do saneamento da cidade uma plancie
muito baixa, grande parte conquistada aos mangues, muito limitada no
seu sistema de drenagem e ainda mais no de esgotamento sanitrio. Este
ltimo sistema sempre foi da responsabilidade do Estado, representado
pela Companhia Pernambucana de Saneamento (COMPESA), nos ltimos
quarenta anos. Mas nesta empresa os investimentos para este setor so,
com certeza, daqueles que no conseguem vencer a disputa com os do
abastecimento dgua 67.
A partir da segunda metade dos anos oitenta, quando a situao atingia
quase o caos, desse ponto de vista alagamentos em qualquer chuva,
contaminao generalizada de suas guas - a Prefeitura intensificou
bastante as obras de drenagem da cidade, reduzindo-lhe substancialmente
os alagamentos, mas, em compensao, o seu sistema de canais e galerias
pluviais foi progressivamente invadido por esgotos, falta de sistema
regulamentar. Como resultado desse processo, visvel que a cidade afastou
os esgotos das casas, principalmente na estao sem chuvas, mas apressou
a sua chegada aos corpos dgua, poluindo-os literalmente, e apenas a
Praia da Boa Viagem, por uma feliz circunstncia, se manteve a salvo
desse problema. que ela atravessada por um canal (o do Setbal) em
toda a sua extenso, o qual lhe serve de dreno e de receptor de efluentes
mal resolvidos com o que se transformou numa verdadeira cloaca - mas
realiza seus despejos nas suas extremidades opostas, em esturios que
ganham o mar atravs de correntes marinhas que no se aproximam desta
praia.
Na mesma poca dos investimentos na drenagem, a municipalidade, no
vazio que deixava a COMPESA, fazia tambm algumas incurses no campo
do esgotamento sanitrio, mediante a implantao de pequenos sistemas
condominiais nos assentamentos sub urbanizados ou favelas onde este
problema era maior. Eles foram incontveis, quase nunca mereceram a
operao do prestador oficial do servio e desgastaram-se em sua maioria 68.
Mas a iniciativa municipal que se considerou importante narrar
aqui ocorreu na segunda metade dos anos noventa, com o Plano de
214

66

Dentre todos os empreendimentos


condominiais que esto sendo objeto
deste Caderno, sem dvida este o mais
prximo do autor. Com efeito, alm de
cidado recifense e morador desde sempre,
foi consultor de vrios estudos sobre o
saneamento da cidade realizados a partir
de 1968 (ACQUA-PLAN) e ainda seu vicePrefeito no perodo 1986/88 (quando foi o
condutor deste setor da cidade) e Secretrio
de Saneamento e Meio Ambiente do Estado,
de 1987 a 1989, quando a sua atuao
principal, obviamente, foi nessa Capital.
/HPEUDPVHDUHVSHLWRUHIHUrQFLDVQR
Caderno 1 sobre essa situao comum
no Brasil, nas empresas que cuidam
simultaneamente dos sistemas de gua
e de esgotos. A empresa estadual de
Pernambuco uma delas, particularmente,
no que tange sua Regio Metropolitana,
historicamente atendida por servio
intermitente de abastecimento dgua.

67

68

Nos ltimos oito anos, uma secretaria


HVSHFLFDPHQWHYROWDGDSDUDVDQHDPHQWRQR
mbito municipal est procurando recuperar
HVVHVVLVWHPDVHPHGLDQWHFRQYrQLR
estabeleceu uma interessante diviso de
responsabilidades com a COMPESA: ela,
Prefeitura, cuida, nessas reas, das casas
- seus ramais, suas instalaes sanitrias
- e da educao ambiental; a empresa
prestadora do servio assume a operao
das parcelas pblicas dos sistemas e dos
procedimentos comerciais. A parceria
bastante interessante, mas est apenas no
seu comeo.

Sistema Condominial

Ordenamento do Sistema de Esgotos do Recife, ao qual se seguiu uma


proposta de Modelo para Gesto e Operao de Servios de gua e Esgotos
da mesma cidade 69.
O Plano de Ordenamento inspirou-se, basicamente, em trs questes
bastante visveis poca, e que destacavam o absoluto imobilismo do setor
nos ltimos tempos. A primeira foi a crtica aos planejamentos tradicionais
de sistemas de esgotos realizados para a cidade e que idealizavam concentrar
os efluentes coletados em poucas estaes depuradoras, tornando muito altos
os investimentos de qualquer dos subsistemas assim formados. A segunda
foi o surgimento de dezenas daqueles pequenos sistemas condominiais que
tinham comeo, meio e fim (na sua independncia), mas no se situavam
numa perspectiva de integrao na cidade vista em seu todo. E, por ltimo,
nas idias de um plano emergencial de combate clera (a poca era de
ameaa real de uma epidemia regional), tambm de iniciativa da prefeitura.
Na sua concepo, por seu turno, este plano buscou os seus fundamentos
no sistema condominial: o gradualismo, a descentralizao, a integrao de
aes, os condomnios, a adequao realidade... e constou, basicamente,
de trs grandes segmentos que, no conjunto, formularam uma interessante
estratgia. o que se apresenta a seguir, quase que transcrito do prprio
documento original.

$V8QLGDGHVGH&ROHWD8&V
Consiste na subdiviso da cidade em reas conceituadas como Unidades
de Coleta UCs, onde cada umas delas pode limitar-se reunio dos
seus esgotos para um processamento conjunto com o de outra(s) UC(s)
ou, por outro lado, pode contemplar o prprio processamento, quando
ento constituiria um micro sistema, na terminologia condominial, em
carter definitivo ou provisrio, a depender da viabilidade econmica e da
disponibilidade momentnea de investimento. As referncias principais
para a delimitao geogrfica das UCs foi a presena de, no mximo, uma
estao elevatria em sua extremidade (profundidade mxima de 3 a 3,50
m vista como a mais interessante para as condies locais), alm de evitarse a presena de travessias em seu interior que pudessem complicar-lhe o
custo e o processo construtivo (avenidas, linhas frreas, metr, canais, rios
etc). Procedendo dessa forma, e deixando de lado as reas com sistemas j
existentes, foram ao final delimitadas 98 Unidades de Coleta na rea do
Recife.
A figura 71 delimita estas Unidades de Coleta do Recife em um mapa
reduzido do territrio da cidade, elaborado pela sua Prefeitura.

69

Ambos contratados Condominium, o


primeiro diretamente pela Prefeitura e o
ltimo pelo PMSS como medida de apoio
iniciativa municipal e com o beneplcito do
Banco Mundial.

8PDSROtWLFDSDUDRSURFHVVDPHQWRQDO
A respeito do processamento dos esgotos foi importante a constatao inicial
de que exceo daquela praia com a sua proteo natural, todos os demais
cursos dgua do interior da cidade estavam fortemente poludos; e mais,
215

Empreendimentos condominiais de esgotos no Brasil

Figura 71
A delimitao das unidades de coleta do
Recife
Fonte: Prefeitura da Cidade do Recife

216

Sistema Condominial

os seus extravasamentos por ocasio das chuvas constituam evidente risco


para a populao. Da a combinao da descentralizao, do gradualismo
e da interao de aes no equacionamento dessa parte do sistema. A
descentralizao, na forma j explicada com as UCs; a integrao, com o
sistema de drenagem, fazendo por onde o alargamento das calhas dos cursos
dgua se constitusse numa prioridade de modo a garantir, a qualquer poca,
o confinamento das guas poludas, livrando a populao do seu contato; e o
gradualismo, na utilizao de um tratamento parcial dos esgotos extensivo a
toda a cidade, ao invs do pronto e acabado, que fatalmente se restringiria
a uma parte. Os benefcios, portanto, chegariam mais rpidos e tenderiam
maior abrangncia. Em ltima anlise, cada curso de gua estaria
confinado e progressivamente menos poludo.

2PRGHORGHWUDWDPHQWR
Quanto ao tratamento a adotar nesta etapa inicial, a recomendao do Plano
de Ordenamento foi pela opo preferencial pelos reatores anaerbios
de lodo fluidizado, segundo a modelao desenvolvida e largamente
empregada, poca, no Paran, pela sua empresa estadual, a SANEPAR. Eles
atenderiam amplamente s exigncias do esturio receptor quanto presena
de matria orgnica (reduo de 70 a 80% do teor de DQO e de 75 a 85% no
de DBO), demandariam pequenas reas para sua instalao, apresentariam
baixo custo de implantao ( poca, de 10 a 15 dlares por habitante) e
ainda teriam baixos requisitos operacionais. Situaes especiais (presena de
fortes poluidores, por exemplo) demandariam solues especiais.
Com relao futura complementao desse primeiro e insuficiente
tratamento, entendia-se, poca, que os tempos futuros onde ocorreriam
essas necessidades, conspirariam a seu favor, com o desenvolvimento
que j ento se vislumbrava de pesquisas voltadas para a otimizao dos
tratamentos mais avanados e em unidades menores. Evidentemente que
a poca de implant-los constituiria, novamente, mais uma oportunidade
de reexame da questo da maior ou menor descentralizao, e da eventual
reviso do modelo adotado no tratamento primrio.

15.2 UMA NOVA FORMA DE GESTO


O Plano de Ordenamento do Recife, anteriormente sintetizado,
surpreendeu positivamente o sistema institucional de alguma forma
envolvido na problemtica da cidade, no apenas os regionais como a
COMPESA e a FIDEM (Fundao para o Desenvolvimento Metropolitano),
mas tambm organismos mais distantes como o prprio PMSS, patrocinador
destes Cadernos Condominiais, e o Banco Mundial. Em razo, justamente,
dos menores custos revelados, das maiores facilidades de implantao e,
principalmente, do seu carter estratgico. Mas tambm se antevia, nesta
oportunidade, a potencial capacidade do Plano de Ordenamento de
atrair investimentos da iniciativa privada. Como se as Unidades de
Coleta passassem a ser vistas e tambm consideradas como Unidades
217

Empreendimentos condominiais de esgotos no Brasil

de Mercado, as UMs. As primeiras concretamente representadas por seu


sistema fsico, as ltimas por sua rentabilidade.
Em relao possvel participao de empresas privadas, contudo, dois
fatores contraditrios estavam presentes na proposta e precisariam ser
melhor equacionados: de um lado, o aspecto favorvel dessa flexibilidade
(tantas UCs, tantas possibilidades de seus grupamentos, diferentes portes de
investidores) e de outro, a diversidade dessas unidades na sua rentabilidade,
fator, como se sabe, fundamental em face desses novos objetivos.
Nessas circunstncias, portanto, haveria de ser modelado tal Sistema de Gesto,
contemplando a iniciativa privada dentre os possveis prestadores de servio. Ao
novo no plano fsico, acrescentar-se-ia, agora, o novo no plano institucional. Ou
seja, o sistema de esgotos do Recife sendo levado ao mercado.
Essas Unidades de Mercado foram meticulosamente caracterizadas quanto
s suas rentabilidades, a partir de estimativas dos seus investimentos, custos
operacionais e potenciais receitas, sendo apropriadas atravs do quociente
da diferena entre as receitas e os custos totais pelos investimentos. A base
adotada de tarifas foi a que vigorava poca na COMPESA para os sistemas
condominiais (1997), ao passo que os custos foram apropriados na forma
mais abrangente, incluindo-se as depreciaes cabveis e a remunerao do
capital razo de 1 % ao ms. Os resultados obtidos abrangeram 1.280.000
habitantes 70 e a rentabilidade mdia do empreendimento global foi de nada
menos que 0,35 % ao ms ou cerca de 4,2 % ao ano, sendo que o intervalo
em que esteve ela situada foi to grande quanto: -2,75 % < rentabilidade
< 3,60 %, ao ms, respectivamente nas UCs 33 e 87. A figura 72 dispe
estas Unidades de Coleta do Recife, simbolicamente, segundo seus centros
geogrficos, conforme o modelo matemtico trabalhado poca para a
apropriao de seus elementos numricos que culminavam com o clculo de
suas rentabilidades.
Saltou vista nesses resultados, portanto, aquilo que seria uma conseqncia
natural da precria distribuio de renda do Recife: a diversificada
rentabilidade das UCs, e que naturalmente se traduziria em diversificada
atratividade para as empresas. Esse quadro, quando se colocou o objetivo
principal do atendimento pleno da populao, com uma eqitativa
operao dos servios nas diversas reas, sugeriu a compatibilizao entre
a atratividade do capital, a minimizao da participao financeira do
Estado e a operacionalidade do sistema de gesto.
Os estudos ento realizados contemplaram as mais diversas alternativas
quanto aos potenciais participantes (COMPESA, Prefeitura, empresa
privada) e quanto s funes passveis de serem assumidas por cada um
deles investimento (subentendendo-se que a execuo da construo e
a operao do servio so funes secundrias determinadas/ditadas por
quem tem essa responsabilidade principal com o investimento); a funo
medio (determinante principal do faturamento); e, por fim, a arrecadao
(incluindo os procedimentos que faam face inadimplncia). Esta ltima
funo teve cabimento assim parte para contemplar a alternativa de
compensao de diferentes rentabilidades de UMs pela via da arrecadao,
218

70

Foram excludas as reas com


sistemas existentes de esgotos, as quais,
supostamente, continuariam no atual regime
de operao pela COMPESA.

Sistema Condominial

Figura 72
As unidades de coleta do Recife
representadas, simbolicamente, por seus
FHQWURVJHRJUiFRV
Fonte: Condominium

tal como, por exemplo, com a criao de uma cmara de compensao


semelhante s usadas em alguns sistemas de transporte coletivo.
Neste Caderno, o relato contemplar apenas a opo de trabalho com a
iniciativa privada, sob a gesto e a regulao do Estado, examinando-se em
particular os mecanismos de compensao entre as diversas rentabilidades,
de sorte a tornar possvel um equilbrio global. Nesse caso, as alternativas
colocadas foram as seguintes:
t Butilizao de subsdios cruzados, em que a transferncia e
compensao ocorrem no mbito de cada gestor, no se deixando
de considerar, porm, que este mecanismo favorece, certamente,
a prtica universalizada de menor ateno aos setores pobres da
populao, na operao dos servios;
t PTmesmos subsdios e o mesmo mecanismo, sendo porm
realizados mediante a interferncia do Estado, atravs, por
exemplo, de uma cmara de compensao , real e fsica, ou apenas
virtual como se fora uma simples conta bancria ao alcance do
Estado;
t PTsubsdios diretos pelo prprio Estado, semelhana do que j
existe no sistema de transportes coletivos, o vale-transporte, e que
neste caso seria o vale-saneamento;
t Pinvestimento prvio, pelo Estado, no todo ou em parte do
sistema fsico da UM deficitria;
t F OBMNFOUF a simples admisso da concesso onerosa nos
processos licitatrios, com o valor da remunerao admitida pelo
licitante sendo colocado como critrio de seleo.

219

Empreendimentos condominiais de esgotos no Brasil

O passo seguinte foi a formulao de vrias alternativas cabveis para


formao de conjuntos de UMs em face do processo pretendido de sua oferta
empresa privada, a saber:
t Baglutinao por proximidade fsica entre UMs, que traz consigo
uma potencial economia de escala para a operao dos servios e
para os prprios investimentos, embora se caracterize por desiguais
rentabilidades e suas conseqncias para a oferta e a demanda;
t Bformao de agrupamentos homogneos quanto rentabilidade,
o que nivela o sistema no mercado e pressupe uma compensao
interna entre UMs;
t Bconsiderao de trs diferentes estratos de UMs - os bastante
rentveis, os equilibrados e os deficitrios, os quais, nessa
medida, requerem um tratamento mercadolgico e uma gesto
diferenciada cedendo renda, empatando ou recebendo renda;
t FBUNFTNPa no aglutinao ou a total liberdade de
aglutinao, o que de um lado traz consigo a maior flexibilidade, e de
outro, a maior necessidade de compensaes.
Com o objetivo de exercitar um percurso pelas vrias alternativas postas
e com isto evidenciar as suas respectivas peculiaridades, apresentou-se no
estudo trs hipteses para a mobilizao da iniciativa privada no sistema de
esgotamento sanitrio do Recife, que podem ser resumidas da seguinte forma:

$OWHUQDWLYD
Imaginava-se esta alternativa provindo da hiptese de maior liberdade
quanto aglutinao de UCs, com a sugesto, todavia, de que se adote
um mnimo de 6 UCs por conjunto e o critrio geogrfico para aglutinao,
fatores que bem podero explorar alguma economia de aglomerao).
Como nessa hiptese estariam presentes as maiores disparidades de
rentabilidades, far-se-ia necessrio, conseqentemente, lanar mo
do mais potente instrumento de contrapartida, no caso a cmara de
compensao, tanto quanto possvel em sua forma mais vigorosa, associada
prpria estrutura da gesto, quando seriam recprocos os seus benefcios.
Nessas circunstncias, podia-se depreender que esta alternativa trazia
consigo a necessidade de cesso por parte da COMPESA da arrecadao das
contas (em favor da cmara) ou at mesmo da medio dos consumos e
faturamento da gua como seria ainda mais desejvel, em benefcio de uma
j citada especializao que poderia ser alcanada neste caso. Esta alternativa
pode ser vista como bastante estimuladora da equidade e universalizao
do atendimento, mas nem tanto quanto aos demais aspectos tomados como
requisitos - atratividade do capital, minimizao do Estado e operacionalidade.

220

Sistema Condominial

$OWHUQDWLYD
Neste caso, considera-se que o sistema ser dividido em conjuntos de
mesma rentabilidade, em um nmero prximo do mnimo referido na
alternativa anterior, como condizente com possveis ganhos de aglomerao.
Nessa condio, a arrecadao das contas pode remunerar diretamente os
operadores, j que este menor tamanho de conjuntos ajuda naturalmente
ao controle de garantia da operao mais eqitativa. Assegurada a eqidade
da operao de setores urbanos distintos quanto renda por um mesmo
operador - no caso atravs de controle direto - a alternativa em questo
altamente favorvel nos demais aspectos julgados importantes nesse
processo: a atratividade do capital privado (maior liberdade de ao), a
minimizao do papel financeiro do Estado e a operacionalidade da soluo.

$OWHUQDWLYD
Desta feita, partia-se da aglutinao de UCs nas trs categorias de
rentabilidade: a de rentabilidade elevada e que acumular recursos numa
cmara de compensao; a de rentabilidade compatvel com o mercado,
que, como tal, pode ter seus vrios conjuntos geridos integralmente
pelos respectivos empreendedores; e, finalmente, os conjuntos de
menor rentabilidade e que demandaro investimentos pelo Estado
(ou transferncias via cmara de compensao). Considerando os quatro
parmetros que vm balizando as anlises aqui realizadas - universalizao/
eqidade, minimizao do Estado, operacionalidade e atratividade, pode-se
dizer, com toda a certeza, que uma tal alternativa estaria situada numa posio
intermediria em relao s duas anteriores, seja no que se mostre como ponto
positivo e assim estimulvel, seja no que se coloque numa posio contrria.
A ttulo de exemplo de como foram os resultados obtidos no modelo que
examinou os agrupamentos de UCs, apresenta-se adiante a figura 73 que
tratou dos conjuntos homogneos de UCs de alta rentabilidade - todas
iguais a 1,40% - e com populaes de, respectivamente 144.000 (conjunto 1),
138.000 (conjunto 2) e 143.000 habitantes (conjunto 3).

15.3 ALGUMAS CONCLUSES


O Plano de Ordenamento do Sistema de Esgotos do Recife est aceito e
praticado desde a sua elaborao, tanto pela COMPESA, que o estendeu
a toda a Regio Metropolitana, quanto pela Municipalidade, que tudo que
realizou no setor, aps o seu estabelecimento, seguiu-lhe as orientaes. Os
maiores sistemas que podem testemunhar estes fatos so os ilustrados no
mapa das UCs apresentado na figura 74, complementados pelas informaes
da tabela 7. Eles demonstram perfeitamente a estratgia que embasa o
Plano de Ordenamento a boa utilizao de recursos financeiros para
investimentos, sejam quais forem os seus montantes. E ali esto sistemas de
todos os portes, cada um deles com o seu processamento final especfico,
inclusive com alguns casos que aproveitam unidades preexistentes.
A respeito da expanso do ordenamento para toda a regio metropolitana,
cumpre destacar que, num primeiro esforo de otimizao do processamento
221

Empreendimentos condominiais de esgotos no Brasil

final sob a nova tica, registrou-se uma fantstica evoluo em relao ao


ltimo estudo do gnero, realizado em 1980: de apenas 7 dessas unidades
naquele plano mais antigo, de posio mais conservadora, para nada menos
que 27, neste momento, o que ratifica, na prtica, a aceitao acima referida.
Ou seja, para adiante da considerao das UCs como estratgia de otimizar
o aproveitamento de recursos disponveis para investimentos, este novo
nmero de estaes de tratamento uma sinalizao amplamente favorvel
tese da descentralizao. Assim, a sua utilizao, j no est mais em
discusso, em que pese o inusitado da proposta quando da sua difuso inicial.
J a estratgia de atrao de investimentos privados a partir desse plano
de ordenamento no teve, at agora, nenhum desdobramento no sistema
institucional, embora tenha sido largamente debatida na cidade com todos
os potenciais ou possveis interessados (Prefeitura, COMPESA, BNDES,
empresrios e tcnicos), angariando elogios e nunca tendo sido contestada
ou muito menos rechaada. Pelo lado da municipalidade, detentora do poder
concedente e por todos os motivos a principal interessada no saneamento da
cidade, jamais foi assumida qualquer posio sobre as alternativas que esta
perspectiva ofereceria, a tal ponto de estar suspenso o estudo, pelo PMSS, h
dez anos. Pelo lado da COMPESA, a concessionria dos servios, a postura
assumida a que leva a crer que ser ela capaz, ainda sozinha, de enfrentar a
soluo do histrico problema.

222

Figura 73
&RQMXQWRVKRPRJrQLRVHGHDOWD
rentabilidade
Fonte: Condominium

Sistema Condominial

Figura 74
Localizao dos sistemas de esgotamento sanitrio decorrentes do Plano de Ordenamento dos Esgotos do Recife
Fonte: Prefeitura do Recife/COMPESA

223

Empreendimentos condominiais de esgotos no Brasil

A perspectiva agora aberta com as parcerias pblico-privadas poderia,


quem sabe, reavivar a idia ou a direo ali postas. Mesmo porque as
observaes a respeito so otimistas, e a elevada rentabilidade demonstrada
na proposta poderia conduzir viabilidade de uma soluo para um
problema at hoje insolvel. E com outros resultados to significativos alm
da recuperao da salubridade urbana e da melhoria das condies de sade
e de bem-estar da populao: a valorizao das atividades nuticas e do
turismo, que sempre caracterizaram a Cidade; o benefcio direto ao setor
imobilirio (hoje levado a penosos e pouco produtivos investimentos em
unidades locais de tratamento de efluentes); a oportunidade de promoo de
certo desenvolvimento institucional, no setor especfico, que tanto se ressente
dessa condio; e, talvez, o mais importante, o possvel desenvolvimento de
uma nova atividade econmica regional.

Tabela 7
Situao atual do Plano de Ordenamento
Fonte: COMPESA/Prefeitura do Recife

Figura 75
Vista area de um assentamento urbano
tpico da cidade, problemtico no que tange
a sistemas de esgotos

224

Sistema Condominial

16. SALVADOR
16.1 A CIDADE E A SUA PROBLEMTICA URBANA
Salvador, capital do Estado da Bahia, com cerca de 3 milhes de
habitantes, uma das mais antigas cidades do Pas. Foi a primeira capital
e se destaca no turismo em decorrncia de um conjunto grandioso
de fatores que favorecem esta atividade: patrimnio histrico, acervo
cultural, miscigenao racial, sincretismo religioso, msica e carnaval,
alm de uma geografia privilegiada que lhe oferece duas vertentes
extraordinrias o oceano e a Baa de Todos os Santos. Sua topografia
fortemente acidentada e as alcunhas cidade alta e cidade baixa
que sempre designaram sua rea mais antiga e central, podem valer,
atualmente, para toda a cidade. S que nos seus subrbios, essas cidades
altas, esses morros, compem expressivamente a paisagem da cidade,
emprestando um peculiar aspecto urbanstico. Elas abrigam metade da
populao, mas, do ponto de vista dos esgotos sanitrios exatamente
o que interessa neste caderno oferecem um cenrio bastante
complicado...
Complicao que est na sua elevada densidade populacional, que subtrai
importantes espaos de bem-estar urbano. A inadequada urbanizao,
praticamente espontnea, e, dessa forma, pouco comprometida com
a sua topografia, cria uma exigidade de espaos para os sistemas de
infra-estrutura, responsveis diretos pela urbanidade dos assentamentos
residenciais. Nas suas singelas habitaes, apertadas e superpostas, formamse verdadeiros edifcios, sempre muito distantes do conforto mnimo - e
na sua generalizada pobreza, grande desemprego e incontrolvel violncia,
alimentada pelo narcotrfico a sediado.
A grande complicao, do ngulo que aqui se persegue, est na cultura que
historicamente se formou nessas localidades e na cidade do Salvador como
um todo relativamente ao trato domstico e urbano com os esgotos. A sua
origem foi, at pouco tempo, a ausncia de um sistema coletor adequado, por
parte do prestador do servio, e a impossibilidade do uso de fossas spticas
pelos moradores, por falta de espaos e pela impermeabilidade dos terrenos.
Na seqncia, como ltimo recurso (vlido, diga-se de passagem) chega
o sistema de drenagem realizando as duas coletas, a das guas de chuva
e a dos esgotos sanitrios, moda de um sistema unitrio. o tal pacto
surdo a qual j se fez referncia desde o Caderno 1, entre a municipalidade
e os moradores, que afasta os esgotos das residncias, escondendo-os nas
galerias e acelerando a chegada da poluio aos cursos dgua. Esse servio
requereu, em alguma poca, instalaes domiciliares voltadas para suas
exigncias (que custaram dinheiro e transtorno), trouxeram a sensao de
problema resolvido, no tm cobrana mensal e, o mais importante, est
culturalmente arraigado na populao. , com certeza, o maior adversrio
do sistema separador em sua chegada, qualquer que seja o seu modelo,
justamente por exigir, alm de novas instalaes sanitrias novos
investimentos, novos transtornos tambm uma conta mensal, para a

225

Empreendimentos condominiais de esgotos no Brasil

Figura 76
Aperto, desarrumao, habitao precria... nos assentamentos sub urbanizados de Salvador

Figura 77
Os sistemas unitrios em Salvador so muito
precrios do ponto de vista sanitrio e, alm
GLVVRVmRVpULRVREVWiFXORVSDUDRr[LWRGR
sistema separado

226

Sistema Condominial

soluo de um problema que, aos olhos da populao, j parecia resolvido...


Nessas reas acidentadas, h ainda um outro problema com o sistema de
drenagem (e com os esgotos), alm dessa sua equivocada funo. que at
parece ter sido ele realizado apenas para a coleta dos esgotos, j que as calhas
e canais naturais que constituem a sua macrodrenagem esto apertados entre
casas, com os seus espaos bastante subtrados pela ocupao das margens.
Assim, durante as estiagens os seus fluxos so quase esgotos, repugnantes
e malcheirosos, causando um grande mal-estar para a populao; nas
enxurradas, eles transbordam, alagam e espalham a contaminao, malestar ainda maior. Ao chegar o sistema separador, inexistem esses espaos
marginais que so, necessariamente, os de seus grandes coletores e
interceptores. As desapropriaes se tornam inevitveis, mas inexistem os
recursos necessrios e, assim, encontrar espaos para essas estruturas requer
verdadeiros passes de mgica.
Pode-se dizer, com absoluta certeza, que so das mais difceis as condies
presentes nesses assentamentos, em face da implantao e, sobretudo, da
operao de sistemas separadores de esgotamento sanitrio, quaisquer
que sejam seus modelos.

16.2 O CONTEXTO QUE ENSEJOU O SISTEMA


CONDOMINIAL
No incio da dcada de noventa os esgotos coletados da cidade e que tinham
uma destinao adequada no alcanavam os 30 % da demanda 71, de sorte
que a proliferao dos sistemas unitrios tanto limpavam, efetivamente,
a cidade, quanto os seus efluentes, que cada vez mais rpido e em maior
quantidade, atingiam os corpos dgua. As chamadas lnguas negras j se
faziam presente, inclusive nas prprias praias de banho, sobretudo naquelas
menos protegidas da Baa de Todos os Santos, no que afetavam diretamente
o lazer e o turismo. dessa poca, a deciso do Governo do Estado no
sentido de implantar o chamado Projeto BAHIA AZUL, com recursos
financiados que viriam a alcanar os 600 milhes de dlares, destinados ao
enfrentamento da questo dos esgotos em Salvador e cidades dessa baa,
tendo competido Empresa Baiana de guas e Saneamento EMBASA a
sua implementao, com incio em 1994, j concludo atualmente para o
atendimento de 80% da populao.

71

A destinao adequada poca, como


at hoje, era o lanamento ocenico,
atravs de emissrio construdo no incio
dos anos setenta, que tem seu ponto
de reunio no bairro do Rio Vermelho,
onde existe atualmente uma Estao de
Condicionamento Prvio dos Esgotos.

Em Salvador, esse projeto viria a abranger praticamente toda a Cidade,


at porque o processo de adensamento de redes, ramais e interligaes
continua e est predisposto universalizao, distribuindo-se em 26 bacias
de drenagem, em algumas delas completando-lhes a cobertura. A oferta pelo
sistema de coleta alcana, ento, cerca de 2,3 milhes de habitantes, e outro
lado de sua amplitude pode ser visto na sua imensa estrutura de transporte
dos efluentes, atravessando todas as bacias em direo ao emissrio
submarino e sua estao de condicionamento prvio, com capacidade para
atendimento de 80% de toda a atual demanda da cidade. Alm de grandiosas,
essas obras viriam a encontrar muitas dificuldades em seus percursos
227

Empreendimentos condominiais de esgotos no Brasil

necessariamente margens de cursos dgua - justamente por estarem eles


sujeitos indiscriminada ocupao em vrios trechos.

6LVWHPDVHPiUHDVFUtWLFDV
TXHDQWHFHGHUDPR
FRQGRPLQLDO

Em toda a rea plenamente urbanizada da cidade, os projetos executivos do


sistema coletor seguiam por inteiro o modelo convencional, ao passo que
para as reas de urbanizao precria, 1,5 milhes de habitantes, apenas
hachuras apontavam para a utilizao de sistemas condominiais, sem
qualquer outro indicativo a respeito. Isto deixava implcito que a EMBASA,
de um lado, j tinha a certeza da inaplicabilidade do modelo tradicional
nessas reas e, de outro, desconhecia por inteiro os tais sistemas
condominiais, ou pelo menos dispensava especificaes ou referncias
sobre eles.

Na realidade, anteriormente
ao BAHIA AZUL, a EMBASA
realizou algumas incurses
nos morros de Salvador,
tentando preencher as lacunas
do projeto nessas reas
de inferior urbanizao. O
esforo realizado constou
da implantao de coletores
em todos os elementos do
sistema virio que permitissem
a continuidade (ruas, vielas,
becos, etc), mas abstraindo,
por desinformao, as idiaschave de condomnio e de ramal
condominial; adotava o que
eram as informaes sobre o
tema veiculadas na ocasio, do
tipo... coletores que passam
no interior dos lotes... ou
sistema alternativo de baixo
custo; limitava a participao
comunitria apenas aos acordos
para passagem da tubulao
em alguns casos mais crticos; e
deixava as ligaes por conta da
iniciativa dos moradores. Apesar
das distores, essas iniciativas
representaram, sem qualquer
dvida, uma importante e
pioneira entrada da EMBASA
nessas reas crticas, com
sistemas de esgotamento
sanitrio; abriam-se as portas,
portanto, para os sistemas
condominiais.

Dessa forma, partiu a empresa para a licitao das obras, dividindo-as em


lotes coincidentes com as bacias do sistema lotes bastante grandes, portanto
- neles contemplando todas as suas obras, inclusive os condominiais, como
veio a se tornar mais chamado este sistema, na Bahia. Com lotes to grandes
de obras, foram grandes tambm, naturalmente, as exigncias do acesso aos
concorrentes (nenhuma, contudo, alusiva a conhecimento ou a experincia
com sistemas condominiais), de forma que o rol de licitantes ficaria limitado
s grandes empresas nacionais todas elas estreantes no novo sistema
- caracterstica que viria a marcar toda a construo do BAHIA AZUL 72.
Nos oramentos, padronizados, que balizavam essas licitaes e as futuras
medies, um nico item, dentre centenas, contemplava os condomnios,
adotando simplesmente o metro linear de ramal como sua unidade de
medio e preo, e levando em conta todas as tarefas necessrias definio
dos ramais condominiais: estudos, levantamentos, cadastros, projetos,
mobilizao social, etc, numa evidente subestimao desse mtodo.
Uma referncia importante a respeito dos primeiros anos de implantao do
BAHIA AZUL, quatro ou cinco anos, fica por conta do regime quase frentico
de sua execuo. Ele foi decorrente da vontade de superar o grandioso dficit,
e que por sua vez sugeriu ditou prazos contratuais exguos (e que jamais
seriam cumpridos), pela simultaneidade de tantas obras em tantas partes da
mesma cidade e, principalmente, pelo aparecimento de vrios obstculos ao
desempenho regular, principalmente, as interferncias com outros sistemas
enterrados, sobretudo a drenagem, e a carncia de espaos para as unidades
estruturais do sistema, em virtude do avano, sobre eles, das habitaes.
Os primeiros exerccios sistemticos com o modelo condominial vieram
com a contratao dos primeiros lotes de obras, correspondentes s bacias
de Pernambus, Baixo Camurujipe e Campinas, todas elas com a maior parte
das suas reas daquela forma hachurada um grande campo de aplicao,
portanto, do modelo condominial. Isto ocorreu com a contribuio de uma
coincidncia: a contratada foi a Construtora Norberto Odebrecht e a sua sala
tcnica, restrita s tarefas pertinentes a sistemas condominiais, foi assumida
pela Condominium, sob a coordenao do autor desses cadernos. Essa viria
a ser, a rigor, a oportunidade de Salvador e da EMBASA conhecerem de
alguma forma o novo modelo. Alm disso, tcnicos formados e treinados
nessa primeira obra vieram a ser, como integrantes dos quadros de outros
228

72

Foram alm desse perodo as obras


consideradas complementares, tais como
DGHQVDPHQWRGHOLJDo}HVQDOL]DomRGH
trechos de canalizao que haviam sido
interrompidos, etc.

Sistema Condominial

contratantes de prximas obras, os nicos veiculadores do modelo ao ensejo


de seus trabalhos; com varivel grau de percia e sem qualquer sistemtica
delineada com esse objetivo. A esse tempo, competentes e dedicadas
tcnicas sociais do quadro da EMBASA se engajavam no processo e o
levavam de alguma forma para o interior da empresa 73, mas o que viria se
constituir na mais formal adeso institucional ao novo sistema ocorreria
aps reunio condominial, nessa mesma poca, assistida pelos principais
dirigentes do BAHIA AZUL e que ali se convenciam da sua adequao
realidade de Salvador 74. Esse primeiro rol de obras, na realidade, teve um
importante papel na EMBASA, uma vez que se constituiu numa espcie de
experincia-piloto, para a empresa. No naquela modalidade planejada e
efetivamente experimental, mas na oportunidade, se no de aprendizado,
pelo menos de um primeiro contato de todos com o novo mtodo: prestador
de servio, executante e comunidades. A partir desses fatos, ento, estava
decididamente exigida, pela EMBASA, uma assessoria tcnica especfica
para sistemas condominiais em cada empresa contratada para as obras; mas
restritivamente, contudo, quelas reas hachuradas desde os editais.
Deve ser ressaltado que em todas as bacias que dividem o sistema de
esgotos da cidade, as suas reas aqui consideradas como sub urbanizadas
foram trabalhadas segundo o modelo condominial, embora com variaes
significativas de uma para outra a depender do executante quanto ao grau
de absoro de sua teoria. Quanto s reas de urbanizao normal, foram elas
tratadas segundo o modelo condominial em no mais do que trs das bacias
em que o sistema de esgotos dividia Salvador. As demais permaneceram sob
o modelo convencional, embora com simplificaes importadas do outro
modelo que diminuam custos e racionalizavam a obra.

16.3 O ESTABELECIMENTO DAS REGRAS


BSICAS
Logo no incio dos trabalhos condominiais surgiu a necessidade do
estabelecimento de regras para o acesso ao seu servio, seja por se tratar de
algo novo para a cidade, seja, principalmente, em razo de duas questes
que se mostravam fundamentais para o xito do programa, quais sejam as
necessidades de:
t estmulo s ligaes ao novo sistema quando, de uma maneira
geral, o pblico usurio se dava por satisfeito com os seus
sistemas unitrios;
73

Muito particularmente as tcnicas sociais


Ester Navarro Ferreira e Tnia Maria
Dourado Vasconcelos.

74

Os senhores secretrio de
Desenvolvimento Urbano, Roberto
Moussalem de Andrade, e os diretores
da EMBASA, presidente Jos Lcio Lima
Machado e de Engenharia, Jess Motta
Carvalho.

t conquista da populao para as permisses de localizao dos


ramais condominiais por onde fosse possvel passar com eles
quintais, escadarias, vielas e at mesmo interiores de residncias.
Foram estas regras estabelecidas um tanto longe daquelas que seriam as
indicaes da teoria do modelo, da mesma forma que no tiveram tempo
para emergir, como desejvel, de um processo de amadurecimento, tais eram
a pressa como ocorria o programa e suas vrias definies, e o seu prprio
229

Empreendimentos condominiais de esgotos no Brasil

gigantismo, fatores que absorviam quase que por inteiro as energias da


empresa na sua conduo.
As regras ento assentadas e que foram levadas aos usurios objetivaram,
ostensivamente, a conquista da adeso ao sistema, mesmo que em detrimento
de outros valores (isolamento de guas de chuva, por exemplo), e se
desdobravam nos itens seguintes:
t conquista da permisso, pelos condminos, ao livre percurso
das canalizaes em seus terrenos privados, atravs da explicao
franca e convincente de que quase sempre esses percursos seriam,
na prtica, obrigatrios; com feito, haveriam de conciliar requisitos
to exigentes quanto minimizar as quebras em espaos construdos,
oferecer o ponto mais conveniente a cada casa para a sua ligao e
atender aos rigores do escoamento por gravidade;
t compromisso de efetivao da futura ligao ao servio, s
expensas de cada um, evidenciando-se a necessidade do isolamento
das guas de chuva e que, no caso de Salvador, representaria
a necessidade de nova ligao (novos investimentos, novos
transtornos);
t compromisso com o pagamento mensal, via tarifa, do novo
servio, numa das duas opes seguintes de preo para cada
condomnio, que levavam em conta a responsabilidade pela operao
dos ramais condominiais: valor equivalente a 45 % da conta
dgua para os condomnios que se dispusessem a arcar com tal
responsabilidade ou, por outra, valor de 80 % da mesma conta para
os que preferissem a operao sob a responsabilidade da EMBASA.
No primeiro item, a aceitao seria a mais absoluta, certamente pela
evidncia com que se apresentava a todos o percurso nico, em vista
das explicaes tcnicas; no segundo, a vontade da ligao levava ao
compromisso, mas, na ocasio, no antecipava o que seriam as dificuldades;
e no terceiro, a EMBASA mostrava-se ingnua, na medida em que induzia
a menor tarifa sem maiores garantias quanto efetividade da futura
operao. A escolha dessa menor tarifa seria, ento, uma unanimidade... O
elevado custo das ligaes viria a se mostrar como o ponto crtico de todo o
programa, dados os requisitos de separao, nas mesmas, das guas pluviais e
dos esgotos, reunidas desde sempre, conforme era a cultura local. A soluo
desse problema seria dependente, portanto, de uma mobilizao social
bastante mais intensa e que haveria de acompanhar o prprio funcionamento
do sistema 75.
Se estas regras no eram as melhores, foram, sem dvida, as possveis, vista,
como j se disse, do atropelo para o seu estabelecimento quando as obras
do programa j se faziam em plena intensidade. E, antecipando, continuam
elas vigendo at o presente momento, confirmando as dificuldades para uma
mudana no plano institucional, mesmo quando se trata de uma questo
recente e ainda no arraigada.
230

$(0%$6$SHUFHEHQGRHVWDVGLFXOGDGHV
teve a iniciativa de promover programas
HVSHFtFRVGHHGXFDomRDPELHQWDOGRV
quais se deve destacar os denominados
Projeto Tudo Azul e o Programa de Educao
Ambiental Bahia Azul.

75

Sistema Condominial

16.4 OS SISTEMAS CONDOMINIAIS NO BAHIA


AZUL
A difuso do mtodo condominial em Salvador ocorreu, como visto, como
se fora por contgio, a partir do que se praticava a esse ttulo em algumas
reas e por meio do que eram as exigncias da EMBASA a esse respeito,
fruto do que apreendera e concordara. Dessa forma foram distintas, por
certo, de uma para outra rea trabalhada, as aplicaes do novo modelo:
nas reas urbanizadas, tendncia utilizao do modelo convencional,
embora que atenuado nas suas redes; nas reas de precria urbanizao, o
esforo da utilizao do condominial, mas com menor ateno ou afinco, na
considerao dos condomnios.
Por essas circunstncias e pelo desconhecimento, pelo autor, de cada
uma das parcelas que compunham o todo, os relatos aqui feitos estaro
limitados s bacias em que a sua empresa foi assessora tcnica das
construtoras encarregadas das obras, por sinal abrangendo as mais variadas
urbanizaes. Respectivamente, as bacias da Pennsula e do Comrcio,
com a empresa Queiroz Galvo, e a do Alto Camurujipe, com o consrcio
Telar/Tejofran; elas esto representadas nas figuras 78, 79, 80. A Pennsula
se caracteriza, principalmente, pela sua topografia plana e quase ao nvel
do mar, pela remota ocupao de sua maior parte e pela diversidade de
seus segmentos sociais, sendo que os pobres, nela, esto em reas muito
baixas, quase alagadas, diferentemente de suas localizaes em morros
na maior parte da cidade. O Alto Camurujipe, por seu turno, tem feies
absolutamente diversas: relevo altamente acidentado, precria urbanizao,
elevadssimas densidades e generalizada pobreza, sendo que a sua marca
mais importante do ponto de vista do esgotamento sanitrio a absoluta
exigidade dos espaos marginais aos seus cursos dgua, que so os locais
insubstituveis para o posicionamento das estruturas da coleta. A bacia do
Comrcio, por fim, a que comporta as tradicionais Cidade Alta e Cidade
Baixa mais conhecidas dos visitantes, onde se localizam o Stio Histrico,
o comrcio mais tradicional (inclusive o simblico Mercado Modelo) e
o centro financeiro. Urbanizaes e ocupaes, portanto, absolutamente
representativas do conjunto da cidade e de grande parte do Brasil. As figuras
78, 79 e 80 do uma viso dessas trs bacias.
Em todas as trs reas aqui consideradas, o primeiro passo na implementao
das obras foi a transformao de seus projetos, ento calcados no mtodo
tradicional, para o modelo condominial, com a apresentao dos respectivos
demonstrativos das economias e racionalidades introduzidas, que haveriam
de melhorar o desempenho das prprias obras e de sua futura operao.
Os referidos estudos, por serem analisados e aprovados pela EMBASA,
oficializavam, na prtica, a utilizao do novo mtodo, j no mais restrito
s reas sub urbanizadas, mas, generalizadamente, nos mais variados setores
urbanos e sociais.
Para uma melhor apreciao dessa questo, foram considerados separadamente
a rede bsica e os ramais condominiais; e por extenso e pela sua importncia,
tambm as instalaes de interligao das casas com os ramais.
231

Empreendimentos condominiais de esgotos no Brasil

Figura 78
$VGXDVYLVWDVVmRGD%DFLDGD3HQLQVXODHWrPHPFRPXPDWRSRJUDDEDVWDQWHSODQD'LVWLQJXHPVHFRPRVHYrQDGHQVLGDGHQtYHOGH
renda, qualidade da urbanizao e das casas e na proximidade da praia

Figura 79
Uma nica vista da Bacia do Alto Camurujipe pode represent-la satisfatoriamente: alta densidade, prcaria urbanizao, pobreza...

232

Sistema Condominial

Figura 80
Vista da Bacia do Comrcio, da sua zona
porturia

Os elementos componentes da estrutura de transportes, por seu turno, no


ensejaram maiores transformaes dado que a sua concepo geral estava
condicionada pelo destino final dos efluentes e era de feio absolutamente
convencional, num elevadssimo patamar, inclusive, de centralizao das suas
instalaes de disposio final dos esgotos. Apenas foram relocadas algumas
das estaes elevatrias, sempre para espaos pblicos praas e logradouros
e at mesmo o leito de uma avenida de grande movimento com o intuito
de fugir-se das desapropriaes e suas conhecidas pendncias; nessas novas
posies seus espaos teis eram subterrneos, disfarados, portanto, e
seus quadros de comando eram localizados na superfcie, sob condio de
extrema proteo.
233

Empreendimentos condominiais de esgotos no Brasil

$5HGH%iVLFD
Os estudos da rede bsica atenderam ao conceito que est na teoria dos
sistemas condominiais e, dessa forma, alteraram radicalmente o traado
do projeto original, agora apenas tocando cada quadra, como um futuro
condomnio. Foram realizados para a demanda j estabelecida e em nvel
necessrio e suficiente, apenas, para a caracterizao do novo traado e
elaborao dos oramentos que serviriam de comparao com o antigo
projeto, reservando-se os seus projetos executivos para o momento da obra,
quando j se constituiriam em ordens de servio para a construo. Tudo,
portanto, conforme a orientao expressa no Caderno 2.
Na bacia do Alto Camurujipe, bastante acidentada na sua topografia, as
suas redes, seguindo as declividades naturais, puderam ter as mnimas
profundidades em quase toda a sua extenso. Nesse sentido, nada
apresentaram de novidade, exceo de um gigantesco tubo de queda com
25 metros de altura, que est comentado em destaque neste item. Nas suas
baixadas, por outro lado, o avano das casas sobre as margens dos cursos
de gua locais inevitveis de coletores-tronco e interceptores forou a
criao de solues inusitadas para a viabilizao dessas estruturas, conforme
est descrito e ilustrado em boxes que tratam, por exemplo de coletores na
superfcie dos terrenos, envelopados para sua proteo, ou de tubulaes
pressurizadas para travessia de trechos crticos onde seriam impossveis as
escavaes para o funcionamento por gravidade.
Na Pennsula, uma plancie quase ao nvel do mar e com o lenol fretico
muito raso, as profundidades foram limitadas aos 3 metros, reduzindo-se
o impacto dos grandes custos das escavaes com gua pela introduo de
maior nmero de pequenas estaes elevatrias. Algumas reas marginais,
alagveis durante as chuvas, foram excludas do sistema de esgotamento at
que a sua urbanizao fosse equacionada. No mais, os cuidados nesta bacia
sempre para minimizar profundidades foram com uma maior preciso
na definio dos pontos de passagem dos ramais condominiais nas primeiras
casas de cada quadra, quando foram eles determinados pela exclusiva
condio de captao dos esgotos nas instalaes domiciliares.
Na Bacia do Comrcio, onde a topografia reproduziu as das duas
anteriores e desse ponto de vista, reproduziu-se, tambm, os critrios de
posicionamento da rede bsica as diferenas ficaram por conta da sua mais
avanada urbanizao, neste caso facilitadora das obras (maiores espaos
nos logradouros, principalmente). A sua novidade em relao s anteriores
ocupaes ficou por conta de um assentamento em barrancos localizados
beira-mar, que demandaram grandes extenses de coleta area, sobre pilares
ou presas ao prprio barranco, conforme evidenciam as fotos da figura 81,
obra que, alis, foi executada diretamente pela prpria EMBASA.
Em sucessivas caixas de texto inseridas a partir deste item esto descritas e
explicadas algumas situaes peculiares adotadas para o sistema de coleta de
esgotos na cidade do Salvador. A bem da verdade, esses exemplos em nada
caracterizam a tecnologia condominial (enquanto modelos ou tipologias de
soluo), mas apenas o compromisso com o atendimento pleno da populao
234

Sistema Condominial

Figura 81
Fotos de coletores apoiados em pilares, na
Bacia do Comercio, em rea de construes
em barrancos beira do mar

que um dos seus princpios filosficos, ou seja, eles configuraram, em


ltima anlise, a busca de solues para reas altamente crticas que, no
Brasil, historicamente, sempre deixaram de ser atendidas sob o pretexto de
que primeiro haveriam de vir as reformas da infra-estrutura para que depois
viessem os sistemas de esgotos.

2V5DPDLV&RQGRPLQLDLV
Os ramais condominiais, ento chamados, em Salvador, redes condominiais,
ou ainda mais simplesmente, os condominiais. Nas reas aqui consideradas,
apresentaram variaes no seu formato e posio conforme estivessem
localizados em reas planas ou nos morros, independentemente do nvel de
renda ou do tipo de habitao. Nas primeiras, os ramais condominiais foram
sempre os de passeio, determinados por trs condies muito presentes:
as elevadas densidades, a ocupao quase integral dos lotes na maioria
das quadras e, principalmente, pela localizao sistemtica das sadas dos
esgotos pela frente das casas (puxadas, que sempre foram, pelas galerias de
drenagem) 76. Nos morros, por seu turno, novamente as elevadas densidades
e ocupaes dos lotes, desta feita aliadas desorganizada urbanizao e
movimentada topografia, obrigaram um percurso quase nico para os ramais
caracterstico de cada condomnio enquadrando-se naquela classificao
de cadernos anteriores que os designavam como ramais passando por onde
podem....

76

Estas sadas dos esgotos pela parte


da frente, na direo das galerias, sugere
naturalmente o ramal de passeio, que por
estar mais prximo das instalaes oferece
o menor custo para a ligao e menor
desconforto com a sua execuo.

Com relao aos seus dimetros, uma determinao da EMBASA


alterou a sistemtica usual de defini-los pela hidrulica e para a vazo
do condomnio, hiptese que tem favorecido em carter praticamente
exclusivo aquele mnimo de 100 mm. Ela foi no sentido de contemporizar
com a histrica juntada das guas pluviais e esgotos na cidade. Nesse
sentido, estabeleceu um limite de 15 residncias para o menor dimetro,
evoluindo a partir deste nmero para 150 mm. Os materiais foram sempre
o PVC especfico para esgotos e as caixas de passagem e inspeo foram
235

Empreendimentos condominiais de esgotos no Brasil

pr-moldadas com dimenses variveis com a profundidade, conforme


a conveno. Recorde-se que o dimetro de 100 mm tem sido defendido,
no modelo condominial, no apenas pelo seu atendimento hidrulica
(e, em conseqncia, melhor escoamento e maior poder de arraste), mas
tambm pelo seu papel de filtro em relao ao ingresso de guas de chuva
e de resduos slidos inadequados rede (que as obstrues causadas por
esses fatores ocorram onde mais raso o sistema, poupando coletores mais
profundos e estaes elevatrias).

7XERGH4XHGD*LJDQWH
1HVVDPHVPDEDFLDDRFRUUrQFLD
de outra singularidade sugeriu,
tambm, uma soluo singular. Foi
a presena, nela, de uma subbacia cujo exutrio natural era um
verdadeiro abismo, com cerca de
20 metros de altura, e em cuja base
tinha continuidade a ocupao
XUEDQD3DUDDWUDQVIHUrQFLDGRV
HXHQWHVHQWmRUHXQLGRVSDUDRQGH
fosse possvel a continuidade do
X[RSUHWHULXVHRXVRGHXPD
instalao de recalque, trivial nesses
casos, em benefcio de uma soluo
VHPGLVSrQGLRGHHQHUJLDHPHQRU
valor de investimento. Foi a utilizao
de um inusitado tubo de queda com
aquela altura, mas concebido numa
forma muito simples: uma tubulao
GHIHUURIXQGLGR[DGDDRSDUHGmR
por abraadeiras, nenhuma estrutura
de concreto armado e uma caixa
de quebra-presso na sua base,
funcionando tambm como o poo
de visita inicial nessa outra bacia.
A estrutura aqui mencionada est
funcionando perfeitamente desde a
sua inaugurao em 2003.

No que tange execuo dessas unidades, a EMBASA tambm estabeleceu


algumas condies, tais como o intervalo adotado para as profundidades
em caladas e lotes particulares (do mnimo compatvel com o desge das
casas at o limite superior de 1 m); a interposio de caixas de passagem
em cada ponto de contribuio, juno ou mudana de direo, e de tubos
de queda nas descontinuidades do grade superiores a 0,50 m; a reposio
dos pavimentos danificados por seus (rigorosamente) iguais, sendo que no
caso das escadarias essa medida se tornou uma obstinao da populao 77;
e a concordncia, em carter absoluto, com os mais inusitados percursos
determinados para os ramais, desde que comprovada a evidncia da sua
justificativa e respectiva exeqibilidade 78. Ela ainda definiu padres para as
ordens de servio para execuo e para os posteriores cadastros, mas nada
formalizou quanto ao seu conceito, de uma forma geral. Em 1999, por outro
lado, se tem informao de que ela incorporou ao seu Caderno de Encargos,
as especificaes e diretrizes que tratam do modelo condominial.
Deixando de lado os ramais condominiais das quadras de urbanizao
uniforme, sempre dispostos nos passeios e por isso mesmo j conhecidos dos
interessados, veja-se, no que se segue, o processo que conduz definio
dos ramais condominiais daquelas reas de urbanizao precria, passo a
passo, e utilizando uma rea da bacia do Camurujipe como ilustrao.
O primeiro deles, nem sempre fcil, a prpria delimitao dos condomnios,
a partir da planta disponvel, escala 1:2.000. Ainda no escritrio, nela se
destacam os seus elementos visveis, que interessam a esta tarefa inicial, tais
como ruas, becos, escadarias, canais e talvegues, seguindo-se a vistoria em
campo, que ratifica tais elementos em planta e eventualmente revela o que
antes no aparecia. A tarefa prossegue com a seleo, dentre esses elementos,
daqueles que faro parte, finalmente, dos permetros dos condomnios, sendo
concluda com a contagem das casas delimitadas em cada um deles, que
deve ser sempre inferior a 40 unidades (nmero mximo compatvel com o
tamanho das reunies condominiais e com a vazo a escoar nesses percursos
internos).
O passo seguinte j ocorre dentro de cada condomnio, quando se tem em
mos uma planta na escala 1:200 (ampliao, precria, daquela inicial), que
servir de base a todos os trabalhos subseqentes, antes da elaborao da
ordem de servio para a execuo:
t conhecimento das pessoas, informaes sobre o projeto, licena
para o trabalho no interior, anotao de dados bsicos de cada casa
(nome do responsvel, condio da moradia, nmero de residentes,
236

'HFRUUrQFLDVHPG~YLGDGRSDSHOGHVVHV
HTXLSDPHQWRVQDViUHDVGHWRSRJUDDWmR
acidentada, bem como das lutas do passado
voltadas para o alcance do benefcio ou da
vontade atual de melhorar o existente, alm
do precrio estado de grande parte delas no
momento de execuo da obras de esgotos
(aproveitamento da oportunidade, portanto!).

77

78

Alm de localizao em mnimos espaos


de becos e escadarias, esses ramais foram
largamente locados em quintais (na frente
e nos fundos) e no prprio interior das
UHVLGrQFLDVHPFDVRVH[WUHPRVGHRFXSDomR
do solo.

Sistema Condominial

3UHVVXUL]DomRQD&ROHWD
No Alto Camurujipe so comuns
as sub-bacias com formato de
DQWHDWURFRPHQFRVWDVtQJUHPHVH
densamente ocupadas; e que ainda
apresentam um sistemtico avano
das casas sobre as margens dos
seus drenos principais ou talvegues,
percurso natural para locao dos
coletores-tronco. Uma dessas reas
a ilustrada na foto disposta abaixo,
onde se percebe com facilidade
essa formao aqui descrita, com
o agravante de que o curso dgua
natural est inclusive coberto com
uma laje, constituindo a prpria
rua. A alternativa de pressurizao
do coletor-tronco do sistema foi a
adotada, o que alis poderia ter
sido repetido, com vantagens, em
vrias outras reas de caractersticas
semelhantes da cidade. A despeito
de constituir-se, salvo melhor juzo,
na soluo mais apropriada para este
tipo de formao, ela somente veio
a ser utilizada em razo da absoluta
falta de espao, no fundo do vale,
para a implantao de um coletor
tradicional, com escoamento por
gravidade. Consistiu na considerao
de dois sistemas independentes na
PHVPDPLFUREDFLDFRQFrQWULFRVH
separados por determinada cota do
terreno. O superior, bastante maior,
abrangendo pelo menos 80% da
contribuio total, realiza os seus
desges em um coletor-tronco
pressurizado, localizado nas exguas
margens disponveis, graas aos seus
requisitos de tubulao sob presso
(declividade e profundidades nulas, ou
quase). E o da poro inferior, pelas
suas mnimas dimenses (quase
exclusivamente ramais condominiais
de 100mm de dimetro), funciona
inteiramente por gravidade, at a
UHXQLmRGRVHXHQWHVQXPDSHTXHQD
elevatria que os recalca para o
sistema principal, superior.

condio atual do abastecimento, do trato dos esgotos, da gua de


chuva);
t complementao cadastral com os elementos apenas necessrios:
reas cobertas, localizao de fossas, caminhos preferenciais da gua,
reas pavimentadas;
t esboo do futuro ramal, conciliando os seguintes fatores locais:
minimizao de distncias das futuras interligaes, utilizao do
percurso mais livre e com maiores declividades (espcie de talvegue
interno) e drible dos obstculos na passagem dos ramais;
t informao superficial aos proprietrios sobre esse percurso
e o local das caixas de inspeo, e obteno de um primeiro
consentimento.
A receptividade dos condomnios, durante esta entrada, e, de um modo
geral, a receptividade do bairro ao novo sistema determinaram, na prtica, a
ordem dos ltimos passos do processo anteriormente obra: mais perceptvel
a receptividade, segue-se com a elaborao da ordem de servio antecedendo
a reunio condominial; menor a receptividade, inverte-se esta ordem,
realizando-se logo a reunio, ento calcada no esboo do futuro ramal, e a
correspondente busca do termo de adeso que deve anteceder a ordem de
servio. Mais adiante tornou-se uma medida padronizada da EMBASA, a
realizao das reunies condominiais anteriormente s obras.
As reunies seguiram a metodologia especfica abordada no Caderno 2 e
estiveram focadas nas questes principais: separao das guas de chuva,
efetivao da ligao, aprovao do traado do ramal condominial e escolha
da opo tarifria conjugada forma de operao dos ramais. As ordens
de servio dos ramais condominiais, da mesma forma, seguiram a sua
metodologia especfica e, embora representadas em planta e em nmeros,
tiveram, na realidade, o seu desenho realizado em campo, gravado com
estacas ou marcas indelveis. Repete-se aqui o exemplo de Ordem de Servio
para Execuo de Ramal Condominial apresentado no Caderno 2.
Um ltimo comentrio a respeito dos ramais condominiais de Salvador
sobre as diferenas de topografia que fazem a sua base. Nas reas planas,
como foram a maioria dos ramais na Pennsula, e nas reas acidentadas,
a maioria no Alto Camurujipe. Os cuidados principais num e noutro
projetos so curiosamente distintos: no primeiro, rea plana, a preocupao
principal com a minimizao do aprofundamento, em face dos riscos de
sua escavao em reas to prximas de construes s vezes precrias (da a
necessidade, com a precisa indicao das cotas da canalizao); no segundo,
grandes declividades sempre associadas a grandes densidades, os maiores
cuidados ficam por conta da prpria localizao, j que se trabalha com
as declividades naturais, sempre maiores que a mnima hidraulicamente
determinada (0,005 m/m), e a profundidades constantes.

237

Empreendimentos condominiais de esgotos no Brasil

/LJDo}HVLQWUDGRPLFLOLDUHV
Recorda-se aqui, que estas so as instalaes situadas entre o ramal
condominial e as peas sanitrias do interior dos prdios, cuja execuo
foi assumida pela EMBASA com o compromisso de seu pagamento, pelos
usurios, em parcelas variveis com o valor das mesmas. Na sua composio
e constituio, elas tm os mesmos requisitos dos ramais condominiais
e apenas diferem deles pelo fato de corresponderem a um nico prdio
e estarem em seu interior: o dimetro de 100 mm fixo, o material da
canalizao o PVC tpico de instalaes internas, as profundidades so
livres e a prpria declividade pode ser menos exigente nos seus requisitos
usuais. Pelo seu pequeno porte, essas instalaes poderiam parecer simples,
mas isto apenas aparente.
que a presena daquele sistema unitrio na cidade, destacada neste
captulo como grande problema para o sistema separador, aqui se manifesta
na sua plenitude. Ou seja, as chamadas intradomiciliares tm constitudo,
ainda hoje, o principal fator de limitao do uso efetivo do sistema de
esgotamento recm-implantado, ainda inferior a 80% da populao que
dispe de ramais condominiais. As razes, bastante conhecidas, passam pelos
novos investimentos na adaptao das instalaes (custo para o usurio),
pelos transtornos dessas pequenas, mas ntimas obras e, sobretudo, pelo
pagamento de uma fatura mensal (novo custo para o usurio).
Para quem, como o autor, que teve uma razovel convivncia com as obras do
sistema condominial de esgotamento sanitrio de Salvador, fica a impresso
de que, por mais complexas, grandiosas e caras que sejam as obras de
transporte entre bacias da cidade, por exemplo, as maiores dificuldades em
face da universalizao do atendimento da cidade estaro com estas suas
pequenssimas obras localizadas na intimidade de cada casa.
A figura antes apresentada, do bairro de Periperi, em Salvador, e reaparece
na figura 83 ilustrando momentos sucessivos dos trabalhos num de seus
micro sistemas, desde o reconhecimento da rea at os detalhamentos da
rede bsica e dos ramais condominiais, tudo conforme as prescries do
Caderno 2.

16.5 O BAHIA AZUL, HOJE


$VSULQFLSDLVFRQVWDWDo}HV
Segundo a EMBASA, o sistema de esgotamento sanitrio de Salvador
se estende a mais de 80% de sua rea urbana, abrangendo 27 bacias de
drenagem (que so as unidades desse sistema) e atende a pouco mais de
2 milhes de habitantes, o equivalente a mais de duas teras partes de sua
populao total. Nesse atendimento o sistema convencional responde por
48%, 1,1 milho de pessoas, ao passo que o condominial e os sistemas
simplificados de conjuntos habitacionais atendem 1,2 milho.
A oferta atual do servio, ou a sua atual capacidade de atendimento
suficiente para o alcance de pelo menos 80% da populao da cidade e
238

&ROHWRUHV6XSHUFLDLV
Neste caso a disposio de um coletor
na margem de um canal inteiramente
apertado entre casas dos dois
lados foi possvel de uma forma sui
generisHJUDoDVDXPDFRLQFLGrQFLD
que o referido canal, com seco
LQVXFLHQWHSDUDDVPDLRUHVFKXYDV
passou a extravasar nessas ocasies,
ocasionando, naturalmente, o alagamento
GDVFDVDVULEHLULQKDV1DGHFRUUrQFLD
desse fato, ento, as casas foram sendo
levantadas acima do nvel das guas,
gradualmente, fato que comum no
Brasil, em situaes semelhantes. Esta
nova condio, ento, tornou possvel
a disposio do coletor simplesmente
apoiado sobre a superfcie do terreno, e
sem qualquer prejuzo para a coleta das
casas que a esto, j que, naturalmente,
a referida subida traz consigo, tambm,
a subida das instalaes sanitrias
internas. A proteo da canalizao,
em concreto simples, constituiu-se numa
verdadeira calada para os transeuntes,
o que foi motivo de regozijo para os
PRUDGRUHVQDGHFRUUrQFLDGRVHXQRYR
sistema virio. A foto aqui inserida
ilustra perfeitamente a soluo aqui
delineada, sendo de chamar-se a ateno
para o fato de que ela foi largamente
utilizada em Salvador, em situaes
semelhantes, bem como tem sido levada
a cabo noutras cidades brasileiras, em
iUHDVFRPURFKDVDRUDQWHV

Figura 82
Exemplo de ordem de servio para ramal condominial de esgotos, do Sistema
Salvador, da EMBASA

Sistema Condominial

239

Empreendimentos condominiais de esgotos no Brasil

o processo de consecuo de ligaes tem sido permanente, tendo sua


velocidade ditada pela disposio da populao em acatar a necessidade de
adaptao de suas instalaes sanitrias originariamente unitrias ao
sistema separador que lhe est posto disposio. Nesse intento a empresa
no tem poupado esforos. Isso pode ser comprovado pelas sistemticas
campanhas que chegam a cada casa, pelos financiamentos concedidos para os
investimentos particulares (amortizveis em longo prazo) e pela retaguarda
legal, ainda que s utilizada na prtica para grandes consumidores, que
obriga a cobrana dos esgotos onde haja a sua oferta, independentemente da
efetivao da ligao.
Se a presena das guas pluviais nas instalaes das casas constituem o maior
entrave universalizao do atendimento pelo sistema separador agora
disponvel, tambm elas so responsveis, seguramente, por uma maioria
das aes de operao e manuteno do sistema. Isto se revela atravs da
existncia de um grande nmero de estaes de recalque que funcionam em
tempo seco para a captao de esgotos em regatos e talvegues da cidade e pela
natureza da maioria das ocorrncias de manuteno nas redes e ramais: a
desobstruo causada pelas areias e lixos carreados pelas guas de chuva para
o interior do sistema, alm, evidentemente, do mau uso do servio por uma
grande parte dos usurios.
Ainda sobre essas ocorrncias, algumas informaes dos setores de operao
da empresa do conta de que o maior nmero de ocorrncias est nos
ramais, prediais e condominiais, seguindo-se aquelas relativas a consertos
e substituies de caixas de passagem que, alis, tambm esto nos ramais.
Isto ainda mais agravado quando se sabe que a totalidade prtica de tais
ocorrncias est nos usurios optantes pela menor tarifa (45% da conta de
gua) 79, sob o compromisso de realizarem a manuteno dos seus ramais
condominiais; e que a EMBASA, com a sua simples concordncia em realizlas (sem qualquer nus ou sequer advertncias) termina por estimular o
crescimento deste universo faltoso.
As desobstrues realizadas girariam em torno de 18.000 por ano,
fornecendo uma indicao mdia de 0,08 operaes por ligao, o
equivalente a uma obstruo por ano em oito de cada cem ligaes. Apesar
de no se conhecer um paradigma a respeito deste nmero de ocorrncias,
este aqui registrado, em si, no parece exagerado, mais ainda quando se
levam em conta, de um lado, as elevadas exigncias locais quanto operao
do sistema e, de outro, o fato de que a continuidade dos trabalhos e a melhora
dos hbitos em relao ao sistema so fatores que devero reduzi-lo ao
longo do tempo. Outro fato que merece uma considerao especial aquele
que evidencia que essas obstrues variam bastante de uma para outra
bacia, num universo semelhante em suas caractersticas socioeconmicas e
habitacionais. Como os hbitos de uso do sistema so certamente decorrentes
de tais caractersticas, estas variaes tendem a ser explicadas, portanto, mais
por questes alheias populao e ao uso do servio, dentre as quais devem
ser salientadas, por hiptese, a qualidade de servios de infra-estrutura como
os de drenagem e de coleta de lixo, ou a qualidade deficiente do prprio
sistema coletor dos esgotos, no seu projeto ou na sua construo.
240

79

Ao que parece no h qualquer pesquisa


na cidade, realizada pela EMBASA, e que
possa dar conta de quantos so os usurios
que cumprem e que no cumprem seus
compromissos com a manuteno, bem
como quais seriam as suas inspiraes a
esse respeito.

Sistema Condominial

Figura 83
Fases do trabalho num micro sistema,
sucessivamente: apreciao de sua
WRSRJUDDHVHXVWDOYHJXHV  GHOLPLWDomR
de seus condomnios (2); lanamento
de sua rede bsica (3); e o ramal de um
condomnio (4)

Com relao s caixas de passagem, os fatos parecem demonstrar que os


seus problemas so de duas naturezas distintas, uma interna e outra externa
EMBASA: a primeira corresponderia m qualidade de sua execuo,
quando da implantao do sistema, que, dessa forma, no resistiria ao tempo
e ao uso, e tambm a certo vandalismo; a segunda decorreria do desvio de
sua funo pela populao, quebrando-lhe a tampa para torn-la receptora de
guas pluviais, na falta de um servio oficial, eficiente, com esta finalidade.
Um registro muito importante a respeito desta operao deve ser feito
para assinalar o rigor com que os setores operacionais da EMBASA vm
cuidando da manuteno dos servios de esgotos, com presteza e eficincia,
independentemente da condio de direito dos solicitantes.

(DOJXPDVFRQVLGHUDo}HVVREUHDRSHUDomR
A histria do espontanesmo que caracterizou a adeso progressiva
das obras do Programa BAHIA AZUL ao modelo condominial repetese, na prtica, na operao dos sistemas condominiais que foram sendo
construdos. Como conseqncia, possivelmente, de certa estanqueidade
entre setores, na empresa, bem como pela maior ateno que sempre
representam as obras, usualmente, no saneamento do Brasil. Assim, os

241

Empreendimentos condominiais de esgotos no Brasil

novos sistemas, nova tecnologia, foram sendo operados segundo o regime


tradicional da EMBASA para sistemas de esgotos, para somente aos poucos,
como nas obras, o setor operacional ir assumindo procedimentos mais
consentneos com as caractersticas do novo modelo 80. A observao dessa
realidade, contudo, faz constatar-se que os sistemas condominiais funcionam
normalmente ou, melhor dizendo, na mesma normalidade caracterstica da
operao dos sistemas convencionais.
As trs maiores dificuldades enfrentadas nesta operao podem ser
consideradas comuns aos dois modelos de sistema e excedem a ambos nas
suas origens, merecendo ser relembradas.
A primeira a formidvel presena das guas pluviais no interior dos
sistemas, por ocasio das chuvas, trazendo-lhes todas as complicaes a
reconhecidas: o subdimensionamento das canalizaes, a indesejvel entrada
do lixo e da terra e a sedimentao de material pesado no interior das
tubulaes; enfim, a sensao bastante presente, desagradvel, de problema
que nunca se consegue resolver. A figura 84 ilustrativa de uma, apenas,
das situaes de entrada de guas pluviais no sistema separador, qual seja a
quebra de tampas de inspees com essa finalidade.
A segunda representada pela parcialidade, ainda, do atendimento da
populao, por conta das dificuldades j citadas de custo e de transtorno das
(novas) ligaes ao sistema, distintas das atuais que juntam as duas guas.
A terceira so as conseqncias, nos sistemas coletores, do mau uso das
instalaes sanitrias domiciliares, que costuma ser uma constante, quase,
nos assentamentos mais pobres (majoritrios na cidade do Salvador) 81, e
a que sempre se associam, agravando-as, s prprias falhas dos sistemas da
infra-estrutura desses locais.
No que tange operao do sistema condominial, nas reas por si dominadas
e que j atingem mais de um milho de pessoas, a questo que se deve
colocar como principal pelo quanto poder contribuir para perdas da
empresa a relativa ao cumprimento da regra (que fez parte do acordo de
adeso ao sistema), que estabelece uma menor tarifa para os usurios que
se dispuserem a realizar a manuteno dos seus ramais condominiais 82. A
EMBASA, conquanto no tenha a informao de quantas seriam, ao todo,
as operaes dessa natureza, tem a impresso, todavia, de que cada vez mais
as pessoas recorrem empresa, para a realizao delas. Antes de mais nada
preciso esclarecer, a esse respeito, que desde a primeira solicitao do
gnero, a empresa procedeu como se fosse correta e devida esta solicitao,
de tal sorte que, de sua parte, a populao jamais foi estimulada ao que seria
o cumprimento do acerto inicial. Outras consideraes devem ainda ser
apresentadas a esse respeito, dentre elas as seguintes:
t alm da ruptura do processo educativo que foi levado a efeito
durante as obras, voltado para sndicos e lideranas, e do
sistemtico cumprimento do processo condominial (reunio na
quadra, eleio de sndico, adeso formal ao sistema, cadastramento
individual do usurio, etc), deixou-se de aproveitar as ocorrncias
242

80

Seria uma grande lacuna no mencionar,


aqui, a engenheira Roberta Henriques,
gerente de Operao de Esgotos da
EMBASA, como um verdadeiro baluarte na
manuteno dos servios de Salvador e na
busca permanente de seu aperfeioamento.

81

Neste caso, o sistema mais atingido


o condominial, justamente por ser ele o
nico presente nessas reas de menor
urbanizao e mais baixa renda.

82

Na prtica, isto corresponderia aos


procedimentos de desobstruo de
canalizao, pelo usurio, no trecho
correspondente sua propriedade.

Sistema Condominial

Figura 84
$JUDQGHRFRUUrQFLDGDTXHEUDGHWDPSDV
das inspees do sistema de esgotos como
mais uma forma de penetrao das guas
pluviais. Fonte: Arquivos do Eng Ivan Paiva

reclamadas, sequer, como oportunidades (insubstituveis, quase)


para novos esclarecimentos, e mesmo para a alterao tarifria no
caso de o usurio insistir no descumprimento atual; ao contrrio,
nessas ocasies, tudo se tem passado como se fora esse conserto uma
obrigao da concessionria;
t a utilizao de dimetros de 150 mm nos ramais, iguais aos
utilizados na rede bsica, tambm se constitui em fator que
dificulta ao usurio distinguir o que seria o ramal condominial,
sob sua responsabilidade, e a rede, da responsabilidade da EMBASA;
valeria a pena, na hiptese de vir a ser retomada a questo, que uma
delimitao objetiva fosse usada entre essas duas responsabilidades,
por exemplo, fixando-se o dimetro de 100 mm, largamente
majoritrio nos ramais, como sendo o de exclusiva responsabilidade
social;
t NBJTEPRVFQSPWWFM QPSPVUSPMBEP que uma maioria dos
problemas dependentes de operao de manuteno venham
sendo assumidos pelos usurios e sem qualquer informao
EMBASA - pelo simples fato de ser esta via mais rpida para a
resoluo de problema que tantos transtornos costuma causar (a
menos, evidentemente, quando no sejam to simples as solues ou,
por outra, no sejam to grandes os transtornos);
t SFMFWBOUFUBNCNPGBUPEFRVF FNNVJUBTCBDJBT QPSGBMUBEF
maior conhecimento da teoria dos sistemas condominiais, vrios
ramais foram implantados abrangendo mais de uma quadra, o que
dificulta o entendimento da populao sobre suas obrigaes, alm de
tornar muito difcil a manuteno com esta modalidade de ramal;
t EFVNBGPSNBPVEFPVUSB DPOUVEP TFEFWFDPODMVJSRVFno esta
uma questo crucial, de custos to relevantes, tampouco que seja
definitiva a utilizao da tarifa reduzida conforme acerto durante
as obras; ao contrrio, poder ela ser revista progressivamente, ou ao
243

Empreendimentos condominiais de esgotos no Brasil

de pinar algumas consideraes sobre o que foi acima relatado sobre os


sistemas condominiais de Salvador, com a finalidade de levar o leitor a
algumas reflexes interessantes sobre o sistema, a cidade e o prestador do
servio, ao tempo em que estimule este ltimo ao interessante exerccio
de ver o BAHIA AZUL um pouco mais de fora, ou mais longe do seu
quotidiano. Por exemplo, revendo as adversidades enfrentadas na sua
construo e na sua operao e os acabamentos ainda demandados pelo
sistema fsico, para em seguida discutir-se algumas idias sobre prximos
passos.

$VJUDQGHVDGYHUVLGDGHV
Salvador e o seu sistema separador de esgotos, qualquer que fosse, haveriam
de levar ao seu prestador de servio as dificuldades que efetivamente
levaram e continuam a levar, a comear das dimenses em jogo: populao,
volumes de esgotos, estruturas. Especificamente na urbanizao da cidade,
essas dificuldades esto naqueles seus assentamentos complicados, na sua
topografia, seu traado, suas elevadas densidades, falta de espaos para quase
tudo e, sem dvida, para todas as obras da estrutura principal de transporte
244

Figura 85
As fotos aqu reunidas oferecem uma boa
viso da falta de espaos para a estrutura
do sistema de esgotos de Salvador, sempre
localizados s margens de cursos de gua

Sistema Condominial

dos esgotos. As fotos da figura 85 ilustram estas dificuldades com os espaos


vitais para o sistema de esgotos.
No seu povo, usurios do servio, esto as dificuldades naquela histrica e
cultural forma de afastamento dos esgotos conjuntamente com as guas de
chuva e, numa grande parte dele, na insuficincia de renda, de educao e
de conscincia ambiental que o levasse a cumprir as exigncias do sistema:
adequadas instalaes sanitrias, correto uso do servio e cumprimento
de obrigaes assumidas. No sistema separador de coleta, finalmente, as
adversidades esto nas suas exigncias operacionais, sobretudo, quanto
eliminao das guas de chuva de suas instalaes, das casas e das reas
pblicas. Quanto a esses fatores, ento, bem pode ser verdadeiro afirmar que
dificuldades de mesma ordem de grandeza at podem existir noutras partes
do planeta, maiores, contudo, no! Na figura 86, por exemplo, se utiliza o
simbolismo de uma escada para representar as etapas a serem vencidas, pela
populao, para que efetivem uma correta ligao ao sistema de esgotos.
Particularmente no que tange ao sistema condominial, esse empreendimento,
sem dvida, constituiu o seu grande teste, inusitado at agora, por tais
dificuldades e pela dimenso metropolitana. Ele, efetivamente, j chegou
quase totalidade das casas e evidenciou a certeza de que alcanar aquela
condio, oferecendo um adequado servio de coleta. Para isso tem se valido
de duas de suas tcnicas principais: a utilizao dos condomnios como
unidades da coleta, para uma mnima racionalidade no espao urbano
desordenado; e a elevada mobilidade dos ramais condominiais, para driblar
os vrios obstculos em seu percurso at a abordagem de cada ligao.
Um outro conjunto de dificuldades tambm viria com a prpria forma de
execuo das obras, sobretudo seus exguos prazos e o gigantismo dos lotes
em que foram elas divididas para desempenho simultneo, decorrncia,
por certo, da justa euforia do sistema institucional com a conquista dos
financiamentos e com a perspectiva da despoluio quando j era ela to
grande e visvel. Mesmo reunindo as maiores e mais habilitadas empresas
construtoras do Pas, no se pode deixar de reconhecer que aqueles fatores
no lhes foram propcios ao melhor desempenho. Particularmente quando
no eram por elas conhecidos os assentamentos sub urbanizados locais
(e suas complicaes), o modelo condominial que veio a prevalecer na
implantao do sistema (suas caractersticas e seus requisitos) e ainda uma
grande quantidade de reas que impossibilitariam (pela sua atual condio
de imprpria ocupao) a construo do que para elas estava previsto. Eram
muitas as questes a enfrentar para que fossem contnuas as obras e pouco o
tempo para os novos equacionamentos que se faziam necessrios.
Quanto ao prprio sistema, os problemas mais visveis que tiveram
a contribuio desses fatores foram grandes atrasos de programao,
descontinuidades do processo por substituies de contratantes, fraca divulgao
e preparao do prestador de servio para a absoro de to gigantesco sistema
em sua organizao e um grande nmero de trechos inacabados que, embora
pequenos, so responsveis por descontinuidades na coleta.
Pelo lado da populao, por seu turno, ainda h um grande nmero de
desatendidos, menos onde existem as redes e as ligaes intradomiciliares
245

Empreendimentos condominiais de esgotos no Brasil

esto em curso, e mais onde as redes ainda no foram implantadas. De fato,


eram muitas as transformaes exigidas dentro de cada casa e pouco o tempo
e os recursos para que cassem na vontade e nas possibilidades das pessoas.

(RTXHSRGHULDVHUIHLWRSDUDXPDPHOKRUD
progressiva
Como visto, o processo de implantao dos sistemas condominiais em
Salvador enfrentou e continua enfrentando todo tipo de dificuldades, mas
afinal apresenta um saldo de um milho de pessoas atendidas, moradoras de
mais que precrios assentamentos urbanos, particularmente no que tange
aos requisitos de um sistema separador absoluto de esgotamento sanitrio.
Dificilmente um tal xito encontra, nesse momento, em mesmas condies e
dimenses, algo similar no mundo.
Esse contexto de dificuldades e de xito merece uma melhor apreciao,
sobretudo quando se precisa enxergar o servio em curso como algo que deve
ser, literalmente, eterno e, alm disso, aperfeioado em carter permanente.
Tenha-se em vista, ento, que uma parte das dificuldades da cidade e sua
urbanizao, das pessoas e sua cultura sanitria e da EMBASA e sua menor
experincia com sistema condominiais em reas degradadas - j foi realmente
enfrentada e superada com a implantao do sistema, mas outra parte das
mesmas dificuldades permanecero daqui por diante, na sua operao
principalmente, mas tambm na complementao de obras que no se logrou
alcanar na poca oportuna.
Os esforos de superao praticados at agora suas prticas, seus meios,
seus jeitos de ser certamente no puderam trilhar os melhores caminhos
246

Figura 86
8PDHVFDGDUHSUHVHQWDQGRDVGLFXOGDGHV
para um usurio do servio de esgotos

Sistema Condominial

da racionalidade tcnica, do planejamento e da sensibilidade, por terem sido


premidos, quase esmagados, por um quotidiano de grandes problemas e de
urgentes solues. razovel que de agora por diante, na tal perspectiva de
eternidade, se busque a melhor forma de desenvolvimento dos trabalhos
importante para Salvador e significativa contribuio ao Pas e a uma grande
parte do mundo que ainda no aprenderam a entrar e a permanecer, com
servios adequados, nas reas urbanas aqui consideradas.
Na perspectiva de uma prospeco em maior profundidade, como
interessa nesta coleo condominial, no poderiam faltar, ento,
algumas elucubraes que sirvam s reflexes sobre o futuro dos sistemas
condominiais nas reas crticas de Salvador. Nesse sentido convm dividir a
questo em duas vertentes, distintas quanto ao grau de conhecimento que se
tem delas e quanto sua natureza, e distintas, tambm, conseqentemente,
quanto forma de encaminhamento das possveis solues.
A primeira delas a que comporta os problemas que esto na alada
exclusiva da EMBASA e as solues, portanto, dependem apenas dela (muitas
vezes requerendo uma integrao de aes no plano institucional). Esto
eles na engenharia propriamente dita dos sistemas e, em diversos graus de
dificuldade e de custos, normalmente complementaes ou suplementaes
de obras e adequao de procedimentos operacionais, em todas as instncias
do sistema, das instalaes intradomiciliares aos maiores interceptores que
demandam grandes desapropriaes. Sobre isto no h o que comentar,
muito menos o que sugerir.
A segunda vertente, por seu turno, a que est dentro das casas, onde tem
incio efetivo todo e qualquer sistema coletor de esgotos, no custa relembrar.
Est no saber e no querer realizar as ligaes, adequar as instalaes
domiciliares para isolamento das guas de chuva, atender ao estabelecido
nas regras do sistema, usar adequadamente o servio e pagar as suas
contas mensais. Suas origens, portanto, esto no nvel de informao e de
conscincia (ambiental) das pessoas, nas suas vontades, enfim; alm disso,
essa vertente muito pouco conhecida do sistema, na sua face problemtica
e, ainda mais, muito mais, nas suas solues. Ao contrrio da anterior, os
seus elementos problemticos devem ser aqui apreciados, numa perspectiva
de estimular reflexes sobre sua conduo futura. Num primeiro momento,
ento, no se h de ir alm de esforos que se dirijam, apenas - tendo em vista
a grandeza e complexidade do universo - para o conhecimento do problema,
no que a sistemtica a ser adotada dever utilizar mtodos estatsticos e que
se apiem em duas origens, a saber:

83

Considerar, aqui, os diferentes dimetros


adotados nos ramais condominiais
(100 e 150 mm), j que os requisitos de
manuteno so crescentes com eles; os
GRVGRLVPDLRUHVKiTXHYHULFDUVmR
possivelmente maiores que a capacidade
comunitria de execuo.

t BRVFQSPWFOIBEPBDFSWPEFJOGPSNBFTEB&.#"4"TPCSFBT
ocorrncias da operao e manuteno do sistema, inicialmente
atendo-se apenas quelas que, embora solicitadas e realizadas pela
empresa, seriam, segundo esta, da responsabilidade dos usurios
(conhecimento da perspectiva do usurio) 83;
t FBEFDBSUFSNBJTHFSBM FRVFQPSJTTPNFTNPEFWFDBSSFTUSJUB
a uma ou duas bacias de incio, e que se destine ao conhecimento
247

Empreendimentos condominiais de esgotos no Brasil

mais amplo do usurio, naqueles aspectos mais subjetivos acima


destacados (seu conhecimento sobre os sistema e as suas vontades).
Em ambos os casos, os universos seriam estudados atravs de amostras
representativas que, simultaneamente, abordassem o micro sistema que serve
casa pesquisada (conhecimento do seu desempenho naquilo que depende
da EMBASA), as instalaes domiciliares (seu atendimento aos requisitos
do sistema) e os pontos de vista do usurio sobre as questes destacadas. Os
resultados ento revelados permitiriam, fora de dvidas, um conhecimento
que nunca se teve, em Salvador ou noutra cidade do Brasil, sobre este estrato
scio-urbano (e seu servio de esgotos) de que se est agora tratando,
ensejando, possivelmente, boas indicaes para os futuros encaminhamentos
sejam aes efetivas, sejam desdobramentos das pesquisas. As bacias
utilizadas nas pesquisas, bacias-piloto, tambm o seriam para o novo curso
de ao, ele prprio devendo ser visto, e assumido, como uma pesquisa-ao,
onde se aprende e se aperfeioa o processo de correes com as prprias
realizaes.
Pode-se bem imaginar que as aes daqui desencadeadas seriam de
responsabilidade da EMBASA, quase sempre, mas tambm dos usurios;
seriam correes sobre o sistema fsico at ento imperceptveis, campanhas
educativas e persuasivas, reunies comunitrias, revises (pactuadas) de
regras, propagandas especficas, etc, etc, onde se tivesse a preocupao de
apenas exigir a parte do usurio, quando cumprida a parte da empresa que
logicamente a devesse preceder.

248

Sistema Condominial

17. ANEXO NICO


Conforme referncia na Introduo deste Caderno, o engenheiro Pery
Nazareth, organizou este anexo que constitui uma valiosa contribuio a
uma possvel comparao entre trs empreendimentos condominiais do
Brasil e um da Bolvia. Isto foi possvel com as informaes disponibilizadas
pelas empresas de saneamento do Distrito Federal, Bahia e Rio Grande do
Norte, atravs de seus tcnicos que acompanharam a produo deste livro e
foram seus colaboradores.
As comparaes esto expostas nos quatro sucessivos quadros adiante
apresentados e trataram, sucessivamente, das seguintes questes:
t as caractersticas gerais dos programas comparados: idade,
responsveis, grandes nmeros e informaes gerais;
t as regras bsicas adotadas em cada caso, no que tange s variveis
que ai esto em jogo: porte do sistema, alternativas de localizao, de
implantao e de manuteno do ramal condominial, custo da ligao, tarifa
do servio e condies de adeso dos usurios;
t avaliao da adeso e dos aspectos que a facilitaram ou dificultaram;
t e, finalmente, os aspectos institucionais propriamente ditos e
algumas caractersticas tcnicas dos sistemas.

249

Notas:
A tarifa do esgoto convencional remanescente no Distrito Federal corresponde a 100% do valor da conta de gua
A tarifa do esgoto convencional da EMBASA corresponde a 80% do valor da conta de gua
A taxa de ligao no Distrito Federal paga em parcelas, a partir do incio do funcionamento do sistema
$WD[DGHOLJDomRQR3URMHWR3LORWR(O$OWRHUDPHQRUTXHDWD[DGHOLJDomRFRQYHQFLRQDOYLJHQWHHDWDULIDGHiJXDHHVJRWRHUD~QLFD QmRKDYLDWDULIDGHHVSHFtFDGHHVJRWR 
No Distrito Federal as taxas de ligao e parte da tarifa retornavam originalmente a uma espcie de fundo destinado a investimentos na expanso dos servios
As quantidades de ligaes no DF e em Salvador so referentes ao ano de 2008. As quantidade em El Alto referente nicamente ao executado no piloto (1998-2000).

Empreendimentos condominiais de esgotos no Brasil

250

Notas:
As quantidades apresentadas para o DF, RN e BA so referentes ao ano de 2008. As
quantidade em El Alto referente nicamente ao executado no piloto (1998-2000).

Sistema Condominial

251

Empreendimentos condominiais de esgotos no Brasil

252

Sistema Condominial

253

Sistema Condominial

18. INTRODUO AO CADERNO 4

em-se a impresso de que o modelo condominial de distribuio


de gua oferece, potencialmente, maiores vantagens que o de
esgotamento sanitrio, o que pode ser muito interessante para pases
que, diferentemente do Brasil, ainda tenham graves problemas nesse setor.
No apenas na reduo dos investimentos, como principalmente na maior
oferta de procedimentos de controle da distribuio, e que podem vir
a ser de grande importncia para a reduo das perdas de gua desses
sistemas, seu mais grave problema. Este Caderno, a par de fornecer todas as
informaes sobre esta aplicao do modelo condominial, estar certamente
confirmando a assertiva acima.
Nos dois captulos iniciais, este Caderno trata dos elementos tericos do
modelo nessa sua nova aplicao: primeiro, de sua teoria propriamente
dita e, depois, das metodologias utilizadas para a sua consecuo. Sob esse
aspecto se imagina, inclusive, que o leitor mais aplicado dos dois primeiros
cadernos dessa srie condominial (que abordam estes mesmos elementos
para o esgotamento sanitrio) seria plenamente capaz de realizar, tambm,
a converso aqui empreendida, dada a similaridade de objetivos, instncias
de abordagem, tcnicas de engenharia e metodologias do modelo nos dois
setores de aplicao.
Em seguida, reproduz-se o Caderno 3, desta feita para a distribuio de
gua, utilizando-se dois universos que no poderiam ser mais distintos: as
favelas do Rio de Janeiro, difceis em tudo na topografia, na urbanizao,
nas elevadas densidades, na violncia e a cidade de Parauapebas, onde tudo
foi mais fcil segundo os mesmos aspectos. Comparando-se com o Caderno
3 das experincias com sistemas de esgotos, as semelhanas agora seriam,
respectivamente, com Salvador (onde tudo foi mais difcil) e com Braslia
(onde foram grandes as facilidades).
E, finalmente, o ltimo captulo foi reservado a consideraes finais sobre o
assunto do Caderno, destacando-se os seus aspectos mais importantes.

257

O Sistema Condominial na distribuio de gua

19. ORIGENS E FUNDAMENTOS


TERICOS DO SISTEMA CONDOMINIAL
DE DISTRIBUIO DE GUA
No Caderno 1 deste livro, foram expostos a teoria e o mtodo condominiais
com o esforo e a expectativa de que tenha sido isso feito reunindo a
plenitude das experincias e empreendimentos at ento realizados a este
ttulo. Tratou-se, portanto, dos sistemas condominiais de esgotamento
sanitrio. Quando se faz, todavia, uma releitura daquele texto, procurando
entend-lo alm daquele campo especfico, no ser difcil perceber-se que
o modelo ali considerado pode perfeitamente adequar-se a outros servios
urbanos, sobretudo queles mais dependentes de redes e do atendimento a
domiclio. Afinal de contas o que est naquele caderno , na verdade, uma
forma diferente de enxergar a cidade tomando-se o condomnio como
a sua unidade bsica e tirando-se partido do potencial da comunidade
(organizada em seus condomnios), para contribuir com a soluo de seus
problemas), numa forma que amplie o atendimento com os mesmos recursos
financeiros e igual ou superior qualidade nos servios resultantes, em relao
aos sistemas mais tradicionais.
Assim, neste captulo, se procura reescrever aqueles textos do Caderno
1, agora voltando-se especificamente para os sistemas de distribuio
dgua. Usando aquela mesma terminologia, de antemo, pode ser dito
que as Razes Determinantes e os Objetivos do novo modelo, agora no
abastecimento dgua, mudam um pouco; as Idias-fora, os mbitos de
Abordagem e as Tcnicas, contudo, permanecem os mesmos, com ligeiras
adaptaes; e a hidrulica dos condutos livres d lugar dos condutos
forados, mas continua atenta aos seus melhores conceitos e critrios. A
histria de como se construiu a distribuio dgua condominial bem mais
curta favelas do Rio de Janeiro e a cidade de Parauapebas, Par e ser
narrada em captulos subseqentes.

19.1 RAZES DETERMINANTES E OBJETIVOS


No Brasil, o abastecimento de gua das cidades, como sabido, j atende
a quase totalidade da populao, mas traz consigo pelo menos dois
extraordinrios problemas que o acompanham desde os seus primrdios. O
primeiro deles o volume assumido pelas perdas dos sistemas, que alcana
ou at supera, em muitos casos, a metade dos volumes produzidos 84, e o
segundo o mais que precrio atendimento de largos setores da populao,
invariavelmente os mais pobres.
Dentre as muitas causas que podem estar por trs desses problemas algumas
se sobressaem de forma contundente e podem representar o que seja mais
substancial nessa questo. So elas a sub urbanizao extensivamente presente
em praticamente todas as cidades, a fraca aptido dos operadores para a medio
dos consumos e o controle dos sistemas de distribuio e, de resto, a tecnologia
258

84

Num sistema de abastecimento dgua,


devem ser entendidas como perdas, na sua
forma mais ampla, aquela parcela do volume
captado para o abastecimento e que no
transformada em arrecadao pela gesto
do servio.

Sistema Condominial

utilizada nos projetos de redes que, no mnimo, no a mais adequada para o


enfrentamento dos dois problemas apontados como principais.

A sub urbanizao e as favelas


O conhecido problema, largamente comentado no Caderno 1 e apresentado
como srio obstculo para o esgotamento sanitrio quando inclusive
foi apontado como uma das razes para o desenvolvimento do modelo
condominial volta agora, desta vez como problema para o abastecimento de
gua. Na sua caracterizao, rememore-se a descrio desses assentamentos
feitas naquele Caderno e, se possvel, imagine qualquer deles que seja melhor
conhecido do leitor: topografia difcil (sempre pelos exageros dos relevos
movimentados ou das plancies alagadias), elevadas densidades, urbanizao
desordenada, casas sobrepostas e coladas umas s outras, falta de espaos.
Em resumo, extrema dificuldade para a individualizao do consumidor.
Para completar o quadro de dificuldades, a brutal violncia originada no
narcotrfico, que se apoderou de grande parte dessas localidades.
Face aos servios de distribuio de gua nesses assentamentos, no
difcil enxergar-se que, nas formas usuais de gesto, no seria possvel,
na plenitude, cadastrar e controlar ligaes, medir consumos, faturar
contas e, sobretudo, arrecadar de inadimplentes. E se isso fosse possvel,
a gesto de uma de suas casas custaria bastante mais que a do maior dos
usurios da cidade urbanizada. Tomando-se como exemplo a cidade do Rio
de Janeiro, o que se quer afirmar que, para um mesmo patamar de qualidade
da operao do sistema de gua, uma casa da favela da Rocinha demandaria
um custo operacional bastante superior ao de um edifcio do luxuoso bairro
do Leblon, o que chega a ser visvel nas fotos da figura 87. Isso, por conta
do inadministrvel controle sobre as canalizaes da distribuio e, mais
inadministrvel ainda, pela cobrana de contas em atraso, num contexto de
densidade e violncia como este a presente.
A conseqncia imediata dessa uma tal situao um terrvel ciclo vicioso:
reduz-se o suprimento, porque no h rentabilidade; o suprimento deficiente
leva inadimplncia; e esta chega a ser vista como benfica, porque justifica o
menor suprimento... Impem-se, portanto, estudos e pesquisas aprofundados
sobre a questo e, principalmente, um novo pacto sobre uma nova forma
de gesto dos servios. O modelo condominial, nessas reas, se prope a
oferecer melhores condies operacionais, mas no ir prescindir de medidas
outras que, conforme aqui afirmado, ainda no esto estudadas.

Medio e controle dos sistemas


Num sistema de abastecimento de gua as perdas significativas esto
localizadas nas redes distribuidoras e no interior dos prdios, uma vez que
nos sistemas de produo elas ocorrem apenas para lavagem das unidades
(e so reduzidas) ou, esporadicamente, em acidentes com adutoras, quando,
sendo quase sempre visveis, determinam seus reparos de imediato.
259

O Sistema Condominial na distribuio de gua

Desdobrando, ento, as perdas na distribuio, elas se situam em dois grandes


grupos. Em primeiro lugar, esto aquelas provenientes de escapamentos nas
canalizaes subadutoras, redes e ligaes em seus vazamentos naturais
ou acidentais, e que so variveis com as caractersticas hidrulicas do trecho
crtico, com a qualidade da obra e dos materiais, com a sua maior ou menor
visibilidade e com a presteza com que so realizados os reparos pelo prestador
do servio. O segundo grupo formado por aquelas aquelas que ocorrem
dentro da casa do usurio, possivelmente as mais expressivas no Brasil, e que
por sua vez podem ser classificadas da seguinte forma:
t consumos correspondentes a ligaes clandestinas, sejam as
que estariam cortadas pelo servio, mas na realidade teriam sido
religadas revelia da gesto, sejam aquelas que nunca integraram o
rol dos cadastrados (e dessa forma sempre teriam sido clandestinas);
o consumo cresce com o nmero de ligaes, que por sua vez cresce
com a inoperncia dos controles e da prpria represso a este tipo de
ocorrncia;
t consumos no registrados pelo micromedidor, em uma das duas
condies seguintes, ambas decorrentes da falta ou insuficincia
de controle por parte da gesto do servio: o micromedidor est
defeituoso e isto no foi percebido pela gesto; ou h uma fraude na
ligao, do tipo by pass do medidor, ou ocorrncia de uma ou mais
ligaes paralelas, no cadastradas;
t consumos subestimados, na ausncia de medidores, uma condio
que estimulante de consumos superiores quota arbitrariamente
definida e pela qual realizado o faturamento; esta condio, alm de
bastante injusta de um ponto de vista formal, representa uma situao
rigorosamente injustificvel para o servio e se constitui, com certeza,
numa m gesto;
260

Figura 87
As fotos acima so vistas areas dos dois
bairros citados, Rocinha e Leblon, e so
exemplares na ilustrao das diferenas

Sistema Condominial

t a simples inadimplncia de pagamentos relativos aos consumos


faturados, o que no deixa dvidas sobre a ineficcia da gesto, a qual,
em certo patamar, pode estimular um comportamento do usurio do
tipo no pago, nada me acontece e continuo com gua.

Modelo adotado
No se pode dizer que o modelo adotado para sistemas de abastecimento de
gua, no Brasil e tambm em todo o mundo, no se preste ao atendimento
das cidades brasileiras, mesmo das suas reas sub urbanizadas e com
aquelas caractersticas que so complicadoras para qualquer servio. Mas,
efetivamente, a sua principal marca a de oferecer, diretamente pela rede
distribuidora, uma ligao de gua a cada lote de terreno traz consigo
implicaes que no so das mais favorveis. Isso decorre da maximizao
da extenso de sua rede: maiores custos de implantao, operao e
manuteno; maiores transtornos para o fluxo de veculos e pedestres por
ocasio dessas operaes; criao de tantos pontos crticos de fugas de gua
quantas sejam as ligaes prediais, j que so elas realizadas atravs de furos
nos distribuidores, com a utilizao de acessrios nem sempre capazes de
garantir a desejada estanqueidade; e, sobretudo, maiores dificuldades para a
eficincia de um sistema de controle (o que grave num regime de elevadas
perdas como comum ocorrer aqui).
A par desses inconvenientes que decorrem de sua concepo bsica,
algumas outras questes tm-se mostrado problemticas na operao dos
servios de abastecimento dgua. Neste caso, so conseqncias de certas
prticas arraigadas no curso de projetos, obras e operao dos sistemas de
distribuio, todas elas possibilitando facilidades s perdas do servio. Dentre
as principais esto, por certo, as seguintes tendncias:
t DPODFOUSBPEBSFTFSWBPEPTJTUFNBBVNBPVQPVDBTVOJEBEFT 
de tal forma que resultem, para a distribuio propriamente dita
da gua, elevadssimas presses (quando se estaria aproveitando
ao mximo o mais que folgado intervalo de 10 a 40 mca para as
presses na rede, recomendado pelas Normas Brasileiras); alis,
parece que a prxis est, at mesmo, mais determinada pela opo
por maiores presses (e maiores facilidades operacionais, at mais
ao gosto da populao) do que pela disposio de reservatrios;
t concepo dos sistemas de distribuio apoiada em anis, o que,
a despeito de permitir alguma economia para os projetos e melhor
irrigao para o sistema, constitui, todavia, uma vlvula aberta
ao descontrole, sobretudo em presena de falhas de cadastro e
ampliaes desordenadas de distribuidores;
t uma inegvel preferncia, na operao e nos cuidados, de uma
maneira geral, com os sistemas de produo relativamente aos
de distribuio; no raro a ocorrncia de primorosas estaes
de tratamento de gua, em cidades brasileiras, convivendo com
deplorveis controles sobre a distribuio da gua, sendo mais
deplorveis, ainda, as perdas nesse sistema de distribuio.
261

O Sistema Condominial na distribuio de gua

Dessa forma, diferentemente do que ocorre com o esgotamento sanitrio,


no o dficit do atendimento que justificar a criao de um novo modelo,
a ponto de precisar-se de alternativas de soluo mais consentneas com
a plenitude do abastecimento, em que pese a sempre desejvel reduo de
investimentos em qualquer setor de atividades quando no ela decorrente
de qualquer perda de qualidade.
Nessas circunstncias, o que justifica um sistema de distribuio dgua
segundo o modelo condominial , principalmente, a sua significativa
contribuio a sistemas de controle sobre a operao, no que possa se
traduzir em maior regularidade da distribuio e significativa reduo
de perdas, alm de grande reduo nos investimentos que ele possa
proporcionar. Esses benefcios, que se espera demonstrar neste Caderno,
podero ser teis na implantao de novos sistemas, ainda inexistentes
em grande parte dos pequenos aglomerados, nas ampliaes que se
fazem necessrias em carter permanente em todos os sistemas e, talvez
o principal, na reposio das canalizaes de qualquer cidade que
estejam com seus prazos de utilidade vencidos ou cujos materiais sejam
inadequados.

19.2 FUNDAMENTOS E BASE DE SUSTENTAO


A teoria dos sistemas condominiais para esgotamento sanitrio, apresentada no
Caderno 1, a mesma que aqui se prestar para o abastecimento dgua, com
variaes, apenas, de foco. Repassam-se, ento, aqueles mesmos elementos,
agora mais direcionados para este outro setor: os objetivos do modelo e seus
requisitos, os seus instrumentos e tcnicas de abordagem e, por fim, as idias
bsicas que lhe podem impulsionar. Tanto quanto nos sistemas condominiais
de esgotamento sanitrio, estes elementos foram insumos na origem do processo
de criao, mas o desenvolvimento dessa nova aplicao do modelo condominial
ocorreu, de fato, na dotao dos sistemas de distribuio de gua em cerca de
trinta favelas do Rio de Janeiro e na cidade paraense de Parauapebas.

O objetivo
A utilizao do modelo condominial para sistemas de distribuio de gua
tem como seu objeto fundamental oferecer o possvel em recursos tcnicos
e ampliar as condies do controle de perdas nos servios, a fim de garantir
um menor custo e maiores facilidades para a implantao do sistema. Tanto
quanto no caso dos esgotos, sem qualquer perda de qualidade ou, repetindo
o Caderno 1, com a exemplar qualidade tcnica das solues, para que
atendam aos mais exigentes padres estabelecidos para a prestao dos
servios de saneamento, fazendo uso para isso do que de melhor e mais
moderno exista na tecnologia, na engenharia sanitria, na hidrulica e na
indstria. Escusado dizer-se, tambm, que o modelo atenda por igual aos
mais diversos setores da sociedade, constituindo um nico sistema que
interrompa aquele comentado apartheid, no saneamento, entre ricos e
pobres.
262

Sistema Condominial

As instncias do modelo e suas tcnicas


Tambm aqui o sistema condominial se organiza naquelas instncias
sucessivamente mais abrangentes e que equivalem, na prtica, s unidades
espaciais nas quais ocorrem a sua resoluo. Todas elas contemplam os seus
respectivos componentes materiais (tubulaes, elevatrias, estaes de
tratamento, etc) e, eventualmente, novas regras para a convivncia entre os
usurios e o prestador do servio 85. Essas instncias, as mesmas do sistema
de esgotos, mas com outras nfases e algumas nuances, podem ser repassadas
e adaptadas, como se explica a seguir.
Relembrando, o condomnio o conjunto de casas ou lotes situados
numa mesma quadra urbana, formando uma espcie de ilha cercada de
ruas por todos os lados, constituindo uma unidade de vizinhana que,
vantajosamente para o que se quer, tende a apresentar uma tendncia a
certa homogeneidade entre os vizinhos: na urbanizao, nas habitaes, nas
suas condies socioeconmicas e culturais, nos problemas e suas solues
(inclusive no setor do saneamento). Nos assentamentos menos urbanizados e
regulares, e nas favelas, os condomnios seguem os mesmos conceitos, mas a
quadra d lugar ao aglomerado de casas, contguo, e que definido (cercado)
por becos, vielas, canais ou escadarias. No aspecto da distribuio de gua,
os condomnios apresentam uma nica diferena em relao queles dos
esgotos: precisariam ser subdivididos no caso da sua variao de cotas
topogrficas ser superior ao que se defina para uma mesma zona de
presso 86. Esse espao assim condominial se constituir, ento, na Unidade
de Atendimento (da populao) do sistema de distribuio, numa forma
coletiva, como nos esgotos, mas garantindo a individualizao de cada
usurio, seu consumo e sua conta mensal.

85

No caso dos sistemas condominiais de


esgotos, a sua propenso a se tornar maioria
ou at mesmo chegar universalidade nas
FLGDGHVRQGHVHLQVWDOHPREULJDDGHQLomR
de novas regras de convivncia entre o
prestador do servio e o usurio. No caso
do abastecimento dgua, ao contrrio, a
eventual aplicao do modelo condominial
atingir sempre uma minoria (ampliaes,
substituies ou pequenas comunidades
de um universo mais amplo), de sorte que
as mudanas de carter socioinstitucional
devem ser relegadas.

86

A expresso est aqui assumida na sua


conceituao usual, qual seja, a de um
setor da cidade onde a rede de distribuio
WHQKDVLGRSURMHWDGDSDUDFDUFRQWLGDHP
determinado intervalo de presses.

O sistema fsico de distribuio de gua em cada condomnio ser o Ramal


Condominial, por extenso do conceito adotado no caso dos esgotos,
apenas que tem ele, agora, uma grave restrio: a de situar-se, sempre,
nos passeios ou caminhos exteriores propriedade privada, de modo
a garantir a mais perfeita individualizao do usurio parmetro
essencial na individualizao do seu consumo e da sua conta. Nas reas
urbanisticamente desarrumadas, ou nas favelas, sejam reas escarpadas ou
sejam baixadas, o seu traado segue o mesmo princpio, mas eventualmente
poder ser forado a alguma transgresso, o que deve ser sempre negociado
entre vizinhos. Esse ramal condominial equivale ao que seriam os ramais
prediais do sistema tradicional no mesmo condomnio (realizam o mesmo
papel de ligao rede coletora pblica), da porque, seguindo a tradio,
devem ter os seus custos sob a responsabilidade dos usurios - salvo poltica
em contrrio adotada pelos prestadores do servio.
No seu dimensionamento, devem seguir perfeitamente as leis dos
condutos forados da hidrulica e as regras que presidem os projetos das
colunas verticais de suprimento de gua dos edifcios de apartamentos,
sem quaisquer restries de dimetros. No projeto e execuo, as
profundidades devem ser as mnimas, compatveis, to-somente, com a
garantia de sua integridade e as definies do prestador do servio quanto
desejvel inviolabilidade da canalizao. A interligao de cada usurio
263

O Sistema Condominial na distribuio de gua

aos ramais se far sempre atravs de conexes industrializadas. O formato


e dimetros sero compatveis, a que se siga, j no domnio privado de
cada um, os acessrios caractersticos do prestador: registro de parada,
hidrmetro, torneira inicial das instalaes, etc, com as suas devidas
protees (como o satisfatrio nas ligaes tradicionais).
A instncia seguinte o Micro sistema, um conjunto contguo de
condomnios com uma nica alimentao de gua realizada a partir da
estrutura do sistema de distribuio, com a mesma zona de presso e
superfcie adequada realizao de uma medio da vazo afluente. Ele
constituir a Unidade de Distribuio da Cidade, que poder se originar
de um reservatrio ou de uma simples derivao na estrutura, com ou sem
a interposio de uma vlvula reguladora de presso e, desejavelmente, com
um medidor de vazo. Para os prestadores de servio que venham a realizar
um primeiro empreendimento segundo este novo modelo, recomenda-se que
o inicie atravs de uma experincia-piloto em um micro sistema.
O componente fsico desse micro sistema a sua Rede Bsica, de mnima
extenso, capaz de alimentar cada um dos condomnios, num nico ponto
preferivelmente o que se situe em sua posio mais elevada. Todas as
alimentaes condominiais, a partir desta rede bsica so realizadas atravs
da melhor combinao de conexes industrializadas capazes de realizar at
quatro derivaes em cada cruzamento de ruas, de sorte que inexistir, nela,
qualquer tipo de furo, potenciais pontos crticos do sistema. Na entrada de
cada condomnio, ser indispensvel a presena de um registro de parada
(capaz de garantir a interrupo do fluxo para o conforto de usurios e
operador durante as manutenes) e, desejavelmente, a instalao de um
hidrmetro controlador do condomnio, com o mximo rigor em sistemas
de controle de consumos, mas que no deve ser utilizado como referncia de
consumo para um rateio das contas individuais.
A caixa condominial que venha a proteger esses acessrios uma
caracterstica do prestador do servio. A figura 88, de um bairro da
cidade do Recife que apresenta uma variao na sua urbanizao,
pode ilustrar perfeitamente a delimitao de diferentes condomnios
quanto regularidade das quadras e o que seria a sua rede bsica de
mnimo percurso, tocando apenas cada condomnio, no ponto de seu
abastecimento. Os dimensionamentos hidrulicos da rede bsica, assim
como o seu projeto, construo e operao, seguiro os preceitos da
hidrulica e as recomendaes convencionais da engenharia sanitria para
condutos forados.
A ltima instncia local o Sistema-cidade, contemplando o conjunto
dos micro sistemas acima conceituados e mais, evidentemente, o que haja
de construdo em sistemas de abastecimento de gua anteriormente ao
modelo condominial. Enquanto componentes fsicos, alm dos anteriores
ramais condominiais e redes bsicas, aqui estaro as unidades de produo
do sistema e a estrutura do sistema de distribuio, esta ltima sendo
entendida como o conjunto das instalaes (canalizaes, elevatrias e
reservatrios) que interligam e alimentam os micro sistemas, e sobre a qual
cabe uma considerao especial. que alm de atender aos critrios usuais
264

Sistema Condominial

Figura 88
Num bairro varivel na sua urbanizao,
a delimitao de diferentes condomnios,
na primeira foto, e a sua rede bsica, na
segunda foto

de otimizao econmica-financeira, e obedecer, no seu dimensionamento,


aos ditames da hidrulica, deve ter a sua concepo pautada no sentido de
garantir a independncia de cada um dos seus micro sistemas, os quais
atenderiam ainda aos seguintes requisitos: toda a sua rea submetida
a presses to uniformes quanto possvel e prximas da mnima
admitida pelo prestador do servio, em face da minimizao de perdas;
alimentao nica, macromedida, controlada por registro de parada e
realizada a partir de reservatrio ou derivao no distribuidor principal,
eventualmente contando com a interposio de vlvula controladora de
presso. Observe-se, portanto, que micro sistemas e condomnios, numa tal
condio, estariam trabalhando sob as mais adequadas condies de presso
piezomtrica, como ponto de partida para o alcance de uma situao de
perdas mnimas.

As idias que lhe do fora


Expostas no Caderno 1, as idias-fora tiveram sua aplicao exemplificada
nos empreendimentos discutidos no Caderno 3, mas sempre com a
reafirmao de que so idias absolutamente universais, passveis de serem
exercitadas em qualquer ramo da atividade humana. O modelo condominial
estimula ao mximo que, nas concepes que nele se inspirem, as idias-fora
sejam contempladas ao mximo e sempre aliadas criatividade. Dessa forma,
os sistemas de distribuio de gua havero de aproveit-las, fazendo delas
insumos, que sejam fonte de energias e ossam substituir o dinheiro, reduzir
custos e melhorar qualidade.
A Participao Comunitria, por exemplo, se no esgotamento sanitrio o seu
exerccio era fundamental para conquistar as adeses, no abastecimento dgua
onde as adeses fluem espontaneamente com a simples chegada das obras ele
se torna importante para as informaes que possam racionalizar o consumo
265

O Sistema Condominial na distribuio de gua

e, nas reas sub urbanizadas, para ser um instrumento que possa ajudar na
construo de uma nova conveno sobre os servios de saneamento, capaz
de superar o ciclo vicioso a que se fez referncia anteriormente. Deste ltimo
ponto de vista, ento, uma verdade absoluta que sem a participao no
haver a paz nos morros entre usurios e prestador de servio.
A forma mais objetiva de participao da populao no seu abastecimento de
gua o pblico e regular 87 - aquela que chega contribuio efetiva na prpria
construo do sistema, seja pela contribuio financeira que viabilize os ramais
condominiais, seja na sua prpria execuo, nos casos onde a falta de recursos
financeiros est determinando a ausncia dos servios (a esse respeito, os casos
de Parauapebas e das favelas do Rio de Janeiro que sero comentados adiante,
so exemplares). Esta frmula ser possivelmente insubstituvel quando o Brasil
resolver enfrentar, decididamente, o abastecimento de gua das populaes
rurais, situadas em vilas e pequenos aglomerados.
A segunda idia-fora proposta no Caderno 1, Adequao Realidade,
foi justamente aquela que praticamente preside a concepo do modelo
condominial de distribuio de gua, quando ele, para atend-la, busca a
maior contribuio possvel reduo das perdas e a minimizao de
investimentos e custo operacional. Para tornar mais compreensvel este
esforo de adequao realidade dos sistemas de distribuio de gua,
vale a pena lembrar algumas prticas comuns em seus projetos e que tm
atropelado esta preocupao. Primeira, e mais evidente, a adoo de elevadas
presses, principal favorecedora do acrscimo de perdas para mesmos
pontos de escapamento de gua; e depois, a quase universalizao das redes
entrelaadas e s vezes gigantesca que, voltadas na sua concepo inicial
para a racionalidade da distribuio, terminam por tornar-se simplesmente
descontroladas. J se ouviu de uma autoridade do setor, no Brasil, que uma
grande parte das redes de distribuio dgua, das nossas cidades, so, na
realidade, tangidas ao invs de operadas.
A Integrao de Agentes e de Aes, terceira das idias discutidas no
Caderno 1, em verdade, propunha esforos nesse sentido entre os sistemas
de esgotos, da drenagem e da viao das cidades, objetivando a racionalidade
mnima, sobretudo, nos projetos e na construo desses sistemas; ou a
integrao de unidades de processamento final dos efluentes ao paisagismo
(enquanto instalaes fsicas) e produo econmica (enquanto utilizao
de insumos nos seus processos); ou a juno com os agentes de sade
visando associao promissora dos dois servios. No caso do abastecimento
de gua, no h registro, salvo melhor juzo, de qualquer integrao com
outros sistemas da infra-estrutura urbana, mas certamente sero elas
fundamentais quando, ao se tentar enfrentar radicalmente aquele ciclo
vicioso nos assentamentos problemticos (que certamente est presente
noutros servios que chegam s casas, como os de saneamento), se dever
reconhecer a evidncia de que se impe um novo pacto, novo concerto de
aes (usurios - prestadores), e que ele ser to mais forte e profcuo quanto
mais incluir e reunir outros servios drenagem, energia eltrica, coleta de
lixo, pavimentao, etc.
266

87

importante destacar esta natureza do


servio porque, quando ele no provm do
sistema institucional, j sabido que a
participao comunitria que, sob as mais
deferentes formas, prov os seus servios,
tendo em comum entre eles, apenas, o
motor dessa ao que a essencialidade do
servio, o fato de inexistir vida sem gua.

Sistema Condominial

Figura 89
Vistas areas da cidade de Parauapebas
e da favela do Borel, do Rio de Janeiro,
evidenciando as expressivas diferenas das
duas reas urbanas

As oportunidades que fizeram a sua construo


Para quem compreendeu satisfatoriamente as idias do sistema condominial
de esgotos sanitrios perfeitamente possvel antever a possibilidade
de sua aplicao aos sistemas de distribuio de gua. Da ser possvel
antever, tambm, como se faria um projeto com esta finalidade, como se
implantaria, como se operaria. Evidentemente que se predispondo no ensejo
de tal experimentao, aos procedimentos tpicos da pesquisa-ao, do
aperfeioamento permanente ao longo do processo, como so pressupostos e
recomendaes da prpria teoria condominial.
Exatamente nessas condies foram projetadas, construdas e esto sendo
operados os dois grandes empreendimentos de sistemas de distribuio
de gua que se pautaram pelo modelo condominial e que, dessa forma,
plantaram as suas origens. Um est implantado no Rio de Janeiro, em cerca
de trinta das suas favelas e abrange uma populao de pouco menos de
1 milho de habitantes; o outro, na cidade de Parauapebas, no Par, que
atende 140.000 habitantes. Ambos foram iniciados na primeira metade
da dcada de 90, corresponderam a realidades absolutamente distintas,
conforme as revelam as vistas areas da figura 89 no fsico, no urbanstico,
no social e no institucional. Eles sero abordados em maior profundidade
em captulos especficos deste Caderno.
Alm desses sistemas brasileiros, so conhecidos pelo menos dois outros
projetos do gnero, um deles em EL Alto, na Bolvia, para uma populao de
100.000 habitantes, iniciado h mais de dez anos, e outro, em Lima, no Peru,
que vem sendo implantado nos ltimos cinco anos, para atender pelo menos
1 milho de pessoas.

267

O Sistema Condominial na distribuio de gua

20. METODOLOGIAS APLICVEIS


AOS SISTEMAS CONDOMINIAIS DE
DISTRIBUIO DE GUA
No caso dos esgotos sanitrios, as metodologias abrangeram a engenharia
do sistema e o processo condominial propriamente dito. Na distribuio de
gua, por seu turno, esses esforos e essa abrangncia podem ser menores,
restritos, por exemplo, engenharia dos sistemas, em razo de dois aspectos
presentes na questo. O primeiro deles a massificao j alcanada pelo
abastecimento das cidades, em decorrncia do que se consolidou pelos
seus dois lados o institucional e o social - uma cultura nas formas de sua
implementao que muito dificilmente abriria espao para algo feito de forma
diferente e que viesse a constituir um diferencial do modelo condominial. O
segundo a j referida menor exigncia da participao comunitria neste
setor do saneamento, j que a adeso ao servio francamente espontnea
por parte da populao e os requisitos de consumo so bastante mais simples
e quase intuitivos.
As hipteses que fugiriam dessa situao, por demandarem um processo
participativo, tambm j comentadas, podero perfeitamente utilizar a
metodologia exposta no caso dos esgotos, em todos os seus aspectos e
apenas adequando-se o tema, ou, se for o caso, devero adotar metodologias
especficas da situao ou do executante. Seriam elas a educao sanitria
voltada para populaes rurais (ou de costumes ainda rurais); a busca de
um acordo em torno dos investimentos nos ramais condominiais, seja
para o seu pagamento, seja para a sua construo 88; ou situaes que
justifiquem trabalhos especiais, tais como a realizao de estudos e pesquisas
em assentamentos sub urbanizados (o que, alis, tem uma importncia
excepcional).
Assim, este captulo abordar, to-somente, a Rede Bsica e os Ramais
Condominiais, nos seus projetos, construo e operao.

20.1 A ENGENHARIA DA REDE BSICA


Como visto no captulo anterior, no seu traado, os ramais condominiais
proporcionam a mxima racionalidade da rede bsica de distribuio, a
partir da minimizao de sua extenso, mas do ponto de vista da hidrulica
(e de seu dimensionamento), da sua construo e da sua operao, contudo,
nada a distingue, em princpio, dos procedimentos mais usuais com os
sistemas tradicionais. Nesse sentido, ao abordar-se, aqui, a Engenharia da
Rede Bsica dos estudos e projetos, construo e operao embora
no se deixe maiores lacunas, conferir-se- maior ateno aos aspectos que
sejam mais caractersticos do modelo condominial.

268

88

Sobre essa construo, atente-se para a


descrio do caso de Parauapebas, adiante
neste Caderno, quando esto destacados
os papis da populao e do prestador
do servio nesse processo, respeitados
os limites tcnicos do primeiro, e os
QDQFHLURVGR~OWLPR

Sistema Condominial

Indicaes para a concepo do sistema de


distribuio
A depender do tamanho das cidades, a planta necessria para esta concepo
pode ser, quase, a que estiver disponvel, com curvas de nvel a intervalo
de 5 metros ou menor e em escala de 1:1000 at 1:10.000, j que o sistema
pressurizado e a menor ordem de grandeza das presses em jogo de
5 metros, a metade da menor requerida segundo as Normas Brasileiras.
Numa hiptese extrema, uma planta apenas planimtrica, do tipo que pode
ser obtida de imagens de satlite, pode servir a este trabalho, no mximo
requisitando a medio de algumas cotas esparsas.
A preocupao fundamental do modelo condominial em sistemas de
distribuio de gua com a criao de condies capazes de contribuir
significativamente para reduo das perdas. Nesse sentido, os fatores
principais na concepo desses sistemas so, exatamente, a possvel
limitao das presses, a oferta das melhores condies para a
macromedio, a medio condominial e a minimizao da extenso das
canalizaes.
A limitao das presses alcanada atravs da estratificao topogrfica
da cidade, a intervalos de 20 a 25 metros, por exemplo, tornando cada
setor assim delimitado num micro sistema de distribuio, estanque e com
alimentao nica e devidamente macromedida. A configurao geral da
cidade e a posio da(s) captao(es) de gua ser(o) determinante(s) do
caminhamento das subadutoras e reservatrios de alimentao desses micro
sistemas, sendo recomendveis duas condies gerais para estas unidades: a
descentralizao economicamente tolervel dos reservatrios e a realizao
de derivaes nas subadutoras, exclusivamente, para atendimento dos micro
sistemas. Nelas, onde no haja reservatrio e a presso precise ser contida,
indispensvel, logicamente, a interposio de vlvula redutora de presso
ou, se possvel, de um tipo adequado de caixa de quebra-presso, j na
derivao.
Com relao rede bsica de distribuio e sua oferta de condies
para ampliao dos controles que podem reduzir as perdas - permanece
o conceito clssico do modelo condominial, que a rede tocando
cada quadra em apenas um ponto, mas se altera a hidrulica, com a
pressurizao das canalizaes. O ponto a ser tocado j no precisa ser
o mais baixo, concentrador natural dos esgotos, passando a ser qualquer
uma das suas esquinas. Com isso a rede tende a reduzir ainda mais a sua
extenso (relativamente a de esgotos), j que passa a ser ela ditada, num
mesmo micro sistema, apenas pela geometria das ruas. Se nos sistemas de
esgotos a sua rede bsica condominial alcana cerca de metade das ruas,
nos sistemas de distribuio este ndice jamais supera os 30%, sendo tanto
menor quanto mais regular o traado urbanstico. Na figura 90, por
exemplo, a mesma que se usou no Caderno 2 para ilustrar a formao da
rede bsica de esgotos, esto indicados a sua rede bsica de distribuio
(em vermelho), os seus ramais condominiais (azuis), as suas derivaes
269

O Sistema Condominial na distribuio de gua

(Di) e os potenciais pontos para insero de registros de parada e


macromedidores (Ri).
A extenso da rede bsica, neste caso, limitou-se a apenas 20% do que
seria a extenso de uma rede convencional (nmero que praticamente
invarivel com a mudana do ponto de alimentao do micro sistema),
ao passo que os seus ns foram 6, contra os 13 que, no mnimo, seriam
necessrios no outro sistema; as derivaes so 5 para o abastecimento
de 12 quadras e dois registros, e desejavelmente dois hidrmetros seriam
necessrios para o controle quase que absoluto do setor. Com relao s
derivaes que abastecem as quadras, a sua composio ser uma escolha
do prestador do servio, usualmente sendo adotadas uma das opes
seguintes: cruzeta nica para quatro quadras, com suas duas sadas sendo
seguidas por peas Y e sucessivas redues; ou uma cruzeta para cada par
de quadras frontais, e mesmas redues.

270

Figura 90
Traado tpico de uma rede bsica de
distribuio de gua

Sistema Condominial

Projeto da Rede Bsica


Para esse projeto as Normas Brasileiras indicam a necessidade de uma planta
planialtimtrica e semicadastral da cidade, com curvas de nvel a cada metro.
A rigor, a pressurizao do sistema capaz de permitir que se trabalhe
com uma base menos exigente, e que deve ser avaliada em cada caso. O
que ir requerer maior preciso sero os detalhes dos ns das canalizaes,
onde as peas e conexes precisaro estar bem especificadas, quantificadas
e posicionadas em esquema caracterstico. A partir do lanamento da
rede bsica conforme as indicaes do item anterior, seguem-se, aqui, os
sucessivos procedimentos que definem o seu projeto:
a) Clculo das demandas e vazes
Na sua essncia, esses estudos no diferem daqueles corriqueiramente
realizados com as mesmas intenes por diferentes projetistas de redes
convencionais, razo pela qual sero vistos, aqui, superficialmente. O modelo
condominial apenas estimula e defende dois procedimentos que nem sempre
so os adotados, quais sejam:
t maior importncia adoo de densidades de saturao em cada
micro sistema (e em cada condomnio) que esteja na iminncia de
sua implantao, relativamente formulao de hipteses nem
sempre crveis sobre a distribuio populacional futura pelos espaos
citadinos;
t considerao das vazes concentradas nos pontos de suprimento
das quadras, na montagem das planilhas de dimensionamento, j
que isto uma realidade dos sistemas condominiais 89.
Os parmetros de consumo empregados no clculo das vazes so aqueles
definidos nas Normas Tcnicas. O consumo per capita de gua deve ser
estabelecido preferencialmente com base nos dados de micromedio da
rea do empreendimento ou, na falta desses, por extrapolao de consumos
conhecidos de bairros de caractersticas semelhantes. As vazes mximas e
mnimas devem ser preferencialmente estimadas com base em hidrogramas
de consumo de gua da rea. Na maioria das vezes, infelizmente, esses
hidrogramas no estaro disponveis. Nessas situaes, os parmetros
a serem considerados no clculo, conforme recomendam as Normas
Brasileiras, so aqueles genricos, de uso consagrado:

89

Se esta base cadastral montada em


arquivo dinmico e permanentemente
atualizada, se consegue manter as
demandas, ao nvel de cada condomnio,
WDPEpPVHPSUHDWXDOL]DGDVH~WHLVSDUD
YHULFDo}HVGRIXQFLRQDPHQWRGDUHGHH
para os sucessivos projetos de ampliao. A
mesma base, devidamente adaptada, servir
tambm ao sistema de esgotos.

- Coeficiente de mxima vazo diria (k1)

1,2

- Coeficiente de mxima vazo horria (k2)

1,5

As vazes totais de projeto no diferem na sua essncia de um sistema


condominial para um sistema convencional equivalente e dependem
fundamentalmente da populao e das quotas de consumo. A distribuio
dessas vazes ao longo dos distribuidores, no Sistema Condominial,
contudo, obedece quela lgica j referida, distinta da comumente adotada
nos sistemas convencionais.

271

O Sistema Condominial na distribuio de gua

Apesar de ser possvel manter as tcnicas e critrios convencionais para


o clculo de vazes, para dimensionamento do sistema condominial,
recomenda-se uma abordagem diferente, conforme descrita a seguir, por
ser mais compatvel com o modelo aqui considerado. Alm disso, facilitam
o uso de tcnicas de dimensionamento simplificado, muito teis em
determinadas situaes.
O sistema convencional assume que os prdios se ligam diretamente
rede distribuidora. Com isso, as vazes de gua tendem a distribuirse de maneira relativamente uniforme ao longo de toda a rede e so
representadas por taxas lineares, o que no , contudo, o mtodo que
melhor representa a lgica de vazes do Sistema Condominial. Neste, os
prdios so conectados ao distribuidor pblico indiretamente, por meio
dos ramais condominiais, que, estes sim, abastecem diretamente cada
lote de terreno atravs de uma ligao predial. Por isso, a forma como as
vazes alimentam a rede bsica melhor representada por um modelo
baseado em demandas pontuais, com o qual tambm se facilita o clculo
de vazes com vista ao dimensionamento simplificado. Qualquer que seja o
modelo adotado, contudo, a partir de contribuies pontuais ou lineares, os
resultados finais do clculo de vazes tendem a ser bastante aproximados.
No poderia ser diferente, uma vez que as vazes consideradas so as
mesmas, variando apenas o critrio de sua atribuio aos trechos da rede
bsica. A figura 91 ilustrativa das duas situaes.
A vazo de dimensionamento aquela mxima horria do dia de maior
consumo e o seu clculo expedito fica facilitado quando ela realizada com
base na contagem de unidades de demanda.
b) Dimensionamento hidrulico
Como no poderia deixar de ser, a hidrulica da rede bsica condominial
a mesma que se aplica s redes distribuidoras dos sistemas convencionais.
Dessa forma, seu dimensionamento realizado com auxlio das mesmas
frmulas, critrios e parmetros comumente empregados no projeto de
redes convencionais, seguindo, na essncia, o estabelecido nas Normas
Brasileiras destinadas a tais projetos. Da mesma forma se deve proceder
com a instalao de registros de descarga, em seus pontos mais baixos, e,
eventualmente, de ventosas em pontos altos de transio. A marcha de seu
clculo segue os mesmos passos dos dimensionamentos tradicionais, como
se indica a seguir. Atendendo as Normas Brasileiras o clculo da perda de
carga distribuda deve ser feito, preferencialmente, adotando-se a frmula
Universal de Perda de Carga, com o coeficiente de atrito f calculado pela
expresso de ColebrookWhite.

272

Sistema Condominial

Figura 91
Apropriao de vazes de
dimensionamento nas redes
de distribuio de gua

Frmula Universal
hf
hf

fu

L
V2
u
Dh 2 u g

perda de carga distribuda (mca)

coeficiente de perda de carga distribuda (adimensional)

comprimento (m)

Dh

dimetro hidrulico (m)

velocidade (m/s)

acelerao da gravidade (m/s2)

Frmula de Colebrook-White
1
f

2 u log(

K
2,51

)
3,7 u Dh R u f

rugosidade uniforme equivalente (m)

nmero de Reynolds (adimensional)


273

O Sistema Condominial na distribuio de gua

Frmula de Reynolds
R
N

V u Dh
N

viscosidade cinemtica (m2/s)

O dimetro mnimo da rede deve ser de 50 mm. As velocidades mnima e


mxima a serem adotadas nas tubulaes devem ser de 0,60 m/s e 3,5 m/s.
c) Ordens de servio como alternativas aos projetos executivos
A experincia tem evidenciado a impossibilidade de se antever, a priori,
projetos de obras enterradas como as redes de distribuio de gua. Por
mais que se detalhe um desses projetos, as caractersticas e interferncias
contidas no subsolo sero plenamente conhecidas apenas quando da
execuo das obras, quando ento os ajustes finais no projeto so feitos.
Nos casos de distribuio de gua, pela ocorrncia de presses, as alteraes
ocasionais se tornam, inclusive, muito simples. O projeto bsico, como
conhecido, se adequadamente elaborado, via de regra ser suficiente,
do ponto de vista de engenharia e de oramento, para a caracterizao,
contratao e execuo do empreendimento. Portanto, o projeto executivo
da rede bsica de distribuio de gua, em sua forma tradicionalmente
conhecida, salvo em excepcionalidades e em grandes dimetros,
perfeitamente dispensvel, sem qualquer prejuzo para a execuo das obras
e com grande economia de tempo e recursos. Ele deve ser realizado na
ocasio da implantao do empreendimento, pari passu com as prprias
obras, e detalhado, j, na forma de ordem de servio. a forma mais racional,
econmica e confivel para a otimizao do sistema.
Para que a economia de tempo e recursos que tal procedimento proporciona
sejam viabilizados, fundamental que os organismos financiadores avancem
e aceitem o projeto bsico como instrumento suficiente para a contratao da
execuo do empreendimento, o que j tem sido um fato crescente. A Ordem
de Servio, por seu turno, composta, grosso modo, dos seguintes elementos:
t JEFOUJDBPEBDJEBEF CBJSSP micro sistema e distribuidor, data e
responsvel pela elaborao;
t QMBOUB DSPRVJ
NPTUSBOEPPUSBBEPEPTUSFDIPTEBSFEFCTJDB
a serem executados; localizao e numerao dos ns e trechos;
dimetros e direo do fluxo; eventuais interferncias;
t QSPGVOEJEBEFTFMBSHVSBEBTWBMBT
t FTQFDJDBPEPTSFHJTUSPT WMWVMBTFNFEJEPSFTBTFSFNJOTUBMBEPT
nas derivaes que atendero cada um dos micro sistemas, com o
detalhamento de suas respectivas caixas de proteo, conforme os
modelos em voga no prestador do servio;
t EFUBMIBNFOUPEPTOTe relao dos materiais.
274

Sistema Condominial

Execuo da Rede Bsica


Algumas disposies construtivas podero anteceder a execuo da obra, se
for o caso de existirem particularidades da cidade que devam ser levadas em
conta para a construo mais econmica da rede, e para se evitar ao mximo
as surpresas durante a construo. As mais importantes so as que dizem
respeito s formas mais convenientes de lidar, por exemplo, com:
t elementos dos outros sistemas (enterrados) da infra-estrutura
da cidade drenagem, esgotos e, eventualmente telefonia, gs e
eletricidade no que devero variar as indicaes construtivas que
minimizem interferncias e agilizem procedimentos para a superao
de obstculos junto aos respectivos responsveis por tais sistemas;
t caractersticas do comrcio local que possam trazer importantes
contribuies construo da rede, por exemplo, disponibilidade
e preo de determinado tipo de tubulao, ou indisponibilidade de
equipamentos ou mo-de-obra especializada para determinadas
tarefas que vo estar presentes no sistema;
t verificao da rede prevista em face dos transtornos potenciais do
trnsito local e que possam representar maior comodidade ao fluxo
de veculos, mesmo que, eventualmente, encaream a obra.
Com relao execuo propriamente dita da rede de distribuio, nada
h a distingui-la da execuo de redes convencionais, dispensando-se,
portanto, comentrios a respeito. Quanto aos materiais utilizveis para a
rede propriamente dita, para as suas conexes, peas especiais e caixas de
proteo, e para as suas estaes elevatrias, eles devem ser uma opo
do prestador do servio, em funo da sua experincia anterior. Apenas
se propugna que sejam devidamente padronizados e modulados de forma
a favorecer as atividades de manuteno e reposio. O cadastramento
indispensvel como elemento de suporte operao e s futuras ampliaes,
e deve ser realizado com perfeio, locando os ns da rede relativamente a
pontos fixos e visveis do local.

Funcionamento da Rede Bsica


Aqui, outra etapa sem diferenas em relao aos sistemas tradicionais. Apenas
algumas recomendaes que corrijam situaes comuns no Brasil. Por
exemplo, uma maior perfeio no registro das ocorrncias de manuteno,
tornando possvel a acumulao de informes que permitam os melhores
estudos estatsticos sobre os acidentes, para uma ao mais efetiva de sua
erradicao. Uma rede bsica do sistema condominial em absolutamente nada
difere das redes tradicionais quanto ao seu funcionamento e manuteno,
chamando-se a ateno, apenas, maior freqncia com que ocorrem as
vlvulas controladoras de presso e os medidores de vazo, fundamentais na
ampliao dos mecanismos de controle das perdas. A aferio e a manuteno
preventiva desses equipamentos devem ser realizadas regularmente, e a sua
manuteno corretiva com a mxima presteza. Nesse sentido, o prestador do
servio ter que cuidar de bem dimensionar-se para as tarefas que adviro e
para o treinamento das suas equipes.
275

O Sistema Condominial na distribuio de gua

Por fim, devem ser destacados os procedimentos de controle do sistema


de distribuio condominial, que devem ser operados regularmente. So
eles dependentes de uma atualizao cadastral permanente, incorporada
aos procedimentos usuais do prestador do servio que chegam aos
consumidores (leitura do hidrmetro e entrega das contas, por exemplo) e
so principalmente os seguintes:
t leituras mensais dos medidores de micro sistemas, para
sua comparao com as leituras, em mesmos perodos, dos
hidrmetros condominiais e dos individuais, com o objetivo de
situar perfeitamente a localizao e a quantificao das perdas;
t BOPUBPEPUFNQPEFJOUFSSVQPEFVYPFNDBEBGFDIBNFOUP
de registro de parada, o que, sendo realizado sistematicamente,
permitiria o clculo mensal do ndice de desabastecimento.
Este ndice de Desabastecimento calculado com os elementos anotados
mensalmente sobre o fechamento de registros (tempo da parada e quantidade
de usurios abrangidos) 90, cuja somatria deve ser comparada ao produto do
universo de usurios pelo tempo caracterstico do ms. O ndice procura medir o
afastamento do que seria a marca de atendimento representada pelo abastecimento
contnuo, em todo o ms, da totalidade dos usurios, sendo evidente que o seu
valor ser to melhor quanto mais prximo de zero. O seu clculo, portanto, ser
dado pela expresso:
ID [ (ti x ni) : T x N] x 100, onde
ti ......... tempos (em minutos) de cada interrupo
ni ........ quantidade de ligaes correspondente a cada evento
N ........ nmero total de ligaes
T ......... tempo do ms em minutos (ou 1440 x no de dias)

20.2 A ENGENHARIA DO RAMAL CONDOMINIAL


Disposies preliminares
O sistema condominial de distribuio de gua e, particularmente, os
seus ramais condominiais, representa uma significativa mudana de
comportamento para o prestador do servio no projeto, na construo
e na operao mas nada de novo representa para os usurios do sistema
tradicional. A menos, evidentemente, que se deseje torn-los participantes
ativos, ou at mesmo parceiros na sua construo como foi, por exemplo, no
caso da cidade de Parauapebas onde as mudanas para os usurios tambm
foram bastante evidentes.
Diferentemente das alternativas oferecidas aos usurios de esgotos, em
seus condomnios, para localizao dos seus ramais condominiais, na
distribuio de gua, a alternativa para isto nica, sempre nos passeios ou,
na sua ausncia, nos espaos longitudinais que melhor os substituam. Isto
decorrncia de dois fatores que se apiam reciprocamente, quais sejam: a
necessidade de individualizao do usurio perante o servio seu consumo,
sua medio, sua conta ; e, por outro lado, a pressurizao do sistema que
sempre garantir essa forma de atendimento.
276

90

O desenho da rede distribuidora, de feio


condominial, garante estas medidas uma
vez que so conhecidos os usurios que
correspondem a cada registro de parada
instalado no sistema e cujos fechamentos
so os determinantes da suspenso do
abastecimento.

Sistema Condominial

Projeto e ordem de servio dos ramais


condominiais
Na sua localizao nos passeios, os ramais condominiais de distribuio de
gua devem distar cerca de 70 cm dos muros e guardar uma profundidade de
40 cm, na hiptese de ocorrncia de pavimentao, ou pouco mais em caso
contrrio, com a preocupao de que liberem espaos para a localizao dos
ramais condominiais de esgotos. Os materiais utilizados na sua composio
devem ser de PVC, na especificao da escolha do prestador do servio, e a
definio dos dimetros obedecer ao dimensionamento hidrulico, realizado
para a hiptese suposta de saturao na ocupao de cada condomnio,
adotando-se o dimetro mnimo de 25 mm (dimetro externo, e cujo
dimetro de referncia, em polegadas, de de polegada).
No ponto de alimentao de cada ramal, dever ser instalado, sempre,
um registro de esfera e, desejavelmente, na seqncia, um medidor de
vazo compatvel com a demanda do condomnio. O primeiro permitir,
confortavelmente, as operaes corretivas, para o prestador do servio, e
a continuidade do suprimento para os condomnios vizinhos. O segundo,
ser um eficiente controlador do consumo do condomnio, magnfico fiscal
dos seus hidrmetros individuais, jamais sendo suas medies utilizadas
para efeito de faturamento (o que seria uma medida bastante injusta e, sem
dvida, fator de desavenas entre vizinhos). Quando forem escassos os
medidores individuais (fato ainda muito comum no Brasil, infelizmente),
os disponveis devem priorizar para a medio de condomnios, no todo
ou em parte das suas ligaes, e podero orientar as prioridades para a
medio individualizada. Em substituio ao colar de tomada para a
ligao domiciliar, ser empregado derivao em T, que dever ser
aplicada durante a execuo do ramal, medida essa que eliminar aqueles
conhecidos pontos crticos (francamente passveis de vazamento).
O dimensionamento do ramal realizado empregando-se a equao de Hazen
Williams com o coeficiente de atrito C igual a 125 (tubulao de pequeno
dimetro). Levando-se em considerao, todavia, o elevado nmero de conexes
existentes e a possvel ocorrncia de deposio de materiais slidos, deve-se
adotar um coeficiente de reforo igual a 2. Com relao s perdas localizadas
existentes entre o ponto de sangria na rede e o ponto de alimentao do ramal,
consideram-se que sejam cobertas por um valor igual a 1 m.c.a..
Para o dimensionamento desses ramais condominiais de abastecimento
dgua, por outro lado, considera-se a presso mnima de 10 m.c.a. na casa
mais desfavorvel do condomnio, e procura-se consumir ao mximo a
presso disponvel at este limite mnimo, o que tambm se constitui em fator
de restrio de perdas. No mais, seu dimensionamento considera:
t ONFSP de lotes a atender;
t ONFSPEFFDPOPNJBTBBUFOEFS
t DPOTVNPper capita;
t DPUBQJF[PNUSJDBOPQPOUPEFTBOHSJB
t DPUBEFUFSreno no ponto mais desfavorvel (extremidade do trecho).
277

O Sistema Condominial na distribuio de gua

Com estes dados, ento, so emitidas as ordens de servio (OS`s), as quais


so subdivididas em quatro campos e tm, no seu rodap, as datas de emisso
e aprovao e o visto dos respectivos responsveis, conforme o seguinte:
t $BNQP POEFJOEJDBEBBMPDBMJ[BPEPSBNBM EJTUSJUP CBJSSP 
rua, lado, incio e fim do trecho);
t $BNQPOFTUFDBNQPTPBQSFTFOUBEBTBTDBSBDUFSTUJDBTEPUSFDIP 
tais como material da tubulao a ser utilizado, dimetro e extenso;
t $BNQPSFTFSWBEPQBSBBBQSFTFOUBPEPDSPRVJEPUSFDIPBTFS
implantado, onde se pode observar a testada dos lotes, o ponto de
alimentao de cada lote, os dimetros e as extenses de cada trecho
do ramal;
t $BNQPEFTUJOBEPBQSFTFOUBPEBSFMBPEPTNBUFSJBJTBTFSFN
empregados na implantao do ramal.

Recomendaes para a execuo dos ramais


condominiais
Tanto quanto nos sistemas de esgotos, o usual e sempre que possvel
mais recomendvel a implantao dos ramais condominiais de
gua pelo prestador do servio, realizada diretamente ou por meio de
uma construtora. Todavia, no se deve descartar a sua construo pelos
usurios, organizadamente, em seus condomnios, se isto vier a conciliar
escassez de recursos financeiros do prestador do servio com a necessidade
dos usurios e a suas correspondentes vontade e disposio.
No primeiro caso, os usurios pagam as taxas pelo servio separadamente
ou includas na tarifa mensal a menos que sejam elas assumidas pelo
prestador do servio ou pelo poder concedente e, ao final, conectam suas
instalaes prediais ao ramal condominial e passam a usar o servio, aps
cadastramento. Essa tem sido a modalidade nica de implantao de
sistemas de distribuio de gua adotada pelos prestadores de servio e,
sem dvida, um padro que deve ser perseguido sempre que possvel.
Muitas vezes, a escassez de recursos para investimentos severa. Nesses
casos, preciso considerar a possibilidade de parcerias com a comunidade
em torno da implantao do ramal condominial, o que pode reduzir bastante
os investimentos institucionais necessrios, tornando possvel, por exemplo,
a troca de ramais por maiores extenses de rede que representem maior
atendimento da populao. Esse foi o caso, precisamente, da cidade de
Parauapebas, que ser visto mais adiante, em outro captulo deste Caderno.
Esta hiptese no exclui de todo o prestador de servio, j que permanecer
ele com todas aquelas responsabilidades que no so cabveis para os
usurios: o projeto, a assistncia tcnica permanente e at mesmo a execuo
de algumas tarefas especializadas 91.
Em apoio a essas duas hipteses que colocam o custo do ramal condominial
no usurio (quota parte de cada condmino sobre o custo total), tm-se
duas razes muito justas: primeiro que esta quota correspondente ao

278

91

No abastecimento dgua de Parauapebas,


Par, onde os ramais condominiais foram
assumidos pela comunidade, os projetos
e o assentamento propriamente dito
das canalizaes permaneceram sob a
responsabilidade do prestador do servio,
justamente por lhes serem devidos. A
aquisio dos materiais, as escavaes e
reaterros, e as quebras e reposies de
SDYLPHQWRFDUDPFRPRVFRQGRPtQLRV
DLQGDDVVLPVREULJRURVDVFDOL]DomR
institucional).

Sistema Condominial

que seria o ramal predial no sistema convencional, tradicionalmente uma


responsabilidade de cada casa; e depois o fato de que a tal quota ter sempre
um custo muito inferior ao daquele ramal pelas mesmas razes do que ocorre
com o condominial de esgotos, mesmo que a extenso seja maior, as menores
escavaes e quebras garantem o menor custo.
Quanto execuo propriamente dita destas unidades, ela s depende de
sua ordem de servio e deve ser realizada de maneira similar a qualquer
obra hidrulica de pequenos dimetros e prximas das residncias.
normalmente uma obra muito simples e de rpida execuo, com a sua
implantao podendo ser feita pelo prestador de servios, diretamente ou por
meio de uma empresa contratada pelas prefeituras, onde for o caso, ou at
mesmo pelo condomnio, como j referido, mediante orientao e assistncia
tcnica adequadas.
Antes ou durante a construo, so pertinentes as seguintes recomendaes
de carter geral:
t BOUFTEPBTTFOUBNFOUP PTUVCPTEFWFNTFSJOTQFDJPOBEPT 
eliminando-se terra e entulhos do seu interior;
t PGVOEPEBWBMBEFWFTFSSFHVMBSJ[BEPFBQSFTFOUBSDPNQBDUBP
adequada em toda sua extenso; alm disso, precisa estar livre
de materiais ou salincias que prejudiquem o assentamento e a
integridade da tubulao.
Segue-se o Cadastro do Ramal Condominial, que ser facilitado com a
utilizao da ordem se servio como sua base, destacando-se, contudo, a
absoluta importncia da incluso, neste cadastro, de todas as modificaes
introduzidas durante a sua instalao. Alm da sua importncia para a
manuteno corretiva, ele tambm ir servir aos reprojetamentos que
se fizerem necessrios se o condomnio vier a alterar a sua composio;
por exemplo, com o aparecimento de edifcios de apartamentos ou de
estabelecimentos de maior porte onde antes estavam existindo residncias
unifamiliares. As citadas alteraes, que sero sempre substituio de
dimetros em um trecho do ramal, correro por conta do usurio ou usurios
que as determinarem.

Recomendaes para a operao dos ramais


condominiais
Quando da sua colocao em carga, o Ramal Condominial dever ser
acompanhado mais de perto, bem como, desejavelmente, as instalaes
prediais dos seus condminos devem ser observadas, para correes de
vazamentos ou procedimentos incorretos tanto quanto deveria ocorrer,
tambm, nos sistemas mais tradicionais. Seria uma espcie de vistoria,
segundo uma perspectiva de educao para o uso, j que neste momento
podem ter origem problemas que tendam a eternizar-se, complicando a vida
do sistema.

279

O Sistema Condominial na distribuio de gua

Segue-se, agora em carter permanente pelo prestador do servio, a


Manuteno Corretiva, para a qual se pressupe que o operador tenha
se preparado devidamente, lembrando que os ramais condominiais so
unidades muito prximas dos usurios, e que por isso mesmo demandam
urgncia no seu atendimento. Essa manuteno corretiva aquela que
decorre de um chamado da populao quando da ocorrncia de acidentes
com os ramais condominiais, usualmente quebras ou vazamentos.
Tais ocorrncias devem levar a uma adequada Acumulao de Informaes,
que pode orientar as suas estatsticas e, conseqentemente, aperfeioar
o processo operacional. Caso esse acervo no seja formado, ou esteja em
regime precrio, recomendvel a montagem de um sistema voltado apenas
para os ramais condominiais, dado que so essas unidades as mais sensveis
do sistema e que, portanto, demandam um processo de ajustamentos
sucessivos. A sua operao haver de indicar, a par de alteraes de
procedimentos, a necessidade de pesquisas especficas que ajudem a melhor
apreciar os eventos crticos e a estudar as solues mais adequadas para sua
correo.
Nas comunidades sub urbanizadas, repete-se aqui, a gesto do servio
deveria merecer Pesquisas Especficas e Estudos Correlatos, que
teriam a finalidade de conhecer o melhor possvel esta realidade ainda
hoje no resolvida quanto a uma eficiente operao dos servios de
saneamento (desde o suprimento e at a arrecadao). Com base nisso, ser
possvel estudar, propor e implantar procedimentos que a faam evoluir
favoravelmente. As questes mais presentes neste rol - e ainda no estudadas!
- so as que dizem respeito ao papel da comunidade de usurios no uso
do sistema e no cumprimento de suas obrigaes pactuadas, bem como a
identificao das causas mais freqentes de acidentes e defeitos de projeto ou
de construo. Os resultados de tais estudos podero oferecer trs diferentes
respostas ao servio: alteraes de procedimentos ou de regras, realizao de
campanhas educativas com objetivos especficos, ou simplesmente nada a se
fazer alm de acumular as informaes decorrentes.
Convm observar que aquilo que demandaria efetivamente uma pesquisa
nos termos acima frisados, e que no teve esta pesquisa realizada,
continuar sendo um estorvo para a operao, com certeza, representando
custos, agravamentos e descrditos crescentes; alm de estar enraizando e
aculturando prticas certamente inconvenientes.

280

Sistema Condominial

21. O CONDOMINIAL NAS FAVELAS DO


RIO DE JANEIRO
21.1 CONSIDERAES PRELIMINARES
A primeira aplicao do modelo condominial a sistemas de distribuio de
gua ocorreu na dcada de 90, com a Companhia de guas e Esgotos do
Estado CEDAE, do Rio de Janeiro, na favela da Rocinha, 85 mil habitantes,
e outras cinco comunidades do mesmo gnero 92. Justamente onde as
condies eram as mais difceis - urbansticas, topogrficas e principalmente
poltico-sociais para a implantao e, sobretudo, a operao, de servios
dessa natureza. Esse programa-piloto cresceu e se desenvolveu at atender,
atualmente, 480 mil pessoas em 30 desses assentamentos, um dos quais, com
75 mil habitantes, o Morro do Alemo.
Focalizando as favelas situadas em morro - quase a totalidade, alis,
do universo acima citado este captulo dedicado descrio desse
empreendimento, particularmente, da sua etapa inicial, onde foram aplicados
os princpios, idias e prticas que conduziram o processo neste novo campo
de atividade. Nesse intento, no se realizou a abordagem sobre nenhum
assentamento em particular salvo eventuais citaes - dado que o interesse
maior pela sua forma, rigorosamente comum a todos eles, e nos seus dois
aspectos fundamentais a engenharia e o processo social.
O contedo deixa de lado dimensionamentos e detalhes de engenharia, j que
nada nessa matria deixou de ser o trivial para o conjunto dos engenheiros
do ramo, para dedicar-se, afinal, ao que no o usual, em absoluto,
engenharia sanitria. Nesse sentido, alis, no h a menor dvida de que
essa engenharia aqui aplicada jamais alcanaria seus objetivos sem o lastro
poltico e social que lhe deve dar sustentao. Sem dvida, quanto mais firme
este apoio, melhores e maiores os resultados alcanados.

92

Esse programa tambm abrangeu os


sistemas de esgotamento sanitrio das
comunidades, seguindo o mesmo modelo
condominial.

Inicia-se o captulo com um esforo de sntese que situe o leitor na


problemtica das favelas, no contexto que originou o programa, suas
dificuldades e requisitos. Aos que no so muito pacientes com questes de
fora da engenharia, o apelo para que se esforcem para alguma concesso
sua vontade, como condio fundamental melhor compreenso da
problemtica e da soluo adotada e que procurou lhe ser a mais adequada.
Segue-se com a descrio e algumas consideraes sobre o que, o porqu
e o como, tudo feito para a poca da origem do programa, quando o autor
era partcipe do mesmo, at discorrer-se sobre a sua situao atual, que
foi feito com o apoio em entrevistas a tcnicos da empresa, operadores de
alguns sistemas e at mesmo uma liderana comunitria. Finalmente, so
feitas algumas consideraes sobre os trabalhos que possam gerar reflexes,
desdobramentos e sugestes por parte de interessados, para a extenso dos
sistemas condominiais de distribuio de gua no prprio Rio de Janeiro ou
em qualquer parte do mundo. Com certeza, o que se preste nas condies
aqui ocorrentes, haver de se prestar em qualquer outra circunstncia.

281

O Sistema Condominial na distribuio de gua

Esto aqui inseridas algumas importantes atividades, caractersticas


da aplicao do modelo condominial ao ProSanear-RJ (nome dado
ao programa de saneamento de favelas do Rio de Janeiro), e de cujo
desempenho depende em certa escala o xito do prprio programa. Para
o que aqui interessa, essas atividades podem ser agrupadas segundo
trs categorias especficas, a saber: aquela categoria que tem a ver mais
objetivamente com o comportamento esperado da comunidade na sua
relao com o servio, o que, certamente, uma mudana de ordem
cultural e depende de um processo de implementao, de alimentao,
progressivo e gradual; uma outra que est mais diretamente relacionada
interface socioinstitucional, mudana necessria na relao entre
concessionria e populao, e que tem por isso mesmo um cunho
eminentemente poltico; e por ltimo, a questo da tecnologia aplicada
aos sistemas fsicos, parte fundamental da adequao das solues s
peculiaridades locais.

21.2 O CONTEXTO DO PROGRAMA


As origens e o rumo seguido
No incio dos anos 90, o governo do Estado do Rio de Janeiro, atravs da sua
Companhia de guas e Esgotos (CEDAE), negociava com o Banco Mundial
(BIRD) e a Caixa Econmica Federal (CEF), a montagem de um programa
de saneamento para as favelas da Rocinha, Mangueira, Borel, Juramento
e Campinho, na Capital, e do Morro do Estado, em Niteri. Chamavase ProSanear-RJ e alcanaria um montante de 37 milhes de dlares,
financiados por emprstimos equivalentes a 50% (BIRD) e 25% (CEF), com
contrapartida dos restantes 25% pelo governo e exigia como requisito bsico
a apresentao, pela CEDAE, de um projeto adequado s condies desses
assentamentos especiais.
Para atendimento deste requisito, a CEDAE elaborou duas ou trs propostas
para o saneamento das favelas, as quais no contaram com a aprovao
dos bancos dado que se baseavam em tecnologias tradicionais e que foram
consideradas inadequadas por essas entidades. Em fevereiro de 1992, uma
misso do BIRD chefiada pelo engenheiro Abel Mejia, concedeu um ltimo
prazo, de apenas trinta dias, para o cumprimento desse requisito. Por ter ficado
implcito nessa ltima tentativa do Banco que os trabalhos explorassem algo do
gnero do modelo condominial, foi o autor destes Cadernos instado a enfrentar
o tal desafio, o que foi aceito por enxergar, na proposta inicial e no trabalho que
o seguiria, algo de absolutamente extraordinrio, inusitado e, principalmente,
uma excelente oportunidade para mais um teste do modelo condominial
tambm no abastecimento de gua.
Este desafio foi cumprido conforme transcrio em caixa de texto adiante
inserida, tendo sido aprovada a sua proposio final, calcada no modelo
condominial para o abastecimento de gua e o esgotamento sanitrio para
o conjunto de favelas. O documento realava, ainda, o compromisso com
uma interveno inovadora da CEDAE no espao das favelas, tratando
de introduzir nesse mundo desconhecido procedimentos tecnolgicos,
282

Sistema Condominial

participativos e de gesto, capazes de reverter a situao existente e garantir


a continuidade dos seus efeitos.
Alm da aprovao, o BIRD ainda recomendou que a Condominium,
detentora do know how naquele mtodo, deveria ser posicionada no
programa como sua gerenciadora, limitada sua ao, todavia, orientao
metodolgica, ao treinamento das equipes e ao controle de qualidade das
intervenes naquilo especificamente relacionado ao mtodo condominial.
Definia-se, alm disso, na mesma ocasio, que outras empresas de consultoria
seriam selecionadas e contratadas para a elaborao dos projetos executivos
dos sistemas concebidos, bem como para as tarefas relativas mobilizao
social. Assim, este autor teve a oportunidade de participar dos trabalhos
como seu orientador, no perodo de 1993 a 1996, atravs daquela empresa,
com o que se ampliou o campo de aplicao do sistema condominial com
a distribuio de gua, numa condio to complicada quanto seria, em
Salvador, o sistema de esgotamento sanitrio.
Em todo este perodo, a funo bsica foi a de procurar transmitir ao referido
Programa a filosofia participativa do sistema condominial, bem como
implementar suas aes atravs do mtodo desse mesmo sistema, agora
tambm adequando a tecnologia s novas circunstncias, caractersticas das
favelas do Rio de Janeiro. Nesse sentido, ora se realizou diretamente as tarefas
especficas do mtodo quando se apresentavam elas pela primeira vez; ora
se esclareceram dvidas das equipes executoras contratadas a terceiros ou
participou-se de seus treinamentos; ora respondeu-se s consultas sobre a
concepo e detalhes de projetos; e ora, enfim, assessoraram-se os dirigentes
na mediao de entendimentos e questes que se mostraram crticas.

O que so as favelas do Rio de Janeiro


No Caderno 1, foram largamente descritos os assentamentos sub urbanizados
e favelas do Brasil, em sua gnese, justamente por se admitir que os servios
de saneamento bsico haveriam de adequar-se s suas especificidades,
muito distantes daquelas que produziram e desenvolveram os mtodos mais
tradicionais para os sistemas de saneamento. No mesmo caderno, e nos dois
que o seguiram, foi evidenciado o alcance desse objetivo com os sistemas
condominiais, os quais se demonstraram capazes de atingir as cidades como
um todo, em toda a sua diversidade urbana e social.
Aquela descrio mais genrica do Caderno 1, conquanto contemple as
favelas do Rio de Janeiro, que so agora abordadas, precisa, contudo, de
uma complementao que leve em conta a forma mais aguda com que
algumas caractersticas se apresentam, ampliando mais as dificuldades para
os servios urbanos, na sua topografia, na sua urbanizao e, sobretudo, na
sua problemtica poltico-social. A topografia, por exemplo, se excede nas
declividades, na altitude e na ocorrncia de barrancos, que so verdadeiros
abismos, aspectos que somente so atenuados em face da ocupao urbana,
pela consistncia predominantemente rochosa de sua geologia, que resiste
um pouco mais s eroses nesse tipo de formao. A Rocinha, por exemplo, a
mais conhecida desses assentamentos, tem nada menos do que 270 metros de
variao na sua altitude numa rea que no passa dos 250 a 300 hectares.
283

O Sistema Condominial na distribuio de gua

A urbanizao, por seu turno, em que pesem as obras virias mais recentes
que penetram uma grande parte da rea, mantm, todavia, para a maioria de
seus habitantes, o aperto de becos e escadarias como nica forma de acesso. E
o que mais chama a ateno, tanto mais quanto mais valioso o cho (pela sua
proximidade de bairros de elevada demanda), o extraordinrio processo de
transformao do que eram barracos em verdadeiros edifcios, construdos
sob formas que desafiam a engenharia estrutural, e que, curiosamente, esto
sempre a subir atravs de prtica estabelecida: se vende a ltima laje, a de cima,
como se fora um lote de terreno... O adensamento, dessa forma, crescente
e sem qualquer limite, no apenas pelos acrscimos na vertical, mas tambm
pelas expanses, que se assemelham a quintais 93.
Mas no campo poltico-social que residem as condies mais agudas,
conseqncias de fatores que se aliam na formao do mundo da favela, por
oposio cidade urbanizada, ou ao asfalto, conforme expresso corriqueira.
Em primeiro lugar, uma significativa ausncia do sistema institucional (quase
que representado, apenas, por obras espordicas e que no tm a devida
manuteno) abre espao para o crime organizado e para o narcotrfico,
estabelecendo-se uma malha de relaes marginais que termina por submeter
a populao a uma incrvel forma de poder, onde fazem parte do quotidiano os
tiroteios entre falanges ou delas com a polcia; as balas perdidas como coisas
corriqueiras matando crianas e trabalhadores nas ruas e nas casas; o trfico
de drogas em alta escala; mais recentemente as milcias, numa falsa defesa da
comunidade; enfim, a ausncia dos mais simples patamares da cidadania.
Estava claro, portanto, absolutamente claro, que a questo colocada sobre o
saneamento das favelas no haveria de se resumir a uma obra de engenharia,
mas, muito ao contrrio, se tratava de uma construo tambm poltica, de
fato, e que alm de tudo fosse capaz de garantir, como em todo o mundo, a
eternidade dos servios.
284

Figura 92
Os barrancos e a falta de espaos, duas
caractersticas marcantes das favelas do Rio
de Janeiro

93

Dentre muitos fatos marcantes da vida


das favelas observados no dia-a-dia dos
trabalhos que se seguiriam, uma frase de
um morador, relativa falta de espaos, foi
chocante: pior do que falta dgua, a falta
de ar - a gente fecha a janela e vai dormir,
quando acorda, construram uma parede e
no se pode mais abrir a janela.

Sistema Condominial

No relatrio tcnico da CEDAE


com a proposta aprovada pelos
QDQFLDGRUHVID]LDVHUHIHUrQFLD
mobilizao de equipes de trs
diferentes origens: a) consultoria de
Jos Carlos Melo e sua equipe de
cinco tcnicos, a quem couberam
as tarefas de anlise e diagnstico,
concepo e detalhamento das
solues, elaborao do relatrio e
coordenao de todas as atividades;
b) a empresa Ambiental, que
disponibilizou dezenove tcnicos de
seus quadros, com a incumbncia de
levantar e processar as informaes,
visitar as favelas, apoiar tcnica e
administrativamente a execuo de
todas as tarefas e, especialmente,
elaborar o projeto de limpeza
urbana; e c) o programa PROFACE,
da CEDAE, que aportou treze
tcnicos, com a responsabilidade de
administrar as equipes e fornecer
apoio logstico aos trabalhos. O
GHVDRDVVXPLGRIRLGHWDOGLPHQVmR
que as tarefas somente puderam
ser concludas merc do esforo
intensivo das equipes, em regime
concentrado de produo que no
poupou ao trabalho noites, domingos
e feriados. Tudo isso se passou
no mbito da vice-presidncia da
CEDAE, tendo frente o engenheiro
Mrcio Paes Leme, um entusiasta do
Programa.

Como eram os sistemas de abastecimento de gua


Naqueles anos de sua implantao, o ProSanear-RJ trazia consigo todas
as dificuldades e a complexidade presentes no seu universo de ao - as
favelas do Estado, particularmente, as maiores, de topografia mais acentuada
e as mais densas. Os reflexos deste quadro no saneamento bsico e,
particularmente, no abastecimento dgua, eram vivamente demonstrados
atravs de fatos to concretos quanto o mais que precrio atendimento
dessas comunidades (em presena de reas vizinhas historicamente bem
abastecidas) ou do quase sistemtico insucesso das obras do gnero at ento
realizadas nesses espaos urbanos.
Uma forma menos visvel disso, que requereria uma apreciao mais
cuidadosa, era aquela que aparecia como um ciclo vicioso: a gua
bombeada para a favela, sempre menos do que a minimamente necessria; a
conseqente falta dgua l em cima determinando uma forte disputa que
destri as instalaes e favorece os mais poderosos, tudo isso se passando
na inteira ausncia do sistema institucional; as contas quase nunca so
emitidas e jamais so cobradas, desestimulando, dessa forma, o controle
social que adviria do direito de quem paga, sem o qual se justifica o menor
bombeamento, a no-operao, a frgil cobrana, enfim, a realimentao
daquele ciclo. Num quadro como esse, marcado pela ausncia do sistema
institucional, sobrevem o poder local, hierarquizando, na prtica, a forma
do suprimento: ainda a lata dgua na cabea dos mais fracos, o suprimento
domiciliar racionado para os protegidos e o abastecimento regular e contnuo
para quem usa sua fora tambm para bombear gua a partir das instalaes
oficiais. As fotos da figura 93 so exemplos do que acontecia nas favelas
cariocas antes da interveno do ProSanear-RJ.
Com a falta ou precariedade do servio de esgotamento sanitrio e da
drenagem, a topografia local invertia, quase, a problemtica, na medida em
que a fora da gravidade ficando do lado das favelas promovia a concentrao
dos esgotos no asfalto seus canais ou regatos e at nas praias de banho.
Por ocasio das enxurradas, um problema ainda maior: a lavagem dos
morros, literalmente, do seu lixo acumulado e seus esgotos empoados,
descendo vertiginosamente, e depositando-se nas ruas e praas das reas
circunvizinhas. Uma calamidade, portanto, para todos, todo o tempo.
Em tais circunstncias, reconhecia-se, de logo, que o ProSanear-RJ haveria
de trazer consigo exigncias absolutamente fundamentais para o desmonte
dessa perversa situao, a saber: a firmeza do propsito institucional de
bem garantir a efetividade do Programa, a garantia da utilizao de uma
tecnologia adequada s especialssimas condies locais, e, sem dvida,
a participao comunitria suficiente para a adoo de um novo papel
pelo usurio (mais ativo, mais responsvel e mais exigente tambm). No rol
dos propsitos no mbito institucional, o mais importante, com certeza, era
o relativo garantia do fornecimento de gua s favelas, numa quantidade
compatvel com cada necessidade - conforme os comentrios da caixa de
texto destacada adiante. Tratava-se, assim, da busca de uma nova relao
sobre os servios, parte, inclusive, de uma estratgia mais geral de ocupao
institucional dos morros do Rio de Janeiro.
285

O Sistema Condominial na distribuio de gua

Ainda com relao aos propsitos institucionais, eles no eram to exigentes


em face dos objetivos de uma empresa de saneamento, mas significariam
uma extraordinria mudana no seu curso de ao nesse universo das favelas.
Deveriam comportar os seguintes novos compromissos:
t execuo primorosa de projetos e obras, de sorte que deste ponto de
vista tcnico, ou da engenharia, no sobreviesse qualquer dificuldade
para o j complicado universo;
t alimentao dos sistemas de abastecimento de gua de forma
certa e regular, mesmo que em alguns casos no fosse possvel
o fornecimento no justo valor da demanda, obrigando-se o
estabelecimento de rodzios no suprimento, porm numa forma
sempre negociada com a populao;
t operao e manuteno dos servios, na medida das suas
necessidades, e certamente numa forma descentralizada que desse
continuidade aos trabalhos comunitrios realizados durante a fase
inicial do processo; uma ateno particular haveria de ser dada
ao sistema comercial, faturando corretamente as contas mensais e
cuidando da efetividade de sua arrecadao; sob este ltimo aspecto,
arrecadao, mais do que contribuio aos ativos da empresa, era o
resgate dos direitos dos usurios com o pagamento de suas contas
(servio que presta, afinal de contas, servio pago!).
Os aspectos tecnolgicos que necessitariam de maior ateno eram
os que diziam respeito uniformizao de presses, em situaes to
complicadas de topografia, alm de uma possvel condio de delimitao
de responsabilidades recprocas entre o prestador do servio e os usurios.
Essas questes que viriam a ser enfrentadas pela criao de zonas de presso
perfeitamente isoladas e, dentro delas, pelos condomnios de usurios,
conforme se ver adiante. Finalmente, a participao comunitria no
processo, vista como forma irrecusvel de oferecer-se a possibilidade
de efetivao do novo pacto sobre os servios e, principalmente, levar a
populao usuria s suas inequvocas responsabilidades.

Figura 93
A hierarquia do poder determinando a forma
do abastecimento de gua:
da lata na cabea, s instalaes precrias e
aos complexos bombeamentos

286

Sistema Condominial

Distribuio de gua nos Morros do Rio de Janeiro


As fotos areas aqui dispostas so da Rocinha e do Morro
GR$OHPmRQR5LRGH-DQHLUR3DUHFHPVXFLHQWHVSDUD
ilustrar, em planta, a complexidade dessas reas em face
de um sistema de gua que precise chegar porta de cada
uma de suas casas. Quando, alm disso, se considera que
DVVXDVWRSRJUDDVFRPSRUWDPGHVQtYHLVLQWHUQRVGHPDLV
de 200 metros, amplia-se ainda mais aquela sensao de
GLFXOGDGHVGLDQWHGRREMHWLYRHPYLVWDeDtHQWmRTXHD
concepo adotada para os sistemas de abastecimento em
iUHDVGHVVDQDWXUH]DSDUHFHSHUIHLWDPHQWHMXVWLFDGDD
qual se procurou ilustrar nos dois desenhos da parte inferior
GDJXUD1RSULPHLURDWDOFRQFHSomRJHUDOGHXPDiUHD
FWtFLDPDVGHVVDQDWXUH]DFRPGHVQtYHOSRUH[HPSOR
GHPHWURVMXVWLFDQGRGRLVUHVHUYDWyULRVH]RQDV
de presso, cada uma delas com dois micro sistemas. Na
segunda, apresenta-se em detalhe o quadrado indicado no
desenho anterior, onde esto simbolizados seus condomnios
e os distribuidores que os alimentariam.

287

O Sistema Condominial na distribuio de gua

21.3 O CONDOMINIAL NA DISTRIBUIO DE


GUA NOS MORROS
A sua perfeita entrada...
Nas circunstncias descritas anteriormente, as linhas bsicas do sistema
condominial pareceram de imediato inteiramente adequadas para o
delineamento dos sistemas de distribuio de gua das favelas do Rio
de Janeiro, e at mesmo ganhando, nessa adequao, s aplicaes
no esgotamento sanitrio. Ganhando menos pela reduo de custos
proporcionada, alis, bastante elevada, e ganhando mais, muito mais, pelos
controles oferecidos futura operao dos servios.
No seu original conceito de agrupamento de vizinhana, os condomnios,
ofereciam-se como espaos interessantes e, talvez insubstituveis, nas duas
vertentes requeridas:
t BEForganizao da comunidade para a participao no processo
(reunio de grupos de tamanho compatvel com as questes a serem
discutidas e decididas);
t BEFsubdiviso dos complexos universos em pequenos conjuntos
de vizinhos, para que se constitussem unidades de atendimento,
atravs de seus ramais condominiais.

Figura 94
A estrutura segundo os micro sistemas por
faixas de presso, conforme se representava
poca
Fonte: Condominium/CEDAE

Neste caso, os micro sistemas, entendidos como conjuntos de


condomnios com uma nica entrada de gua, constituindo uma
adequada zona de presses uniformes, garantiriam o escalonamento das
presses atravs de reservatrios ou dispositivos especiais de regulao
(caixas de seccionamento da coluna ou vlvulas redutoras), aliados
ainda a registros de parada e macromedidores. O sistema-favela, ou o
ProSanear-RJ como j designado, reuniria as regras e procedimentos que
valeriam para o inteiro universo desses assentamentos especiais.

A engenharia dos sistemas


A concepo dos sistemas fsicos em cada localidade teve por base a
observao de sua topografia e, em conseqncia, o esforo de delimitao
de suas futuras zonas de presso, em intervalos de 30 metros de altura, no
mximo. Essa questo era vista e reconhecida por todos como essencial ao
bom desempenho dos servios, numa significativa contribuio ao controle
das perdas, historicamente, gigantescas. Numa primeira aproximao, estas
zonas eram verdadeiras fatias do morro, sendo estabelecidas apenas pelas
curvas de nvel da planta disponvel, para em seguida reacomodarem-se,
contemplando em seu interior um nmero inteiro de condomnios. Esta
ltima operao impunha pequenos afastamentos naquela marca inicial dos
30 metros.
O passo seguinte decorria da informao sobre a posio topogrfica da
chegada da gua que abasteceria a rea, com base no que se buscava
racionalizar a localizao do(s) reservatrio(s) e da(s) subadutora(s) a
288

Os principais responsveis
pelos trabalhos
Na elaborao da proposta que
veio a ser aprovada pelo Banco
Mundial, naquele curto intervalo de
30 dias, foram membros importantes
da equipe os engenheiros Edrize
Ayres, Natanael Ramalho e Herslia
Coelho de Medeiros e o economista
Pedro Terrer; na implementao
dos trabalhos pela Condominium,
os principais colaboradores foram
os engenheiros Helton Alves Lima,
Maria Clara Rodrigues e Srgio
Pinheiro.

Sistema Condominial

Figura 95
Flagrante da planta da Rocinha que constou da concepo inicial do seu projeto
Fonte: Condominium/CEDAE

289

O Sistema Condominial na distribuio de gua

ser(em) disposta(s) num ou mais dorso(s) do morro, em condies de suprir


cada zona de presso, formadora de um micro sistema.
Essa chegada ainda definiria a melhor condio para as instalaes de
recalque, no que a otimizao dos custos poderia indicar uma ou mais dessas
unidades, cada uma delas direcionada para o que constituiria um macro
sistema (conjuntos de micro sistemas e de zonas de presso). Completava-se
o sistema pblico de distribuio com as derivaes, a partir das subadutoras,
que irrigavam cada um dos micro sistemas, tocando em pelo menos um
ponto de cada um de seus condomnios. A semelhana das formaes
topogrficas dos vrios assentamentos em elevaes do terreno estendeu esta
forma de concepo a todo o universo com tais caractersticas.
A ltima instncia da distribuio a que se realiza dentro de cada
condomnio, atravs dos seus ramais condominiais, situados na posio
que, no contexto deste tipo de assentamento, melhor individualize as ligaes
prediais (o equivalente, numa urbanizao regular, ao que seriam os ramais
invariavelmente situados nos passeios, conforme explicaes nos captulos
anteriores).
As seguintes recomendaes especficas contemplaram esta concepo de
sistema distribuidor:
t QSFGFSFODJBMNFOUF VNSFTFSWBUSJPQBSBDBEB[POBEFQSFTTP NBT
no sendo isto econmico, utilizao de vlvulas reguladoras de
presso;
t BDPMPDBPEFTTBTWMWVMBTTFSJBNPOUBOUFJNFEJBUPEFDBEB
subadutora;
t UBJTEFSJWBFT QPSTFVUVSOP EFWFSJBNFTUBSTJUVBEBTOBQPTJPRVF
permitisse a alimentao de suas respectivas reas abastecveis, pelo
seu ponto mais elevado, como forma de garantir o suprimento de
suas partes altas e facilitar a limpeza dos ramais, utilizando-se atravs
das torneiras mais baixas;
t EJTQPTJPEFSFHJTUSPEFQBSBEBFNDBEBEFSJWBP DPNPGPSNB
de facilitar a manuteno do micro sistema e, desejavelmente, em
srie, um equipamento de macromedio, para controle dos volumes
fornecidos ao setor;
t QPSTJNJMBSJEBEF NFTNPTFRVJQBNFOUPT FNNFOPSFTEJNFOTFT 
certamente, na entrada de cada condomnio.

290

Sistema Condominial

Os componentes eminentemente condominiais


Esses componentes so aqueles que afetaro diretamente a populao por
estarem prximos ou dentro das residncias e sua consecuo depender,
diretamente, da participao e da deciso dos condomnios. A despeito de
constiturem um todo integrado, para efeito de apresentao estaro aqui
desdobrados nos quatro itens seguintes: o estabelecimento das regras bsicas,
o discurso do programa e a sua legitimao poltica, o processo condominial
propriamente dito e os ramais condominiais.

As regras bsicas
Dois fatores foram determinantes no estabelecimento das regras que
regulariam o sistema de abastecimento dgua do ProSanear RJ: o
sentimento de dvida do sistema institucional para com o universo das
favelas, e da a deciso de nada se cobrar de seus usurios por conta dos
investimentos realizados (ramais condominiais ou ligaes prediais); e a forte
presena do mesmo ciclo vicioso, cujo desmonte (ou pelo menos um grande
abalo) tornara-se um requisito para o xito do empreendimento. Assim,
valendo tambm para o sistema de esgotamento sanitrio, foram essas as
regras estabelecidas:
t os trabalhos de campo teriam incio com a concordncia das
lideranas locais na abertura de todos os espaos necessrios
mobilizao social e aos levantamentos de campo para todo
o projeto e, particularmente, para os ramais condominiais; isto
implicava, conseqentemente, na entrada de tcnicos na intimidade
da favela, inclusive suas casas, com a segurana pessoal garantida
pelos moradores sem qualquer remunerao; para as condies
reinantes nesse universo, este item inicial das regras que vigiria
durante todo o programa - j representava um extraordinrio avano;
t a CEDAE seria responsvel pela execuo de todas as obras, mas
na operao se restringiria s chamadas obras pblicas, excluindo
os ramais condominiais; a comunidade, organizada em seus
condomnios, garantiria a integridade das tubulaes, realizaria
a manuteno dos ramais 94 e pagaria as contas mensais, conforme
o sistema tarifrio vigente em todo o Estado (idia de no distinguir,
sob esse aspecto, os usurios do programa);
94

A atribuio de manuteno dos ramais


de gua e de esgotos pela populao
advinha de sentimento bastante sensato
QRVHQWLGRGHTXHD&('$(GLFLOPHQWH
arcaria com uma tal responsabilidade, e que,
portanto, seria esta uma deciso pragmtica
a favor do empreendimento. A consultoria
desaconselhou a incluso dos ramais de gua
nesta condio (pelos seus maiores requisitos
e pela desejada presena dos hidrmetros,
necessariamente, uma responsabilidade
exclusiva do prestador do servio).

t DPNVOJEBEF TFSJBBTTFHVSBEPPFYFSDDJPEPcontrole sobre os


volumes de gua fornecidos a cada localidade, com base nos acertos
em cada caso realizados, tarefa de importncia fundamental para o
sucesso do empreendimento.

291

O Sistema Condominial na distribuio de gua

O discurso e sua legitimao poltica


O propsito de mudar a histrica relao do sistema institucional com as
favelas cariocas, como condio, inclusive, da efetividade do ProSanear-RJ
e, tambm de contribuir-se para a verdadeira insero dessas comunidades
na vida da cidade, estaria presente em todas as fases do processo, numa
lgica de coerncia que pudesse ser percebida pelos participantes.
Da a importncia da pactuao com as lideranas, voltada para o
estabelecimento, j naquela primeira hora, de uma nova relao 95. No caso,
a adeso inicial sobre as regras gerais do Programa e sua abordagem, e at
mesmo como teste de sua compreenso e primeira adeso, a concordncia
sobre o desenvolvimento dos trabalhos na intimidade da rea e sob
total condio de segurana e respeito recproco, mas garantindo-se um
comportamento dos tcnicos que se assemelhasse discrio caracterstica
das visitas mdicas. Com isto se procurava interromper uma prtica
bastante difundida de utilizao de uma proteo local remunerada
(os chamados guias). Deve-se sublinhar, a este ttulo, o patamar de
intimidade a que precisa chegar o trabalho com a respectiva rea a ser
atendida, para vislumbrar a importncia do pacto inicial (reunies em cada
condomnio, levantamentos de todas as moradias, aes pontuais em todos
os quintais e becos...).
A par da explicao, discusso e conquista de apoio relativamente s
regras do programa, constitua o pano de fundo do discurso as reflexes
sobre o histrico ciclo vicioso da gua nos morros e a importncia
de sua erradicao, contando-se com aquela tarefa comunitria de
acompanhamento dos volumes afluentes de gua.

O processo condominial propriamente dito


Com a viabilizao dessa etapa inicial espcie de passe para a entrada
no morro - tem incio o processo condominial propriamente dito, com a
realizao, em cada condomnio: da mobilizao social buscando a adeso
ao programa e suas regras; e dos levantamentos de campo necessrios aos
projetos dos ramais condominiais (principalmente aos mais exigentes, do
esgotamento sanitrio, j que os de gua, pressurizados, apenas tocariam um
ponto qualquer prximo entrada das casas).
Na mobilizao social, o trabalho realizado concentrou-se na realizao
da reunio de informaes e discusso sobre as questes do programa. As
reunies eram convocadas casa a casa, com a entrega de um convite e um
papo motivador, exigiam a presena de pelo menos metade dos moradores
e expunham os objetivos do programa e suas regras, alm de levar os
presentes a reflexes sobre aquele ciclo vicioso, logo entendido por todos.
Com a concluso das discusses e esclarecimentos, passava-se eleio do
sndico (sempre muito motivadora), entrega do termo de adeso a este
eleito (responsvel pelas assinaturas e esclarecimentos complementares) e,
finalmente, encerrava-se a reunio com os presentes dando um nome ao
condomnio, idia que brotou nesse programa e que seguramente respondia a
um desejo reprimido de se ter um endereo 96.
292

95
Nessa questo, estava implcito que o
sistema local de poder seria sempre ouvido
e participaria, com o seu beneplcito, das
concordncias solicitadas; a experincia que
VHULDYLYHQFLDGDDHVVHVUHVSHLWRFRQUPDULD
esta suposio.
96
'HQWUHDVYiULDVGLFXOGDGHVFDUDFWHUtVWLFDV
dos moradores desses assentamentos, uma,
inesperada, a falta de endereo (e que
sugere falta de cidadania): para a abertura de
credirios no comrcio e para o recebimento
de correspondncias e contas, com estas
~OWLPDVVHQGRGHSRVLWDGDVSHORV&RUUHLRV
em poucos pontos das suas periferias que
concordavam com a tarefa. Era perceptvel,
poca, uma certa humilhao com esta
condio.

Sistema Condominial

Figura 96
As fotos ilustram o bom nvel da mobilizao
social no Rio de Janeiro. A foto da esquerda
foi na comunidade de Ramos, com as suas
lideranas, e foi comandada pelo engenheiro
Mrcio Paes Leme, vice-presidente da
CEDAE; a da direita, na mesma comunidade,
uma reunio condominial quando falava
um morador. Em ambas, a boa freqncia e
a ateno dos presentes

Com relao ao termo de adeso, uma caracterstica dos sistemas


condominiais, ele demorou muito a ser definido no mbito institucional,
por conta de discusses quase interminveis sobre a responsabilidade
pela operao dos ramais condominiais de gua, finalmente colocada
para a populao. O fato, sem dvida, denotava evidente desinteresse
institucional: a bem da verdade, menos, com toda a certeza, por parte
dos dirigentes ento diretamente envolvidos, e mais como decorrncia da
inrcia da mquina propriamente dita e de sua cultura. Aconselhavase, poca, uma sria anlise da questo e uma deciso que garantisse a
continuidade do processo de insero dos servios - seja reabrindo-se em
qualquer aspecto os termos ento ajustados, seja mantendo-os como seria
o desejvel, seja, enfim, at mesmo eliminando-o, caso em que estaria
explicitamente mantido o status quo. Mesmo no perodo que antecedeu a
sua aprovao formal, os termos de adeso jamais deixaram de ser levados
discusso e aprovao da comunidade, em oportunidades nas quais foram
amplamente aceitos.
As figuras 97 e 98 so duas verses do Termo de Adeso, ambas postas na
sua forma original. A primeira a que consta de relatrio da consultora, do
incio do processo, e que expunha, para os decisores e lideranas, as idias
bsicas do projeto. A segunda, por seu turno, um exemplar do prprio
termo de adeso que finalmente veio a ser assumido pela CEDAE, que
manteve, na prtica, o que j vinha sendo admitido, mas destacava algumas
questes (como se estivesse antevendo acontecimentos: distribuio
de contas como tarefa dos condomnios (verdadeira antecipao da
inadimplncia); adoo de um consumo fixo por ligao (pressuposto da
falta de micromedio); destaque ao corte da ligao como medida de
represso inadimplncia (face real impossibilidade de uma tal medida).

293

O Sistema Condominial na distribuio de gua

Os Ramais Condominiais
Nas peculiaridades das favelas verticalizadas e de seus condomnios, os
ramais condominiais vieram a ser instrumentos inovadores de viabilizao
do atendimento individualizado, organizado o suficiente para facilitar ao
mximo o controle operacional que venha a ser estabelecido (pesquisado,
concebido, testado) pelo prestador do servio. Ele constitui a terceira
instncia do sistema de distribuio de gua, seguindo o distribuidor geral
que secciona a coluna de gua para garantir os micro sistemas, com presso
contida dentro de limites e, em seguida, o distribuidor especfico do micro
sistema onde est o seu condomnio.
Os trabalhos relativos aos ramais condominiais, por seu turno, e pelo lado
mais especificamente da engenharia, eram determinados exclusivamente
pelas exigncias da coleta de esgotos no que obedeciam metodologia
semelhante quela aplicada em Salvador, na Bahia j que para o servio de
gua, com as facilidades que lhe oferece a pressurizao, apenas se precisava
assinalar um ponto de entrada mais conveniente para cada casa, prximo
de onde se instalaria a torneira que marca o incio do ramal individual.
Como nos morros, mesmo com aquele seccionamento da coluna de gua
sempre se est dispondo de presses relativamente altas, o dimensionamento
hidrulico desses ramais limitado a simples verificaes quando as presses
se aproximarem de 5 mca, registrando-se no universo aqui considerado
a utilizao quase unnime do dimetro de polegada, em alguns casos
combinado com o de de polegada, sempre em PVC rosquevel. A desejvel
instalao de um registro de parada no incio de cada ramal parece ter
sido obedecida, pelo menos numa maioria de situaes, ao passo que a de
hidrmetros condominiais na mesma posio jamais foi realizada, sem
dvida que com prejuzo para os controles operacionais, mais ainda quando
tambm no foram utilizados os hidrmetros individuais.
A figura 99 ilustra, em desenho da poca, um condomnio e o seu ramal
condominial de gua, chamando-se a ateno para os detalhes de localizao
das torneiras (ponto inicial das ligaes individualizadas) e dos nomes dos
moradores em suas respectivas casas.

O modus faciendi dos trabalhos


A organizao adotada para a implantao do programa, um tanto ou quanto
varivel no curso das aes, foi marcada, contudo, por alguns aspectos
sempre presentes. Dentre eles, um foi bastante favorvel ao alcance dos
objetivos, ao passo que dois outros foram desfavorveis desse ponto de vista.
O favorvel foi o fato de a sua coordenao maior estar sempre
situada muito prxima s maiores instncias do poder institucional,
variando entre a vice-presidncia da CEDAE, sua diretoria de obras ou
a prpria Secretaria de Estado a quem a empresa se subordinava. Assim
haveria mesmo de ser feito, porque se fora outra a sua posio, mais no
interior da chamada mquina com a sua cultura e sua inrcia - muito
possivelmente o programa, pela sua natureza, jamais sairia das intenes,
294

Figura 97
As regras do condomnio segundo sua
primeira verso
Fonte: Condominium/CEDAE

Figura 98
O Termo de Adeso na exata forma em que foi estabelecido pela CEDAE
Fonte: CEDAE

Sistema Condominial

295

O Sistema Condominial na distribuio de gua

como, alis, ocorreu com as propostas recusadas na sua origem e que


tiveram essa autoria. Foi significativo a esse respeito, inclusive, um decreto
governamental concedendo vitalidade especial ao programa.
Por outro lado, os aspectos desfavorveis foram o absoluto isolamento
do programa em relao ao organismo - CEDAE, j que todas as suas
atividades foram terceirizadas, salvo naquilo que dependesse da estrutura
de contrataes e pagamentos; e a permanente separao s vezes at
em diferentes estruturas dos trabalhos sociais daqueles da engenharia
pertinentes ao modelo condominial adotado. No primeiro caso, ter-se-ia
que aproveitar aquela elogivel proximidade do poder para um esforo de
contgio da estrutura com o futuro do programa, muito particularmente
em relao s estruturas de operao. No segundo caso, pelo quanto o
hiato entre as duas organizaes sempre causou um hiato entre as duas
respectivas atividades, com o discurso do programa estando sempre
frente das realizaes, o que em alguns momentos causava certo descrdito
da instituio pelas comunidades.
296

Figura 99
Um ramal condominial em desenho da poca
Fonte: Condominium/CEDAE

Sistema Condominial

Por ltimo, algumas consideraes sobre os primeiros tempos do


programa que estiveram sob a orientao da Condominium para efeito
de transferncia do know how caracterstico do modelo condominial.
Foram os trinta meses iniciais, onde as seis favelas, inicialmente arroladas
foram assumidas como experincia-piloto e serviram de exemplo para o
desenvolvimento de cada uma das novas atividades, sempre realizadas
pela sua equipe: vistorias de campo para re-ratificao dos projetos
bsicos, legitimao poltica junto s lideranas, superviso dos projetos de
engenharia, reunies condominiais e suas decorrncias, locao e ordem
de servio para os ramais condominiais, etc. Esta participao no chegou
a alcanar a plenitude da operao desses servios, muito ao contrrio,
ficou limitada apenas operao experimental, exitosa, de partes de dois
sistemas: o do Morro do Estado e o da Mangueira, nesta ltima no seu
subsistema Telgrafo.

21.4 A SITUAO DO PROGRAMA, HOJE


Os sistemas construdos e a populao atendida,
conforme a CEDAE 97
Foram trinta e duas as favelas atendidas por sistemas condominiais de
gua construdos nos ltimos 15 anos, no Rio de Janeiro, abrangendo
471.000 pessoas. Elas esto relacionadas, com suas principais caractersticas,
na tabela 1 adiante inserida. interessante ressaltar como demonstrao
de adeso ao modelo que este nmero de atendidos 3,5 vezes maior do
que aquele das origens do ProSanear-RJ, de 132.000 usurios. Sinalizando
para a justa observncia das zonas de presses contidas em face da topografia
com grandes elevaes, incluram-se na referida tabela as quantidades de
reservatrios e de estaes de recalque em cada uma das unidades atendidas.
Foram todos os seus sistemas dimensionados para uma quota de suprimento
de 120 l/hab.dia (variaes diria e horria tomadas pelos coeficientes
1,2 e 1,5, respectivamente); patamar de presso situado entre 5 e 30 mca;
dimetros mnimos de 50 mm (nas redes bsicas) e 20 mm (nos ramais
condominiais); alm de serem dotados dos seguintes equipamentos de
segurana: macromedidor nas entradas, vlvulas controladoras de nvel
nos reservatrios e vlvulas redutoras de presso na rede bsica.

97

As informaes aqui dispostas so


da CEDAE e foram organizadas pelo
engenheiro Carlos Eduardo Passos,
abnegado servidor da causa do saneamento
em reas pobres do Rio de Janeiro, que
participou de praticamente todo o ProSanearRJ aqui discutido.

Com relao aos investimentos, as informaes obtidas do conta de que eles


variaram bastante com a dimenso das comunidades, apontando para a forte
presena de economias de escala, o que se pode exemplificar com as favelas do
Morro do Bananal (uma microfavela de apenas 170 habitantes) e a da Rocinha
(uma megafavela de quase 100.000 pessoas), onde os custos per capita foram
de R$ 744,00 e R$ 250,00, respectivamente, para os seus sistemas de gua e de
esgotos, conjuntamente, no sendo considerados os ramais condominiais de ambos
os sistemas.
Uma aluso interessante aos sistemas de abastecimento de gua nas favelas
se pode obter do mesmo rol de informaes citado na nota de rodap 15,
mais ainda quando se considera que a CEDAE uma empresa que deve ser
297

O Sistema Condominial na distribuio de gua

vista como bastante tradicional. que, literalmente, a empresa diz que este
contraste da mega e microfavela nos permite concluir que, tratando-se de
interveno em comunidade de baixa renda, deve-se conceituar os projetos,
no to-somente dentro das normas e padres tcnicos existentes, mas
tambm pela sensibilidade e improvisaes decorrentes dessa forma peculiar
de ocupao habitacional.
Por ltimo, para que se possa ter uma idia da absoro dos conceitos
do modelo condominial pela Unidade do ProSanear-RJ, da CEDAE,
apresentam-se as figuras 100 e 101, onde esse rgo ilustra dois aspectos
do sistema de abastecimento de gua da favela do Vidigal, exatamente de
acordo com a concepo inicial do programa. Na primeira, so mostrados os
subsistemas com seus reservatrios especficos, e que levam na devida conta a
topografia fortemente acidentada; na segunda, a ilustrao do Condomnio
06 do Vidigal, com o seu ramal condominial, com os mesmos detalhes
usados nos primrdios (figura 99).

Desempenho e operao
No foi possvel, tampouco seria o objetivo, realizar um diagnstico
do desempenho operacional dos sistemas de abastecimento dgua ora
considerados. Alis, pela importncia que se imagina para a questo em
se tratando de universos to complicados e soluo to inovadora - bem que
seria o caso de realizar-se um competente diagnstico da operao desses
sistemas. Se isto, inclusive, vier a ser feito como desejvel que se tenha,
todavia, o cuidado para no se incorrer em erros muitas vezes registrados:
o de se atribuir aos sistemas condominiais erros e falhas que no so seus,
mas de dificuldades locais e, principalmente, de deficincias e ausncias dos
prestadores do servio.
De qualquer forma, as entrevistas realizadas na CEDAE, antes referidas,
se no so suficientes, como de fato no so, para uma maior apropriao
da realidade da operao, serviram, com certeza, para que se tivesse uma
razovel idia sobre a questo, sobretudo quando se compara a situao
atual, com os novos sistemas, com a situao de caos anterior a eles. Antes,
porm, de consideraes especficas sobre desempenho, cabem algumas
observaes sobre aspectos fundamentais que so fatores determinantes
da questo, um deles favorvel que a maior presena de sistemas de
infra-estrutura, inclusive os de saneamento e pelo menos trs que lhe
so altamente desfavorveis, a saber:
t FYDFPEBUPQPHSBB FWJEFOUFNFOUFNBOUJEB as demais
caractersticas do universo que eram antes apontadas como
dificuldades esto, hoje, agravadas, constituindo obstculos ainda
maiores: a densidade da ocupao, a fora do governo paralelo
existente em todas elas e a exacerbao da violncia sob todas as suas
formas;
t a estrutura de operao e manuteno montada para as favelas
funciona como um anexo do grande sistema operacional da
298

Sistema Condominial

Tabela 8
As comunidades atendidas por sistemas
condominiais de gua e
suas principais caractersticas
Fonte: CEDAE

empresa, com evidente subestimao de suas necessidades pelos


escales superiores, situao que, alis, no exclusiva da CEDAE,
mas comum a quase todo o sistema brasileiro do saneamento;
t BTequipes alocadas especificamente em cada favela so
simplesmente irrisrias, tais como, por exemplo: um tcnico de nvel
superior para 13 comunidades ou, bem pior, apenas um funcionrio
para, de 12.000 a 20.000 ligaes, nas maiores comunidades.
Nas circunstncias acima, as informaes sobre o desempenho, ou pelo
menos sobre o atendimento da populao, inclusive com testemunho de
moradores, satisfatria: todas as favelas estariam com seus moradores
inteiramente atendidos, em grande parte dos casos com servios
contnuos. Desse ponto de vista, portanto, a situao chegaria a ser mais
confortvel do que a que hoje ocorre no asfalto de algumas capitais
brasileiras.
Na rea comercial, contudo, a situao se mantm sem maiores avanos, j
que inexistem as medies individuais na totalidade prtica do universo.
As contas continuam sendo faturadas apenas para uma parte dos usurios
e inexiste sistema de cobrana, fazendo com o que as perdas sejam elevadas
(porm, no medidas ou sequer avaliadas) e ameaam o retorno daquele ciclo
vicioso. Os operadores comeam a sentir a necessidade do fornecimento
de maiores volumes (embora aleguem que isto ocorre em funo do
crescimento das comunidades) e a evaso de receitas deve ser to grande
quanto antes.
Pelo que se sente da situao do atendimento e, sobretudo, dos depoimentos
dos entrevistados, agentes do processo, de que essa forma dos sistemas
bastante melhor, na medida em que prende a gua em determinadas
posies e permite um maior controle da situao a partir da criao
299

O Sistema Condominial na distribuio de gua

dos condomnios. que, na prtica, eles subdividem o morro e diminuem


os pontos de consumo a controlar, sobretudo na ausncia dos hidrmetros.
Todos defendem que a volta dos trabalhos de mobilizao comunitria seria
uma das mais importantes medidas a ser tomada em benefcio do servio e
declaram que, sendo to poucos os empregados dos servios, evidente
que eles funcionam graas colaborao de abnegados moradores em
tarefas que a rigor seriam do prestador do servio. Por fim, no deve
deixar de ser assinalado que os depoimentos dos entrevistados no podem
deixar de ter um cunho comparativo com a situao anterior e, nesse sentido,
no devem ser tomados na exata medida das afirmaes.

21.5 CONSIDERAES OPORTUNAS


Nos pases desenvolvidos, os servios urbanos, dentre eles os de saneamento,
podem ser vistos como uma questo meramente institucional, regulamentada
e estendida por igual a toda a populao, na medida das necessidades de cada
segmento. Em pases como o Brasil, por outro lado, tais servios esto num
outro patamar, significativamente atrasado, tal que, no sendo capazes, na sua
oferta, daquele atendimento regular e uniforme, so levados ao atendimento
300

Figura 100
O sistema de gua do Morro do Vidigal
com seus subsistemas de reservao e de
presso, conforme ilustrao da CEDAE
Fonte: CEDAE

Sistema Condominial

Figura 101
O condomnio 6 do Vidigal, e seu
ramal condominial, segundo desenho da
CEDAE
Fonte: CEDAE

parcial e bastante diferenciado, de um para outro segmento social. Dessa


forma, ento, se pode dizer que os servios urbanos, ao invs de serem
aquela questo meramente institucional, constituem, ainda, um grande
problema social e que se administra segundo as injunes polticas. Da a
evidncia com a qual se observa que, via de regra, a qualidade do servio
prestado populao , na prtica, proporcional ao seu nvel de renda e
de poder poltico, conseqentemente. O fato de as urbanizaes tambm
seguirem o mesmo contexto tanto mais pobres, tanto mais desorganizados
os bairros agrava ainda mais aquele quadro de desigualdades, j que as
dificuldades oriundas das sub urbanizaes terminam servindo de obstculos
para a melhor dotao e operao dos servios. Tal quadro, dada a sua
continuidade, se torna uma questo cultural a impregnar concessionrios
e operadores.
Isto est novamente colocado, agora, para que se entenda que o universo
das (chamadas) favelas do Rio de Janeiro seja um exemplo inexcedvel
deste problema, onde alm da menor renda, ajudam a explicar o fenmeno
da mnima ateno aos seus servios de saneamento as reais dificuldades
301

O Sistema Condominial na distribuio de gua

trazidas por sua topografia, sua dasarrumao urbana e sua violncia,


sobretudo. De qualquer forma, parece indiscutvel o avano da condio de
atendimento da populao, no apenas pelos novos sistemas implantados
mas tambm por mritos indiscutveis da CEDAE, principalmente na fase de
implantao das obras.
Por ltimo, pelo menos mais uma sugesto parece cabvel para o futuro do
abastecimento de gua nessas comunidades, alm daquela oportunamente
j feita com relao aos estudos que levassem a um diagnstico da situao
dos servios. Seria a descentralizao mxima possvel do atendimento,
criando-se condies para uma efetiva aproximao, sobretudo fsica,
face ao sistema institucional. Isto uma decorrncia da reconhecida
dificuldade de audincia do sistema institucional a essas comunidades, no
apenas nos servios de saneamento, mas tambm nas suas outras demandas.
O atendimento de um tal requisito, que se coloca como bvio, no parece,
contudo, uma atribuio da CEDAE, muito menos, em carter exclusivo.
A rigor, por suas obrigaes constitucionais e sua natural aproximao,
esta descentralizao deveria ser um papel da municipalidade do Rio
de Janeiro. E, por extenso, das municipalidades de todo o Pas. No caso
do saneamento, portanto, a idia seria a de que a operao da distribuio
caminhasse para este novo mbito da gesto, recuando a CEDAE para o
fornecimento da gua, quando ento teria a crtica distribuio de gua
uma melhor e mais adequada responsabilizao institucionalizao. Numa
primeira etapa, seria razovel um papel mais suave para a municipalidade,
algo como a mobilizao e a educao ambiental das comunidades, questo
que seria de grande valia para o saneamento, mas certamente teria muito
maior amplitude na direo da cidadania.

302

Sistema Condominial

22. SISTEMA CONDOMINIAL DE


DISTRIBUIO DE GUA EM
PARAUAPEBAS
22.1 A CIDADE DE PARAUAPEBAS, NO PAR
Parauapebas uma jovem cidade de apenas 20 anos que se situa ao sul do
Estado do Par, a 700 km da sua capital, Belm, e que tem a sua histria e
o seu formidvel crescimento urbano inteiramente associados s jazidas
minerais da Serra dos Carajs, sobretudo as de ferro, exploradas nas
ltimas dcadas pela Companhia Vale do Rio Doce - Vale. Por ocasio de
sua emancipao poltica, em 1988, apresentava uma populao de 20.000
habitantes, evoluindo este nmero para 60.000, quando da implantao
de seus sistemas de saneamento, em 1997, e j alcana quase 150.000
pessoas, agora em 2008. Trata-se, assim, de um eldorado, capaz de atrair
brasileiros de vrios estados, sobretudo do norte e do centro-oeste. Pessoas
que deixam para trs suas origens e se largam corajosamente em busca de
maiores oportunidades. Esta relao da cidade com a Vale viria a constituir,
possivelmente para sempre, uma verdadeira simbiose entre as duas, com a
empresa sempre influenciando a cidade, no apenas no seu crescimento, mas
tambm na sua renda e nos seus problemas urbanos. Lanando o contorno
da planta da cidade da poca do projeto do seu sistema condominial, 1996,
nas fotos de satlite, de 2006, conforme a figura 102, se pode ter uma idia da
formidvel expanso de Parauapebas.
A Vale tem apresentado um extraordinrio dinamismo, crescendo as
suas atividades mineradoras a cada ano e se constituindo, hoje, numa das
maiores mineradoras do mundo. Na regio, ela no pra de se expandir:
seja territorialmente, avanando para os municpios vizinhos de Cana
dos Carajs e Eldorado, seja contemplando a explorao de vrios outros
minrios como o ouro, o cobre, o nquel e o mangans, condio que chega
a conferir a Parauapebas o carter de mais importante centro minerador do
Pas, justificando que se chame a cidade de a Capital do Minrio do Brasil,
com esta atividade sendo a principal responsvel pelo seu elevado Produto
Interno Bruto, por exemplo, de 2 bilhes e 700 milhes de reais, em 2007. De
muito menor expresso que essa atividade, mas tambm ocorrendo em ritmo
crescente esto a pecuria bovina e a agricultura, principalmente, a primeira.
A Cidade est situada no Vale do Rio Parauapebas, sendo banhada pelo
caudaloso leito do rio, que a separa de uma rea de Preservao Ambiental
de floresta amaznica. Ocupa um stio bastante agradvel de altitude mdia
de 350 m e que no apresenta variaes maiores que 60 metros, ao passo
que o seu clima tropical mido, com temperatura mdia anual de 25o e
precipitaes pluviomtricas variando de 1.750 a 2.250 mm por ano, com
maior concentrao de chuvas no perodo novembro-abril.
Alm dos minrios propriamente ditos, o municpio e particularmente a
sua sede - tambm rico em recursos hdricos de superfcie, com destaque
para a presena dos rios Itacainas e Parauapebas, nascidos na Serra
303

O Sistema Condominial na distribuio de gua

Arqueada, sendo que este ltimo limita a sede municipal ao norte, alm de
constituir-se na sua fonte de abastecimento dgua.
No setor dos transportes, Parauapebas conta com um aeroporto capaz
da operao diria de avies de mdio porte com origem e destino em
cidades como Braslia e Belm, e est interligada malha rodoviria do Pas
atravs de estradas regulares para capitais importantes como Belm, Palmas
(Tocantins), Teresina (Piau) e So Lus (Maranho), sendo que para esta
ltima tambm h a disponibilidade de magnfica ferrovia operada pela
Vale, a qual oferece transporte de passageiros de tima qualidade por preos
acessveis, o que de alguma forma tem facilitado a imigrao de populaes
oriundas da regio Nordeste do Pas. A citada ferrovia serve tambm como
indicador do porte das atividades da mineradora, quando se considera que o
transporte de minrio de ferro realizado em regime contnuo durante todo
o ano, com mais de 200 vages carregados em cada locomotiva.
No que tange sua urbanizao, vale registrar que a cidade de
Parauapebas ainda se destaca como um bom exemplo dentre os
municpios do norte e do nordeste do Brasil, pelo seu organizado
desenho urbano, sua infra-estrutura fsica, com modernos e extensivos
sistemas virio e de saneamento bsico (drenagem, abastecimento dgua
e esgotamento sanitrio, coleta de lixo e limpeza pblica), sua rede escolar
(que j inclui universidade) e hospitalar, e ainda pelo grande nmero de
304

Figura 102
Parauapebas e sua expanso num perodo
de apenas 10 anos (1996/2006)

Sistema Condominial

projetos de assistncia a diversos segmentos sociais e econmicos. Parece no


haver dvidas de que isto uma decorrncia natural, inegvel, da confluncia
de dois fatores: de um lado, o substancial reforo dos recursos financeiros
municipais pelos royalties advindos da explorao mineral e, de outro, por
certa caracterstica cosmopolita que lhe confere aquela sua natureza de
eldorado.

22.2 AS CIRCUNSTNCIAS DO SEU PROJETO DE


GUA
A cidade e o seu abastecimento dgua, nos
primrdios
Quando nos anos setenta a Vale se fez mais presente no vilarejo que se
tornaria Parauapebas, atravs da construo de um ncleo habitacional
no seu stio, para seus funcionrios, trouxe tambm alguns dos servios
urbanos, inclusive os de saneamento, condio que aprofundaria, na prtica,
aquela simbiose a que se fez referncia anteriormente. O servio de gua,
por exemplo, alm de construdo pela empresa era tambm por ela operado,
sem nenhum nus para os seus usurios. Com o contnuo crescimento
da cidade, este sistema rapidamente foi superado e a populao excluda
do seu atendimento, dividiu-se, conforme a sua renda e a ocorrncia de
lenol fretico nas suas residncias, entre os que podiam e tinham um poo
raso capaz de seu suprimento, e os impossibilitados desta soluo, que se
abasteciam, muito precariamente, por carros-pipa da municipalidade.
Dia a dia, essas trs formas de suprimento eram pioradas pelo crescimento
acelerado da populao e por razes particulares a cada uma: o servio da
CVRD, desgastado pela m operao; os poos, contaminados pelo nmero
crescente das fossas que supriam a falta de um sistema adequado de coleta de
esgotos; e os carros-pipa pela simples inadequao dessa forma para maiores
contingentes. As precrias condies desse servio, agravadas ainda pela falta
da coleta de esgotos, contribuam fortemente para a proliferao de doenas,
no sendo mais graves as conseqncias desse quadro graas ao trabalho
realizado pela Fundao Nacional de Sade (Funasa), na orientao sanitria
da populao.

O convnio entre a Vale e a prefeitura


ensejando um novo sistema
O contexto no abastecimento de gua evidenciava que a cidade crescia
num ritmo que suplantava o potencial da instncia municipal em face das
suas demandas, o que favoreceu a celebrao, em 1993, de um interessante
convnio de cooperao entre a Vale e a prefeitura, o qual viria a ser
decisivo na dotao dos servios adequados de abastecimento dgua e
esgotamento sanitrio da cidade. que ele possibilitou uma interessante
modelao em favor da dotao desses sistemas, que conciliava todos os
interesses e disponibilidades em jogo, constituindo-se, assim, em um bom
negcio para todos:
305

O Sistema Condominial na distribuio de gua

t a carncia da cidade pelos servios e a impossibilidade de a


municipalidade enfrentar os investimentos demandados num prazo
curto, utilizando apenas os seus recursos;
t a possvel viabilizao de um financiamento pelo Banco Mundial,
tendo-se a Vale como executora das obras e garantidora da operao,
atravs dos royalties devidos municipalidade;
t a Prefeitura amortizaria o citado emprstimo mediante o
desconto, pela Vale e repasse ao Banco, do equivalente a 25% dos
seus recursos arrecadados em royalties, mensalmente;
t FBJOEBBEFDJTPEFesta ltima suprir a ento incipiente estrutura
municipal, trazendo a si a responsabilidade pela implementao dos
sistemas de abastecimento de gua e esgotamento sanitrio da cidade,
at que a sua municipalidade se preparasse para essa tarefa.
Os dois sistemas projetados segundo o modelo convencional foram
orados em 7,8 milhes de dlares, montante que viria adiante se mostrar
insuficiente, quando, ento, os oramento e financiamento elevaram-se para
o dobro desse valor inicial. Destoava do modelo convencional a concepo
do tratamento dos esgotos da cidade, bastante descentralizado e que utilizou
quatro lagoas de estabilizao, todas elas localizadas no ambiente urbano,
conforme a planta representada na figura 103.
O sistema de abastecimento dgua foi projetado para uma populao
de 100 mil habitantes (que seria atingida em apenas dez anos), captando
230 litros/segundo do rio Parauapebas, atravs de uma estao de recalque
montada numa estrutura flutuante e que promovia a aduo (1.300 m
de extenso com dimetro de 500 mm) at uma estao de tratamento e
reservatrio, situados em cota suficiente para o abastecimento da cidade,
por gravidade. A rede de distribuio dgua alcanava duas teras partes
das ruas da cidade, no pressuposto de que a ligao de cada prdio
seria individualizada, conforme o modelo dito convencional, o que est
ilustrado na figura 103 inserida adiante.
O fato que deu margem ao aparecimento do sistema condominial para a
distribuio de gua e o esgotamento sanitrio de Parauapebas foi quase
um acaso. que no final de 1996 a Vale constatou a impossibilidade do
cumprimento das metas originais de atendimento da Cidade pelos dois sistemas,
na hiptese de continuidade do patamar de custos caracterstico do modelo
convencional que vinha determinando a obra. Naquela ocasio, as unidades
componentes do sistema de produo dgua estavam inteiramente concludas
(exatamente na forma como projetadas) 98, ao passo que a implantao das redes
dos dois sistemas, contratada com outra empresa, mal havia iniciado e j estava
paralisada ou, melhor dizendo, as obras estavam abandonadas pela construtora
sob alegao de desequilbrio econmico do contrato.
Inexperiente no setor do saneamento, a Vale buscou informao no
PMSS a respeito do modelo condominial, o qual confirmou o seu xito no
esgotamento sanitrio, inclusive citando Braslia como um bom exemplo.
Nesse sentido, a Condominium, mais uma vez, foi procurada para uma
demonstrao sobre o novo modelo. Com ela, naturalmente, o autor dos
306

98

As unidades concludas a esta poca eram


a captao dgua, a estao de tratamento
e o reservatrio de distribuio, com as
respectivas adutoras e subadutoras que as
interligam.

Sistema Condominial

Figura 103
A descentralizao do tratamento dos
esgotos da cidade e as suas lagoas de
estabilizao no meio urbano

cadernos. Com o avano das obras, naquela altura dos acontecimentos, o que
se fazia em jogo, portanto, para mudanas de concepo, eram os sistemas de
distribuio de gua e de coleta de esgotos 99.

22.3 O PROCESSO DE TRANSFORMAO DOS


SISTEMAS PARA O MODELO CONDOMINIAL
Os estudos realizados que levaram guinada dos
sistemas
99

Com efeito, o sistema de produo de


gua j estava implantado e a concepo do
tratamento do sistema de esgotos, naquela
feio descentralizada, j atendia aos
FRQFHLWRVGDORVRDFRQGRPLQLDO

A concretizao da mudana de concepo para o modelo condominial ocorreu


com os estudos realizados pela Condominium, ento contratada pela Vale com
o objetivo de demonstrar a exeqibilidade daquela transformao - no apenas
em termos de custos, mas tambm de qualidade dos futuros servios. Do seu
relatrio final, foram tirados os elementos deste captulo.
307

O Sistema Condominial na distribuio de gua

Os estudos constaram da concepo, do dimensionamento e do oramento


dos dois sistemas aqui citados, distribuio dgua e coleta de esgotos, dos
quais se considerar apenas o da distribuio de gua 100. Esses estudos
seguiram os mesmos pressupostos adotados para o seu projeto convencional
original: populao de projeto de 100.000 habitantes, regime contnuo de
funcionamento, cota per capita de 250 litros dirio, alm de mesmas hipteses
para os dimensionamentos hidrulicos. No que tange concepo ou ao
traado da rede distribuidora agora rede bsica - a orientao adotada, na
sua plenitude, foi aquela decorrente da conceituao do modelo condominial
e exposta nos captulos 19 e 20 deste Caderno. O desenho da nova rede ento
resultante pode ser visualizado na figura 105, que ilustra a sua nova concepo,
desta feita, cobrindo toda a rea urbana da cidade, diferentemente do primeiro
projeto que exclua o Bairro da Paz, o maior e mais pobre bairro da Cidade.
O argumento decisivo quanto ao modelo a ser adotado na continuidade
das obras seria, evidentemente, a comparao dos custos entre as duas
alternativas, uma vez que a Vale j se convencera da plena suficincia
tcnica do sistema condominial, vista, simplesmente de sua lgica. Nesse
sentido, o critrio adotado naquela ocasio foi o de tomar como referncia
para a comparao os preos vigentes no ltimo contrato de execuo da
prpria obra, estendendo-os aos projetos de uma e de outra soluo e em
mesmas reas da cidade.
Os nmeros alcanados para as duas redes, numa e noutra concepo,
esto expostos na tabela 2, adiante inserida, chamando a ateno para o
fato de que a rea que serviu de base comparao foi aquela comum a
ambas as alternativas: tinha 293 ha, equivalente a 53% de toda a cidade, e
correspondia que restava a executar dentre a rea total projetada no sistema
convencional, 367 ha (que no abrangia toda a cidade), quando dela se
retirava a parcela j executada, 74 ha. Os resultados da comparao foram
bastante expressivos e convincentes, sem dvida:
t uma reduo na extenso da rede de nada menos que 80%, o
equivalente a 54.868 m num total de 68.518 m;
t uma reduo do investimento favorvel ao modelo condominial da
ordem de 73%, explicada pela menor extenso de rede, 68% e, ainda
mais, pelas menores escavaes e suas decorrncias, 78%;
t incluindo-se o Bairro da Paz, quando ento a cidade estaria
totalmente atendida, o investimento necessrio para implantao
da rede segundo a concepo condominial ainda seria 60 %
menor do que o previsto para aquela (menor) rea com o modelo
convencional (R$ 379.295,00, contra R$ 927.776,00);
t VNGBUPJOUFSFTTBOUF UBNCNoDPORVBOUPOPTFKB FNQSJODQJP 
uma caracterstica geral do novo modelo foi a economia de escala
que se alcana na cidade de Parauapebas, quando se amplia a sua
rea atendida por sistema condominial de gua: de R$ 847,00/ha,
quando a rea de 293 ha, para R$792,00/ha quando se a amplia para
os 479 h, mediante a incorporao do Bairro da Paz.
308

100
O sistema condominial de esgotos seguiu
todos os passos do de distribuio de gua,
desde a aprovao operao.

Sistema Condominial

Figura 104
O projeto do sistema convencional de
distribuio de gua
Fonte: Condominium/VALE

101
Este usurio representativo da Cidade foi
FRQVLGHUDGRFRPRVHJXLQWHSHUOPpGLR
ramal no passeio, 10 m de testada de lote,
11 m de largura de rua, 2 m de largura de
calada e 30% de pavimentao de vias;
suas canalizaes eram de PVC, meio a
meio nos dimetros de polegada e 1
polegada, e suas valas tiveram suas larguras
e profundidades estimadas da seguinte
forma: nos ramais convencionais, 0,60 m x
0,90 m e, nos ramais condominiais, 0,30 m
x 0,40 m.
102
Recorde-se que o ramal condominial
atende toda a quadra, de sorte que o custo
correspondente a um usurio, ou a sua
quota, a ensima parte do custo total, onde
QpRQ~PHURGHORWHVGDTXDGUD

Para os oramentos das duas alternativas de ramais, como no havia


referncia de preos naquele contrato de obras acima citado, o procedimento
adotado foi o de quantificar e orar, a mesmos preos, os quantitativos no
comuns s alternativas correspondentes ao usurio mdio da cidade 101,
com o que os custos, tambm mdios, das ligaes, a preos de 1997
foram, respectivamente, de R$ 43,43 para o ramal individual do modelo
convencional, e R$ 17,00 para a cota individual do ramal condominial 102.
necessrio salientar que o maior custo de canalizaes neste item do modelo
condominial, decorrente da maior extenso dos ramais condominiais (10
m/lote) em relao aos convencionais (5,50 m), mais que compensado
pelo maior volume das escavaes (e decorrncias) destes ltimos, dada a
sua posio transversal s ruas. Esses valores mdios dos ramais, portanto,
ainda mais acentuaram a vantagem do novo modelo: para os 5.157 lotes da
rea comparada, os montantes a este ttulo seriam de R$ 223.968,00 e de R$
87.609,00, respectivamente para os sistemas convencional e o condominial;
mais uma economia, aqui, da ordem de 60%.
A par das evidncias favorveis ao modelo condominial, postas acima pelo
lado econmico do empreendimento, vale destacar o que deste modelo
309

O Sistema Condominial na distribuio de gua

ainda era dito no mesmo relatrio de janeiro de 1997, e que tambm


ratifica o que a respeito foi dito no captulo 19:
t facilidades para a construo de uma menor rede e, em
conseqncia, tambm menores escavaes, interferncias de subsolo,
escoramentos, esgotamentos, retiradas e reposies de pavimentos,
como tambm menores transtornos para a populao;
t maior possibilidade de controle sobre a rede bsica, determinada,
no geral, pela reduo das extenses e pelos sucessivos mbitos de
distribuio, com entrada nica e controlvel de gua os micro
sistemas e os condomnios;
t e, ainda, a benfica eliminao, do ponto de vista da reduo de
perdas no sistema, das tomadas dgua caractersticas das redes
convencionais, realizadas para cada ramal predial atravs de frrules,
sabidamente pontos crticos do sistema.

A deciso e a forma de implementao do novo


sistema
A partir desses estudos e sua aceitao pela Vale, tudo viria a acontecer, at
a operao em regime dos sistemas condominiais de gua e de esgotos da
cidade de Parauapebas, de forma inusitada, corajosa e correta por parte dessa
grande empresa. No primeiro momento, ento, os seus encaminhamentos
foram a apresentao, discusso e aprovao da nova soluo, sucessivamente,
na administrao municipal, na Cmara dos Vereadores e em representaes
da sociedade local, em processos sempre informais, no que se repetia,
aperfeioando, todavia, prticas do novo modelo.
A deciso final da Vale pelo modelo condominial tambm para o sistema
de distribuio de gua foi o passo seguinte. Teve o apoio da direo
local da empresa (a Unidade Carajs), mas, de fato, foi tomada pela
instncia superior da empresa, no Rio de Janeiro 103. Ela se constituiria
numa experincia absolutamente indita, no mundo, e estava
sendo assumida por quem no tinha nenhuma tradio ou maiores
conhecimentos no campo do saneamento. Num setor reconhecidamente
conservador como o saneamento, talvez tenha sido este o principal fator
a mover uma tal deciso. Mas, uma vez tomada esta deciso, foi ela em
seguida cercada de todos os requisitos de cautela e segurana, bem como
de responsabilizao por quem a havia induzido nessa direo, no caso a
Condominium. O procedimento nesse sentido foi o de contratao desta
empresa, para, excetuando-se a execuo das obras, que ficaria a cargo de
empreiteiras especficas, assumir todas as demais atividades necessrias e
suficientes ao funcionamento dos sistemas na sua operao em regime.
Abrangeu, ento, a referida contratao, um escopo inusitado, mas
com certeza completo e absolutamente correto, que incluiu todo o
conjunto das necessidades requeridas para a perfeita reverso do modelo,
alm das prprias demandas de quem haveria de realizar a futura
gesto dos servios, sem que para tanto tivesse a mnima experincia,
como era o caso da jovem Prefeitura, que iniciaria, na poca, o seu
310

103

frente, o decisor da empresa para


esses assuntos, Dr. Maurcio Reis, auxiliado
pela arquiteta Vnia Vellozo, responsvel
por todo o processo de viabilizao da
importante guinada.

Sistema Condominial

Figura 105
O sistema condominial de distribuio de
gua, cobrindo toda a rea urbana
Fonte: Condominium/VALE

104
Este contrato, com seus aditivos, se
estenderam de dezembro de 1997 a
setembro de 1999, quando a Prefeitura
assumiu o comando do processo.
105
Como esse reservatrio tem seu nvel
mdio na cota 205, e mais da metade da
rea urbana estava na cota 165, foi cogitado,
nessa ocasio - mas no aceito pelos
contratantes - a reduo das presses nas
reas da Cidade com maiores desnveis em
relao ao reservatrio, o que seria possvel
atravs da adequada interposio de caixas
ou vlvulas redutoras de presso.

terceiro mandato eletivo. Este escopo, ento, estendeu-se desde toda a


engenharia de projetos e assistncia s obras, ao processo educativo
da populao usuria, realizao da operao experimental e seus
naturais ajustamentos, at a elaborao dos instrumentos jurdicolegais e institucionais requeridos para o seu funcionamento: os estudos
econmico-financeiros e a definio de sistema tarifrio; o marco
regulatrio do desempenho dos servios; e as alternativas para o
sistema de gesto e seus mecanismos de suporte legal 104.

22.4 A IMPLEMENTAO DAS OBRAS


A Rede Bsica
Conforme a figura j apresentada, o traado da rede bsica de distribuio de
gua da cidade se originou do reservatrio nico de distribuio da cidade,
com cota capaz de garantir o atendimento, por gravidade, de toda a sua rea
urbana 105. Alm dessa origem, o traado foi determinado, conforme os
captulos 19 e 20 anteriores, pelo esforo de minimizao da sua extenso
e de obstculos de percurso (pavimentao de ruas e maior intensidade de
trfico, sobretudo), com a obrigatoriedade de tocar cada quadra em pelo
menos um ponto, aquele que a abasteceria. Assim delineado, ele foi capaz
de realizar este objetivo numa rea de 950 hectares, com menos de 44
311

O Sistema Condominial na distribuio de gua

quilmetros de tubulao (ou 46 m/ha) extenso que era equivalente a


15% do comprimento total de ruas da cidade, 287 quilmetros, mesmo
comprimento que teria uma rede de distribuio convencional. Relembra-se
que o projeto original deste sistema, convencional, lhe atenderia apenas 293
ha e demandaria uma extenso de canalizao de 84.000 m, do que resultaria
uma relao de 288 m/ha contra 46 m/ha da nova soluo.
A feio longitudinal da cidade sugeriu que o traado acima citado
constitusse uma rede ramificada, critrio que tambm iria assegurar maiores
controles operacionais pela formao de micro sistemas que disporiam de
registro de parada e de macromedidores em seus pontos de alimentao,
conforme se ilustra na figura 106, com a rede bsica de um setor da
cidade. Os registros de parada, ali indicados por RN, onde N representa o
setor passvel do isolamento, conferem grande mobilidade operao do
sistema, mais ainda quando se conhece, como foi o caso de Parauapebas, os
usurios que correspondem a cada um desses setores, e com isso se consegue
determinar o ndice de desabastecimento do servio, conforme se ver
adiante.
Todos os registros (de parada e de descarga) previstos no projeto foram
efetivamente instalados, mas os macromedidores, que inclusive vieram a ter
um projeto especfico na fase de operao do sistema pela municipalidade, e
que ampliariam de muito os controles do sistema, jamais foram adquiridos. A
utilizao de ventosas, por seu turno, no se fez necessria.
O dimensionamento hidrulico da rede bsica ocorreu conforme a
orientao do captulo 20 deste caderno, seja para a apropriao de vazes
(por quadra e conforme a natureza e o nmero de seus lotes), seja para a
definio dos dimetros e a verificao das condies do escoamento. A
disposio de registros de descarga e a formao dos seus ns ocorreram de
forma similar s dos sistemas convencionais, apenas cuidando de interpor,
nos locais de sada para os condomnios, as peas mais adequadas a esta
312

Tabela 9
2VQ~PHURVGRVGRLVPRGHORVTXHVHUYLUDP
comparao
Fonte: Condominium/VALE

Sistema Condominial

Figura 106
Os Micro Sistemas e os seus controles

funo, conforme se exemplifica em destaque adiante inserido. Conforme


as indicaes tambm usuais, no houve necessidade da colocao de
ventosas. A esse respeito, inclusive, vale lembrar que no fora a preexistncia
desse reservatrio na cidade, determinando-lhe, na prtica, seu esquema de
distribuio dgua, uma concepo tipicamente condominial teria partido,
com certeza, de uma descentralizao dos reservatrios, como forma de
tornar mais uniformes as presses disponveis, por patamares.
Para a implantao das obras, realizada em atendimento s especificaes
feitas para a rede convencional, foram emitidas ordens de servio para cada
um de seus trechos, com o detalhamento dos respectivos ns, elementos estes
que serviram de base, para os seus cadastros. Com a disponibilidade de gua
no reservatrio antecedendo toda essa construo, os trechos concludos iam
sendo postos em carga.
Mais recentemente, em 2004, foi elaborada uma primeira reviso desse
projeto para atendimento da forte expanso da Cidade, agregando-lhe mais
228 ha, com a implantao de um adicional de 9.390 m de canalizao e que
forneceu uma densidade de canalizaes ainda menor que aquela registrada
na implantao: apenas 41m/ha.

106
Atravs de cinco frentes de trabalho, uma
em cada um dos bairros envolvidos.

Nesta expanso, por sinal implantada em um prazo to curto quanto 30


dias 106, a concepo, o dimensionamento e os acessrios adotados foram
em tudo semelhantes ao primeiro projeto, registrando-se em relao
a ele, todavia, uma interessante inovao: o seu dimensionamento
automatizado, capaz de fornecer as indicaes para alterao de
componentes em funo de qualquer alterao das condies de
demanda variaes de reas ocupadas, densidades, consumos, etc.
Ou seja, nessas novas condies de domnio sobre o sistema, eventuais
313

O Sistema Condominial na distribuio de gua

deficincias no suprimento de uma rea podero ser diagnosticadas


de imediato, simultaneamente indicao das alteraes necessrias
restaurao do equilbrio hidrulico. Isto pode ser melhor apreciado na
figura 107, onde se renem as sucessivas informaes que caracterizam
trs fases desse dimensionamento e demonstram a sua condio de
permanente atualizao, desde que o cadastro comercial do servio,
tambm de forma sistemtica, tenha a sua atualizao. Na parte superior
da figura, por exemplo, aparece a planilha que apropria a situao de
ocupao de cada quadra, lote por lote, atualizvel, a cada visita do
agente comercial; na sua parte mdia, est, por seu turno, a apropriao
da vazo de cada quadra, o que combina a informao anterior com
o que houver de melhor a partir de hidrogramas de consumo; e,
finalmente, o terceiro elemento da figura a planilha propriamente
dita do dimensionamento hidrulico, realizada a partir das vazes
localizadas em cada quadra.

Mobilizao social: novo impasse, nova deciso,


nova guinada...
Os cuidados de que se muniu a Vale para a implementao do sistema
condominial de gua em Parauapebas no evitariam, contudo, um percalo no
processo, mas cuja forma de superao se constituiria em um de seus pontos
altos. que os preos propostos para a implantao dos ramais superavam
extraordinariamente os valores do mercado, impossibilitariam o atendimento
da populao e eram, at mesmo, inadmissveis no plano moral. Foi a, ento,
que a Condominium, que inclua no seu contrato um processo de sensibilizao
da populao em face dos servios que lhes chegariam 107, props-se a ampliar
este escopo abrangendo a mobilizao de toda a populao para a construo
de seus ramais condominiais, organizadamente, em cada condomnio.
Isso abrangeria, na ocasio, 60.000 pessoas, cerca de 720 condomnios e
aproximadamente 130 quilmetros de canalizao, possivelmente, uma da
maiores mobilizaes sociais j feitas no Brasil 108.
A aceitao da idia pela Vale e pela Prefeitura no foi fcil: embora no fosse
dito, era perceptvel um certo temor de ambos com um grande fiasco. Para
alcan-la, alm de argumentos foi necessrio o exerccio do que o comum
nos processos condominiais: uma grande reunio com lideranas da cidade 109
e uma experincia-piloto em um dos seus bairros, ambos exitosos em face
da firmeza das regras adotadas - que, em ltima anlise, demonstravam
ser esta a nica possibilidade de a gua chegar a todas as casas, diante da
circunstancial falta de recursos pblicos para isto. Giravam em torno do
seguinte:
t absoro, pelo prestador do servio, das tarefas incompatveis com
a natural habilitao dos usurios: o dimensionamento dos ramais e
o assentamento das suas tubulaes;
t informaes exaustivas sobre o modelo condominial em vista do
seu desconhecimento, at ento, pela populao; destaque para a
314

As equipes participantes
justo mencionar os principais
colaboradores diretos do autor,
nos trabalhos realizados pela
Condominium, no saneamento
bsico de Parauapebas, nas
suas trs sucessivas fases. Os
engenheiros Maria Clara Rodrigues
e Natanael Ramalho, nos estudos
iniciais (que inclusive conduziram
deciso pelo modelo condominial)
e nos respectivos projetos; o
engenheiro qumico Alessandro
Spinelli, na vitoriosa conduo
dos trabalhos de implementao
dos sistemas e do seu processo
participativo, no acompanhamento
das obras e na operao
experimental dos servios, com a
valiosa ajuda do tcnico Osvaldo
&RVWDHQDOPHQWHRTXtPLFR
Gedeo Neves e o engenheiro
Joo Miranda Neto, na operao
HPUHJLPHVHQGRHVWH~OWLPR
tambm o responsvel pelo projeto
e acompanhamento da ampliao
do sistema.

107
Isto, utilizando o processo condominial de
mobilizao, abrangeria o esclarecimento
dos usurios sobre os sistemas e o seu
correto uso, alm dos direitos e deveres da
comunidade e da Prefeitura, particularmente
quanto ao consumo da gua e aos
pagamentos devidos.
108
Anteriormente, as situaes similares a
essa ocorreram na construo de ramais
condominiais de esgotos em algumas
cidades do Rio Grande do Norte e do Distrito
Federal, sempre, contudo, em menores
dimenses.
109
Na falta de uma entidade preexistente
FRPHVVHSHUOUHXQLXPHPRUDYHOPHQWH
lideranas de todas as organizaes
locais reconhecidas ou ao menos sabidas:
igrejas, associaes comunitrias, clubes
VRFLDLVHQWLGDGHVS~EOLFDVVLQGLFDWRVH
organizaes de classe, partidos polticos,
etc, sem qualquer discriminao.

Figura 107
Uma ilustrao dos sucessivos clculos at o dimensionamento da rede bsica
Fonte: Condominium/PMP

Sistema Condominial

315

O Sistema Condominial na distribuio de gua

individualidade do usurio no suprimento da gua, na sua medio,


na cobrana das contas;
t garantia da boa operao e da justa cobrana dos servios, pela
municipalidade, e do regular pagamento, por parte da populao;
t ordenamento das ligaes de cada condomnio ao servio na ordem
exata da aceitao das regras por cada um deles, representada pelo
termo de adeso assinado pelos condminos, pela prpria compra dos
componentes especificados para o ramal e pela escavao das suas valas.
Estava aceito, delineado e iniciado, portanto, o processo que levaria
toda a comunidade a prover, organizadamente por seus condomnios
e s suas expensas, o abastecimento dgua de todas as suas casas. Um
processo que abrangeu todos os 15 bairros ento existentes na Cidade,
com as suas 720 quadras, 13.081 lotes e cerca de 60.000 habitantes,
tendo sido deflagrado atravs da realizao de pelo menos uma reunio
em cada uma dessas quadras, que ento passavam a ser vistas e tratadas
como condomnios 110. As reunies, muito objetivas, se voltavam para
os esclarecimentos e para as discusses necessrias sobre o sistema
condominial e as suas regras para o acesso da populao aos servios;
para a eleio do sndico que viria a representar o condomnio em
todos os sucessivos passos do processo; e para a entrega do modelo de
termo de adeso, o qual, assinado por todos os condminos, viria a
determinar o incio do processo de dotao dos ramais condominiais,
conforme descrio no prximo item.

Os Ramais Condominiais
Os ramais condominiais descritos nos captulos 19 e 20, foram, na prtica, os
de Parauapebas, j que foram eles, por excelncia, os que apoiaram a teoria
ali desenvolvida. Nesse sentido, aqui ser a sua descrio limitada quilo que
haja sido o especfico dessa Cidade.
Eles derivaram de cruzetas interpostas nos distribuidores componentes da
rede, nos pontos que coincidem com cruzamentos de ruas, de sorte que uma
dessas peas alimenta dois ramais condominiais e, eventualmente, quatro,
a depender da combinao de conexes. Desses pontos at as entradas
de quadra, j situadas nos passeios, onde se localizaram os registros
condominiais (e, desejavelmente, deveriam estar tambm os hidrmetros)
sucederam-se tubulaes e conexes capazes de garantir as interligaes
da rede bsica com as quadras 111, passando-se a chamar esse conjunto de
derivao. As figuras 108 e 109 so ilustraes, respectivamente, deste
componente derivao e, em maior detalhe, do ramal condominial e seus
controles, delas depreende-se a extrema facilidade com que as derivaes
comportam registros de parada e micromedidores, que fazem com que o
modelo condominial d mais esse passo nos controles que oferece a sistemas
de distribuio de gua.
Eles foram dimensionados semelhana dos procedimentos do gnero
utilizados nos edifcios verticais e a partir de informaes especficas a
316

110

H que se lembrar que tais condomnios


so entidades informais, formadas em torno
das necessidades comuns aos vizinhos
e relativas implementao de servios
de saneamento bsico segundo o modelo
condominial.

111

So peas de formato "Y", uma para cada


extremidade livre da cruzeta, acopladas
a sucessivas redues, que deslocam os
pontos de alimentao para as caladas, ao
tempo em que vo proporcionando a reduo
de suas profundidades at o alcance daquela
que seja considerada interessante.

Sistema Condominial

O sistema tarifrio adotado


Ele foi institudo mediante
decreto do Poder Executivo e
decorreu de estudo de viabilidade
HFRQ{PLFRQDQFHLUDGRVVLVWHPDV
condominiais de gua e de esgotos
da cidade. exceo do preo
social dos primeiros 10 m3 do
consumo residencial, veio a
apresentar algumas caractersticas
que o distinguiu daqueles vigentes
QR%UDVLO6mRHODVRSUHoR[R
mensal da ligao, proporcional
DRVFXVWRV[RVGDPHVPDDV
tarifas independentes dos dois
sistemas, ambas estabelecendo
os preos proporcionalmente
aos respectivos custos; o preo
unitrio invarivel dos demais
FRQVXPRVMXVWLFDGRHPUD]mRGH
ser decrescente o custo marginal
dos sistemas e de ser praticamente
inesgotvel o manancial utilizado;
e o faturamento correspondendo
respectiva medio do consumo.
Era o seguinte, poca, o sistema
adotado para o de gua: R$
OLJDomR YDORU[RLQFOXLRV
dois servios e independente
de consumo); R$ 0,27/m3
(consumidores residenciais, at
10 m3/ms); R$ 1,07/m3, para
todos os outros consumos
(residenciais acima daquele
limite, e consumidores de outras
categorias, qualquer consumo).
Curiosamente, ele permanece nos
nveis de preo da data de sua
inaugurao, em 1997, por deciso
da Municipalidade, a qual, com uma
elevada arrecadao decorrente da
extrao mineral em seu territrio,
prefere no arcar com o nus
(poltico) da atualizao tarifria.
Salvo nas ligaes no medidas,
infelizmente, onde as contas
mensais ainda so faturadas em
correspondncia a uma suposio
de 10 m3 de consumo.

cada caso, conquanto nada se deva opor, em princpio, a que fossem eles
superestimados em benefcio de uma certa padronizao; por exemplo, a
utilizao sistemtica do dimetro de 32 mm teria sido perfeitamente aceitvel.
A figura 110 e a tabela 3 que se seguem neste item exemplificam o projeto de
um desses ramais condominiais.
Foram localizados, via de regra, a uma distncia mdia de 1 metro do limite
frontal dos lotes, com profundidades da ordem de 0,40 m. A ligao de cada
lote foi realizada atravs de conexes padronizadas, introduzidas nos ramais
condominiais, nos pontos que sejam os mais convenientes em cada caso, da
resultando, portanto, a eliminao de furos de qualquer natureza, na rede
ou nos condominiais, conforme referncia j feita.
Quanto ao processo propriamente dito de sua implantao, atendeu-se
seguinte ordenao de passos:
t OBdevoluo pelo condomnio do termo de adeso, devidamente
assinado, era feita a entrega da lista do material hidrulico do seu
ramal, a qual decorria do respectivo dimensionamento (um seu
exemplar est na tabela 4);
t TFHVJBTF OBUVSBMNFOUF Bcompra dos materiais pelo condomnio,
informada pelo sndico, a que se seguia a sua conferncia, pela
consultora (esta etapa era naturalmente a mais demorada, sobretudo
nas reas mais pobres);
t DPNBcompra correta, o passo seguinte era a chamada marcao
do ramal, assim entendida a sua locao no passeio, incluindo a
posio das caixas de cada usurio, atividade que desencadeava a
escavao da vala nas dimenses pactuadas;
t vala concluda e aceita pela fiscalizao, seguia-se o assentamento
das instalaes hidrulicas por equipe de encanadores, ocasio em
que tambm se realizava o cadastramento comercial dos usurios;
t BMUJNBFUBQBEPQSPDFTTPFSBBTJNQMFT abertura do registro da
quadra, com a qual tinha incio o seu efetivo abastecimento sua
verdadeira inaugurao, condomnio a condomnio.
Bastante interessante nesse processo foi a constatao de que a ordem
do atendimento de cada quadra da Cidade foi ditada por fatores que no
estavam na administrao do programa, no campo institucional. Nessa
medida, fugiram das conhecidas prticas de fundo clientelista, quando os
decisores escolhem, segundo sua vontade, a quem e quando atender.
Neste caso, os fatos marcantes da ligao de cada quadra estiveram
com a prpria comunidade, na sua capacidade de organizar-se e de
autodeterminar-se: quando realizam a adeso, quando adquirem os
materiais, quando escavam suas valas.

317

O Sistema Condominial na distribuio de gua

Figura 108
A forma de atendimento dos condomnios e os seus controles
Fonte: Condominium/PMP

Figura 109
O Ramal Condominial e
os seus controles

318

Sistema Condominial

Figura 110
Desenho esquemtico de um projeto de
ramal condominial
Fonte: Condominium/VALE

Os instrumentos complementares
Conforme referncia anterior, a Vale foi perfeita na dotao dos servios de
saneamento de Parauapebas, pois indo alm dos sistemas fsicos, ensejou a
elaborao de todos os instrumentos formais que lhes dariam vida: tarifas,
marco regulatrio e sistema de gesto. Todos exaustivamente discutidos
com as lideranas sociais e polticas, aprovados na Cmara Municipal e
implementados, com a exceo do ltimo, onde o rgo criado para a
superviso e regulao dos servios hoje seu operador, contrariando
uma idia firmada poca de que estas tarefas no seriam interessantes
para a municipalidade. Com relao ao sistema tarifrio, merc de sua
singularidade, elaborou-se uma pequena nota a seu respeito, apresentada no
destaque do texto.

22.5 A OPERAO
Com o final do processo de implementao dos servios de saneamento
de Parauapebas pela Vale, em 1998, e sem que a Prefeitura assumisse uma
deciso sobre a forma definitiva de sua gesto, a operao deles foi realizada
pela Condominium, j sob contrato com esta ltima, dali at o ano de 2004.
319

O Sistema Condominial na distribuio de gua

Tabela 10
Planilhas de clculo de um
ramal condominial
Fonte: Condominium/VALE

320

Sistema Condominial

No incio da nova gesto institucional, em 2005, a Prefeitura optou pela


absoluta municipalizao dos servios, sob a responsabilidade do Servio de
gua e Esgotos de Parauapebas, SAEP, at ento supervisor dos trabalhos da
Condominium. desse perodo, portanto, que so as informaes e comentrios
apresentados neste captulo, quando o prprio autor dos cadernos era partcipe
dos trabalhos. As tabelas apresentadas a respeito so provenientes de relatrios
mensais de operao do servio, de autoria daquela empresa, e j foram usadas
em estudo de caso realizado sob os auspcios do Banco Mundial 112.
Deve preceder, contudo, este item, alguns elementos do contexto local
que influenciaram significativamente na operao dos servios, com os
dois mais importantes deles sendo pertinentes prpria municipalidade:
a sua inexperincia no setor do saneamento, mais ainda na questo do
gerenciamento; e os seus receios de natureza poltica com relao
cobrana das contas dos servios aos usurios, mais ainda diante da relativa
folga de recursos financeiros da administrao, na decorrncia dos royalties.
Isolados ou juntos esses fatores influenciaram, negativamente, pelo menos
dois aspectos do servio, quais sejam:
t BTVBBSSFDBEBP QPSFYFNQMP DPNPFUFSOPBEJBNFOUPEBDPCSBOB
dos esgotos, a no atualizao das tarifas do servio de gua, as
sempre difceis decises relativas ao combate da inadimplncia ou a
ausncia de uma assessoria jurdica em apoio cobrana;
t FBVUJMJ[BPEPQPUFODJBMEPNPEFMPDPOEPNJOJBMGBDFBPDPOUSPMF
de perdas, no que os fatos mais significativos foram a minimizao
dos micromedidores e o adiamento perene da macromedio que
seria to propcia.

A situao geral do servio

112
The Experience of Condominial Water and
Sewerage Systems in Brazil, Jos Carlos
Melo; acervo de BIRD, BNWP e WSP.
113

O abandono dessa fonte decorreu de um


perodo de seca, quando uma parte dos
poos secaram, aliado a uma campanha de
esclarecimento, no sentido de evidenciar
que era um engano a sua boa qualidade,
j que sua limpidez escondia, na realidade,
uma evidente contaminao por organismos
patognicos oriundos da multido de fossas
ainda existentes na Cidade.

Um panorama geral do desempenho do servio de abastecimento de gua


de Parauapebas pode ser preliminarmente obtido da tabela 12, que abrange
o perodo de 2000 a 2003. A partir dela so pertinentes alguns comentrios
relativos ao efetivo atendimento da populao, medio dos consumos e s
perdas. Antes, porm, convm lembrar que, mesmo diante do extraordinrio
crescimento demogrfico da cidade, a rea abastecvel pelo novo sistema
manteve-se estvel em todo o perodo analisado, com os seus 13.766 lotes.
De sorte que a maior parte dos excedentes de populao, da mesma poca,
ocuparam reas exteriores, inalcanveis pela rede, ao menos em condies
regulares.
Sobre o atendimento, portanto, h que se destacar os percentuais indicados
na tabela diziam respeito rea coberta pela rede bsica, sendo eles menores,
progressivamente menores, quando se considera o total da populao. O
contingente que embora dispondo de rede no buscou sua ligao nesse
perodo ofereceu como razo a sua opo pelo abastecimento atravs de
poos rasos residenciais nas reas onde era isso possvel recusando-se a
admitir que a sua gua, grtis e visivelmente atraente, era, contudo, fortemente
contaminada pelas fossas disseminadas pela cidade 113. E a populao mais
321

O Sistema Condominial na distribuio de gua

Tabela 11
Relao de material hidrulico de um
ramal condominial

322

Sistema Condominial

recente, do exterior da rea abastecvel, ou apelava para esse mesmo tipo de


poo ou, onde isso no era possvel, buscava clandestinamente o suprimento
a partir do sistema oficial, constituindo um procedimento inevitvel e
at certo ponto justo, mas realizado de formas as mais perniciosas para a
conservao das instalaes.
Quanto aos hidrmetros, a tabela um demonstrativo da sua insuficincia
durante todo o perodo quando - sem falar no envelhecimento de quase
todo lote instalado no incio da operao -, o percentual de ligaes medidas
foi praticamente decrescente desde os 77% do incio at cerca de 60% ao
final do perodo. Era notrio na municipalidade, a respeito dessa questo,
um generalizado sentimento avesso aos medidores e que se fundava em
duas lastimveis razes: a sua pouca importncia em face do investimento
correspondente e o potencial desagrado que causariam populao eleitora.
Os malefcios da decorrentes somente no foram mais graves graas
condio da medio condominial permitida pelo modelo, conforme est
exemplificada na tabela 6, o que to mais importante quanto menor a
disponibilidade de medidores, e maior, conseqentemente, o cuidado com
quem deve ser medido. Na referida tabela, por exemplo, foram selecionadas
quatro quadras dentre as medidas na entrada dos seus ramais condominiais,
cujas medies evidenciaram diferentes situaes:
t OBRVBESB POEFUPEPTPTVTVSJPTTPNFEJEPT os hidrmetros
apresentavam boa performance e no havia indcios de fraudes;
t OB QPSTFVUVSOP as poucas ligaes no medidas assim
poderiam permanecer, j que no se tinha a evidncia de maior
prejuzo;
t OB POEFBQFOBTNFUBEFEPTVTVSJPTFTUBWBNJDSPNFEJEP era
evidente a importncia de avanar-se com a medio individual;
t F OBMNFOUF OBRVBESB FNRVF no havia medidor
individual, era evidente a sua falta.
A mais importante das informaes da tabela aqui discutida a medio
das perdas, questo fundamental no Brasil, onde foi notria a sua correlao
com o ndice de micromedio: quanto maior este, menores aquelas. Neste
caso, recorda-se, no foi exatamente esta hidrometrao parcial o fator mais
importante na justificativa das perdas, que provinham, em grande parte, daquela
situao especial dos clandestinos exteriores rea coberta pela rede bsica, mas
que deviam ser vistos, a rigor, como inevitveis, porque, tendo a necessidade, no
dispunham da contrapartida do servio essencial. Realizavam seu atendimento
sem consentimento, sem nenhum critrio tcnico na ligao e sem qualquer
pagamento pelo servio, mas constituindo um procedimento fsico e moralmente
irremovvel. Somente pela via da expanso do servio e da correspondente
regularizao das ligaes, como se fez a partir do final do perodo analisado,
poderia ser solucionado. Sabe-se, a respeito, e infelizmente, que no isto uma
peculiaridade de Parauapebas, muito menos do seu sistema condominial.

323

O Sistema Condominial na distribuio de gua

Tabela 12
Valores indicativos da operao do Sistema
Parauapebas

A performance da rede e dos ramais condominiais


As ocorrncias nessas canalizaes eram meticulosamente registradas,
classificando-as conforme sua localizao rede bsica, ramais condominiais,
cavaletes do hidrmetro (inclusive este) e derivaes - estas ltimas sendo as
ligaes entre a rede e os ramais condominiais. Os registros totalizados nos
anos de 2002 e 2003 esto apresentados na tabela 14, em perodos em que
as extenses da rede bsica e dos ramais condominiais eram de 20.320 m e
133.000 m, respectivamente, ao passo que as ligaes nesses dois anos eram,
conforme a tabela 12 acima, 10.865, no primeiro ano, e 11.239, no segundo.
As operaes contabilizadas para o cavalete do hidrmetro, que extrapolam o
modelo do sistema e tm uma explicao especfica, devem ficar de fora dos
esclarecimentos seguintes.
Da referida tabela, pode-se depreender que as ocorrncias nas canalizaes
foram em nmeros bastante contidos. Eram, na realidade, nmeros mensais
to inexpressivos quanto de 2,7 a 3,4 ocorrncias nos ramais condominiais
para cada 1.000 metros deles, ou, no caso da rede bsica, de 1,4 a 1,6
por cada 1.000 metros de sua extenso, ou ainda, sendo 729 as quadras
atendidas, registravam-se problemas em 3 % a 6 % das derivaes existentes.
Uma outra informao interessante fornecida pelos registros da operao
do sistema de gua de Parauapebas e possivelmente sui generis - era o seu
ndice de Desabastecimento, definido no captulo 19 deste Caderno, que
apropriado a partir de informaes como as exemplificadas na tabela 15.
Nesse tipo de tabela se assinalava, no ms, cada fechamento de registro da
rede ou de ramal condominial, o respectivo tempo do fechamento e, alm
disso, o nmero de desabastecidos em cada caso. Assim, por exemplo, no
ms de dezembro de 1999, o ndice foi de 4,5 %, representando a idia de que
equivaleria isto ao desabastecimento de toda a populao da cidade por 32
324

Sistema Condominial

Tabela 13
Medies condominiais - alguns exemplos

horas, num ms. Este ndice, particularmente, foi explicado, na ocasio, no


respectivo relatrio mensal de operao, como sendo conseqncia das obras
de asfaltamento e drenagem da cidade, bastante intensas e que provocavam
grande nmero de quebras na rede de gua. Por ltimo, a esse ttulo, se
apresenta o grfico da figura 111 com a evoluo do ndice aqui considerado
num perodo de dois anos da operao do servio de gua de Parauapebas.

Outros esforos na operao do Sistema Parauapebas


Entendendo-se a problemtica das perdas nos sistemas de abastecimento de gua
como a questo fundamental neste setor, no Brasil, utilizou-se ao mximo, o
servio de Parauapebas, para aes e experimentaes que pudessem representar
contribuies a este tema. Contava-se, favoravelmente, com as facilidades
oferecidas pelas condies operacionais do sistema o que no implica
dizer-se que apenas este modelo se preste para os exerccios aqui relatados. E
desfavoravelmente, com os estreitos limites de recursos financeiros e humanos
para tudo aquilo que no fosse o estritamente fundamental ao funcionamento
do servio, com a insuficincia dos hidrmetros e a completa inexistncia de
macromedidores sendo os seus melhores exemplos nesse sentido.
As principais experimentaes dessa natureza foram as seguintes:
t modificao da metodologia de trabalho dos chamados leituristas
(leitura e entrega das contas): passando ao desempenho mais amplo e
em rea fixa, com reduo do nmero de visitas mensais e aumento de
procedimentos; eram os agentes comerciais, com obrigaes tambm
no esclarecimento dos consumos, atualizao, cadastral, cobrana de
inadimplentes e vistoria mais elementar da ligao e do hidrmetro; os
resultados foram satisfatrios e a metodologia foi mantida em todo o
325

O Sistema Condominial na distribuio de gua

perodo aqui analisado;


t o tratamento diferenciado do grupo dos grandes usurios, aqueles
em nmero relativamente pequeno, mas que perfaziam pelo menos
60% do consumo total medido;
t PVTPEFuma amostra aleatria mensal, equivalente a apenas 1%
do universo, dita amostra auditora, a qual tinha a finalidade de
detectar falhas ou improbidades de procedimentos sobre os usurios
(comparao entre o fato e a realidade no cadastro comercial);
t F QPSMUJNP BJOEBNBJTUJNJEBNFOUF a utilizao de uma amostra
representativa do universo, a qual, sendo administrada o mais
perfeitamente possvel, haveria de se constituir em paradigma para a
operao.

Breve informao sobre o estado atual da operao do


sistema
A partir de janeiro de 2005, instalou-se uma nova administrao municipal
em Parauapebas, emergente da eleio do ano anterior. Novo Prefeito, novo
gestor do SAEP, rgo responsvel pela gesto dos servios prestados pela
Condominium na operao do saneamento da Cidade. E esta empresa,
contrariando a prpria opinio do prefeito nos prembulos de sua gesto,
foi sumariamente afastada dos servios, juntamente com toda a sua equipe,
sob a alegao de estar com o seu contrato vencido. Afastada e impedida
326

Tabela 14
Ocorrncias no sistema condominial de
distribuio (valores mdios mensais)

Sistema Condominial

Tabela 15
Interrupo do abastecimento de gua exemplo indicativo

dos procedimentos universais de repassar os servios, mesmo que estes


comportassem uma nova tecnologia, que a nova gesto no dispusesse de
nenhum especialista ou sequer um engenheiro e que h trs meses passados
houvesse sido ampliado o sistema de distribuio da cidade e nessa ocasio
estivesse em sua fase de reequilbrio. Coisas, portanto, de mudanas de
governo...
Como no poderia deixar de acontecer, em apenas trs meses do novo
regime de operao o sistema de gua foi levado a uma situao de completo
desequilbrio hidrulico, com desatendimento de partes da cidade e
intermitncia no funcionamento de outras, alm da suspenso das medies
de consumo, faturamento e cobrana das contas.
Quatro anos depois, em 2008, o sistema de produo de gua da cidade
est ampliado em uma tera parte de sua capacidade, utilizando o mesmo
manancial, e o sistema de distribuio funciona em regime de intermitncia,
sendo a Cidade dividida em duas reas com suprimento alternado. Voltaram
as atividades comerciais numa forma pouco controlada e um engenheiro
passou a ser o responsvel tcnico pela operao. Este mesmo engenheiro,
indagado sobre a continuidade do sistema condominial na expanso da
cidade, informou ser isto uma deciso dos construtores das prximas
redes de distribuio. No se pode deixar de lamentar que o nico sistema
condominial de gua numa cidade brasileira, que mereceria, com certeza,
um acompanhamento primoroso, dadas as suas indiscutveis virtudes,
esteja atualmente administrado sob to escassos conhecimentos da prpria
tecnologia que o inspirou, a ponto de se transferir a terceiros (construtores)
a deciso sobre a metodologia das futuras ampliaes. Para que melhor se
situe esta questo, apresenta-se na caixa de texto adiante inserida, trechos do
relatrio entregue nova gesto poucos dias antes da posse do novo prefeito.

327

O Sistema Condominial na distribuio de gua

Figura 111
Variao do ndice de Desabastecimento no
perodo junho 2000 a maio 2002

328

Sistema Condominial

23. CONSIDERAES FINAIS


Salvo melhor juzo, o sistema condominial de abastecimento dgua, descrito,
explicado e exemplificado em duas situaes extremas, neste Caderno, traz
consigo - mais do que j haviam trazido os sistemas condominiais de esgotos
- algumas respostas que tm uma certa propenso a contriburem para o
equacionamento da complexa problemtica do abastecimento de gua em
pases como o Brasil.
Observando-se, por exemplo, a sua engenharia, e refletindo-se sobre ela
e as suas peculiaridades, no ser demais reiterar algumas importantes
vantagens suas relativamente ao modelo mais usual. So elas, por exemplo:
t a considervel reduo de cerca de 80% no valor do investimento,
o que decorre da menor extenso de canalizaes e, na mesma
proporo, de todos aqueles fatores que lhes esto associados:
escavaes e reaterros, quebra e reposio de pavimentos, remoo
de interferncias, escoramentos e esgotamentos de valas, etc; ou
seja, com maior qualidade que nos sistemas convencionais, com
mesmos recursos financeiros, seria possvel multiplicar por quatro o
atendimento;
t ainda numa mesma proporo, a reduo, tambm, dos prazos de
implantao das obras e da ocorrncia de transtornos, na mesma
ocasio, para o trnsito dos veculos e o deslocamento das pessoas;
t simplificao dos procedimentos de operao e manuteno
observados em diferentes ngulos dessa questo: menor nmero
de acidentes em face da menor extenso; reduo dos seus pontos
de derivao a cerca de 1/30 daqueles caractersticos dos modelos
convencionais 114; e nestas derivaes, alm do mais, eliminao dos
furos sempre crticos nas canalizaes para a montagem dos colares
de tomada que modelam as ligaes prediais, j que, aqui, so todas
elas realizadas atravs de conexes regulamentares;
t a possibilidade de interposio, montante dos pontos de
alimentao de cada quadra, de hidrmetro e de registro de parada
especficos do condomnio, com evidentes benefcios operacionais
(para controle das medies individuais e para facilidade de
manuteno com as canalizaes despressurizadas);
t FBeliminao das perfuraes nos distribuidores para consecuo
das ligaes, como ocorre nos sistemas convencionais, j que
a totalidade de suas interligaes ocorre atravs de conexes
padronizadas.
114

As derivaes, neste caso, so para as


quadras e no para cada um dos prdios
a abastecer, no que se tomou uma mdia
de 30 prdios/quadra para obteno desse
ndice redutor.

Numa outra perspectiva, ainda, o processo social ento desencadeado,


demonstrou, nos dois exemplos considerados, a insofismvel capacidade
da populao em contribuir para a soluo dos seus problemas, desde
que fiquem claras as regras desse jogo e que a sua contribuio se situe
329

O Sistema Condominial na distribuio de gua

Informaes crticas sobre o abastecimento de gua de Parauapebas


$&RQGRPLQLXPRSHURXLQWHJUDOPHQWHR6LVWHPDGH$EDVWHFLPHQWRGJXDHSDUFLDOPHQWHRGH(VJRWDPHQWR6DQLWiULR
apenas as estaes elevatrias e as lagoas de estabilizao.
(PWHUPRVRSHUDFLRQDLVD&RQGRPLQLXPUHDOL]RXDVVXDVIXQo}HVFRPXPDHTXLSHSUySULDUHPXQHUDGDSHODPXQLFLSDOLGDGH
Os insumos requeridos pela operao e manuteno dos sistemas so fornecidos pela municipalidade, mediante encomendas
devidamente antecipadas da operadora. As emergncias dos servios so enfrentadas atravs de uma verba mensal que
constitui limite de reembolso previamente autorizado; em casos especiais mais difceis, a municipalidade se vale de suas
prerrogativas para contrataes imediatas.
2PRGHORFRQGRPLQLDOHPSUHJDGRQRVVLVWHPDVItVLFRVORFDLVDSDUGHVXDVHFRQRPLDHIXQFLRQDOLGDGHRIHUHFHjUHGHGH
distribuio dgua, em particular, uma considervel condio de controle, importante no combate s perdas (de gua e de
faturamento) to freqentes em todo o Brasil, e at arraigadas de um ponto de vista cultural.
$GHVSHLWRGHVVHVLQVWUXPHQWRVHGDIDVHMiYLYHQFLDGDGHUHGX]LGDVSHUGDVGHiJXDRVLVWHPDKRMHMiDSUHVHQWDHVVHV
ndices em patamares bastante preocupantes, na decorrncia de circunstncias que no puderam ser evitadas at o presente
PRPHQWRDSHVDUGDHYLGrQFLDFRPTXHGHYHULDPVHUFRPEDWLGDV$VSULQFLSDLVVmRDVWUrVVHJXLQWHVL JUDQGHQ~PHURGH
casas dos bairros Caetanpolis, Nova Vida e Nova Liberdade, para os quais no foi expandida a rede, e que esto sendo
DEDVWHFLGRVKRMHGHIRUPDFODQGHVWLQDLQMXVWDPHQWHHFRPHOHYDGRVGHVSHUGtFLRVLL LUULVyULDSUHVHQoDGHKLGU{PHWURVQR
sistema, quando para as 14.856 ligaes cadastradas e suas respectivas 715 quadras, apenas esto disponveis 8.990 desses
equipamentos, o equivalente, portanto, a 60% da necessidade; iii) forte contingente de usurios fraudadores, cerca de 2.600,
devedores do sistema e formalmente marginalizados do mesmo, mas que dele continuam abastecidos, clandestinamente, falta
de providncias jurdico-legais, administrativas e at mesmo policiais que extrapolam a ao da operadora e ainda no foram
viabilizadas na cidade.
$DPSOLDomRLQWHPSHVWLYDGDUHGHGHGLVWULEXLomRDRVEDLUURVGHH[SDQVmRPDLVUHFHQWHGD&LGDGHDQWHVTXHVHDWDFDVVH
as questes acima, tem a evidente tendncia de agravar o problema acima comentado, da porque no conseguir ter um
atendimento contnuo, 24 horas por dia, mas apenas um suprimento paliativo, algumas horas durante o dia. Esta expanso,
alis, que amplia em cerca de 3.800 ligaes o atendimento atual, tambm traz consigo a necessidade de uma reacomodao
na operao do sistema, na sua equipe e nas suas prprias instalaes de atendimento, que agora reclama um novo ponto de
ateno aos usurios.
1XPDRXWUDRUGHPDVTXHVW}HVDPHUHFHUHPDWHQomRHVSHFLDOHLPHGLDWDVmRSHORPHQRVDVVHJXLQWHVL FRQVHUYDomRGRV
valores tarifrios relativos ao servio de abastecimento dgua nos mesmos nveis de preo da data de sua inaugurao. ii)
inaplicao de cobrana, at o presente momento, para os servios do esgotamento sanitrio.
'HFLVmRLPHGLDWDSHODSURUURJDomRGDDWXDOFRQGLomRGHJHVWmRGRVVHUYLoRVHGDFRUUHVSRQGHQWHUHODomRHQWUHDSUHIHLWXUDHD
&RQGRPLQLXPSHORSUD]RPtQLPRGHGLDVFRPRIRUPDGHJDUDQWLUVHRX[RGHGHFLV}HVDo}HVHLQVXPRVHQTXDQWRDQRYD
gesto apercebe-se da situao, a ponto de adotar outra orientao.
Nesse mesmo perodo, contudo, poderiam ser assumidas as providncias que se apresentam como francamente bvias: i)
elaborao de proposies alternativas quanto correo da questo tarifria. ii) planejamento da expanso do sistema de
distribuio aos bairros que esto hoje clandestinamente atendidos; iii) aquisio dos hidrmetros necessrios regularizao
GDDWXDOVLWXDomRLY UHDOL]DomRGHHVWXGRSRUHTXLSHSUySULDGDSUHIHLWXUDRXHVSHFLDOPHQWHFRQWUDWDGDFRPDQDOLGDGHGH
equacionar as medidas cabveis para eliminao das fraudes no sistema de gua.

330

Sistema Condominial

nos limites de suas potencialidades. Mais de meio milho de pessoas nas


favelas do Rio de Janeiro, sob as condies mais delicadas de vrios pontos
de vista, foram capazes de abrirem suas residncias para levantamentos
e obras nas suas dependncias, em seguida a um exemplar processo
participativo em suas unidades de vizinhana, com a mais perfeita ordem e
empenho que se possa imaginar. Em Parauapebas, por sua vez, uma cidade
sem qualquer tradio comunitria em funo de suas prprias origens,
60.000 pessoas naquela ocasio, organizadas em 700 condomnios, cada um
deles com o seu representante, foram capazes de construir todos os seus
ramais condominiais de abastecimento dgua, fato que ainda mais reduziu
os j to reduzidos investimentos demandados para a implantao do
sistema de distribuio da gua.
Quanto aos possveis inconvenientes que se poderiam levantar sobre os
ramais condominiais, ficariam eles por conta, possivelmente, de duas
exigncias que trazem consigo, mas que so francamente inexpressivas: a de
continuidade na sua extenso, independentemente da situao de ocupao
dos vrios lotes da quadra, pelo quanto isto poderia levar antecipao
da implantao dos trechos correspondentes a lotes vazios; e depois, a da
eventual necessidade de seu reforo em presena de mudanas na ocupao
(e na demanda) inicialmente prevista, quando a exigncia seria por nova(s)
interveno(es) nos passeios.
Por ltimo, restringindo as consideraes aos dois empreendimentos
analisados e que so, praticamente, os nicos do gnero, no Brasil, o que
se ressalta como mais importante neste momento a desconsiderao, na
operao e manuteno deles, do seu carter de novidade, de descoberta,
de criao tecnolgica, e que por isso mesmo estaria a depender de um
certo esforo de natureza acadmica, capaz de assegurar-lhe os meios
para a maior explorao de suas potencialidades, para o seu indispensvel
monitoramento e para o alcance do aperfeioamento de que sempre carecem
os empreendimentos pioneiros. A esse respeito, ento, e para que no se fique
nas generalidades, devem ser arrolados os seguintes pontos como sendo os
principais quanto aos cuidados aqui reclamados:
t em primeiro lugar, claramente, um sistema de monitoramento
com uma conveniente participao externa sua gesto especfica;
t uma aliana estratgica, formal, de um agente de desenvolvimento
oficial com os seus prestadores de servio, capaz de transferir
aos sistemas certa condio de laboratrio, no apenas para o
desencadeamento do aludido processo de potencializao dos meios
oferecidos pela nova tecnologia, mas tambm como reforo aos
prestadores, no sentido de que melhor exercitem a sua atuao;
t F FTQFDJDBNFOUF TPCSFBFYQMPSBPEFQPUFODJBMJEBEFTa
universalizao das medies condominiais; a hidrometrao
tima, individualizada, decorrente da condio anterior; a
implantao da sui generis macromedio; os recursos necessrios
implementao dos embrionrios sistemas de controle atravs de
amostras do universo, etc.
331

Sistema Condominial

24. INTRODUO AO CADERNO 5


Neste Caderno 5, esto contempladas, na forma mais objetiva e direta,
questes que, ou no foram abordadas nos cadernos anteriores, ou o foram
dentro de um contexto que pode t-las deixado menos explcitas ou, ainda,
tenham sido apresentadas sob um enfoque diferente do agora adotado.
Dessa forma, ele rene temas que certamente so os mais interessantes e,
possivelmente, mais crticos sobre o saneamento, de um modo geral, ou
sobre o prprio sistema condominial. Eles, aqui, estaro sempre abordados
de forma mais especfica: num esforo de maior profundidade, quando se
trata do modelo condominial, e numa forma mais simples, a sentimento,
quase, quando se trata do mais geral.
Por exemplo, no captulo 25 se volta ao problema das perdas nos servios
de gua, no mais para a identificao de fatores que possam favorecer o seu
controle nos condominiais de gua, como se viu no Caderno 4, mas para
focalizar a sua importncia como extraordinrio consumidor dos recursos
financeiros do saneamento, inclusive dos sistemas condominiais. Ou no
captulo 26, quando se trata de perguntas clssicas sobre esses sistemas, se
d uma resposta muito incisiva questo Sendo to bom e barato, por que
ainda no se espalhou?, quando, na realidade, essa resposta est diluda em
praticamente todos os Cadernos, sobretudo nos de nmeros 3 e 4.
Nesse intuito, est o Caderno 5 organizado em cinco captulos alm dessa
introduo, que se compem como agora se indica. Antes, porm, ainda
uma informao curiosa: a sua leitura pode ser realizada sem qualquer
ateno ordem com que esto dispostos os temas, j que cada pargrafo,
quase, tem a sua individualidade. Nessa medida, pode-se ir direto apenas
ao que interessar, da mesma forma que se poder fazer as prprias respostas
s perguntas formuladas para testar os seus conhecimentos em face das
explicaes oferecidas com base na experimentao.
O captulo 25 dedicado s principais questes que, na viso do autor,
constituem, hoje, os grandes entraves do saneamento nacional e que, de
uma forma ou de outra, afetam o sistema condominial. A sua abordagem
oportuna no apenas pela interferncia que exercem no setor, mas tambm
porque a forma como esto expostas no deixa de ser partes de um iderio
que, com certeza, influenciou o desenvolvimento do modelo condominial.
Em nenhuma delas se teve a preocupao de chegar-se s razes, pela falta de
espao e tambm de maiores informaes, mas, em compensao, esto todas
elas postas conforme o sentimento de grande parte dos que vivenciam o setor.
No captulo 26 a vez de se responder em detalhes s dez perguntas
que mais acompanharam e ainda acompanham os debates sobre o novo

333

O Sistema Condominial e seus porqus

modelo, onde algumas, por certo, so maldosas ou capciosas, e nesse sentido


no tm contribudo para a expanso do sistema. Felizmente, cr-se que
todas elas esto devidamente respondidas, indubitavelmente esclarecidas.
No captulo 27 faz- se um novo exerccio sobre a teoria e as idias que
sustentam o modelo condominial, para uma incurso sobre o futuro,
aventando-se alguns outros campos de aplicao potencial do sistema
condominial, do qual a distribuio de gua, j exercitada e que foi objeto do
Caderno 4, constituiu o primeiro deles, alm do esgotamento sanitrio.
Na seqncia, no captulo 28, se procura suprir uma lacuna que
acompanhou todo o desenvolvimento do sistema condominial, exceo de
algumas pesquisas patrocinadas, a seu respeito, pelo antigo Banco Nacional
da Habitacional. Trata-se de algumas sugestes aos governos que so
capazes de impulsionar os conhecimentos e a conseqente difuso do
modelo condominial no Brasil, atravs de medidas nesse mbito e que
privilegiem a sua utilizao. A sua inspirao o Distrito Federal, com seu
milho de habitantes atendido pelo sistema condominial e que caminha
para a universalizao, utilizando investimentos que foram inferiores, por
certo, metade daqueles requeridos pelos modelos tradicionais, em prazos
seguramente menores dada a natureza de suas obras e com uma esplndida
participao comunitria.
Para finalizar o Caderno, o seu captulo 29 atende a questes que foram
postas durante as mesas de discusso realizadas pelo PMSS e Banco Mundial
e que, pela sua especificidade, no esto dentre aquelas que foram chamadas
de clssicas no captulo 25; pela formulao da maior parte das indagaes
aqui contidas, agradece-se, em particular, ao engenheiro Miguel Ramirez, do
BIRD.

334

Sistema Condominial

25. AS DEZ MAIORES QUESTES


PRESENTES NO SANEAMENTO
BRASILEIRO
(e que, por tabela, terminam afetando o Sistema
Condominial)
O Sistema Condominial, como se viu, no uma nova proposta meramente
tecnolgica para o abastecimento de gua e o esgotamento sanitrio de pases
como o Brasil, fortemente devedores do bom atendimento da populao
por esses servios. Ele, efetivamente, pode ser utilizado apenas pela sua
tecnologia, como hoje praticado em vrias cidades, tirando-se partido do
seu menor custo e, de um modo geral, da sua racionalidade. Mas, na sua
forma mais inteira, ele coloca a populao como agente efetivo da sua
incluso, num pas, como o Brasil, onde a questo do saneamento ainda
diferencia setores sociais de uma forma bastante injusta e que por isso
mesmo deve ser visto como um grave problema social.
Da porque, nesse captulo so discutidos alguns temas que, na viso do
autor, fazem parte das questes polticas e tambm culturais que daquela
forma situam o saneamento e, como j se disse, influenciaram a concepo
e o desenvolvimento do novo modelo, voltado para a universalizao do
atendimento segundo concepes que se adqem realidade brasileira: suas
cidades, seu meio ambiente e sua populao.
Nenhum dos assuntos aqui considerados ser totalmente uma novidade para
quem leu os Cadernos anteriores, onde, em formas diversas todos eles foram
abordados. Desta feita, porm, eles voltam tona separadamente, e podem
ser um pouco mais aprofundados naquilo que interferem com a expanso do
atendimento da populao por servios de saneamento, dentre os quais os
condominiais.
As questes selecionadas so em nmero de dez, no esto ordenadas
segundo sua importncia at porque seria isso difcil de realizar e
tambm, repete-se, esto abordadas com simplicidade - sem nenhum rigor
cientfico e com muito sentimento pessoal. o que vem a seguir.

25.1 AS PERDAS NOS SISTEMAS DE GUA


Dentre os vrios problemas presentes no sistema institucional do saneamento
brasileiro, o maior deles mais visvel, mais prejudicial, mais estrutural
o relativo s perdas, de todas as ordens, que ocorrem nos sistemas de
abastecimento de gua, e que se situam num patamar maior que 50%, segundo
todas as informaes. Ou seja, metade da gua produzida no Brasil para
fins de suprimento das cidades no se transforma em receita para quem
a produz. Na quase totalidade das cidades, esse ndice sequer consegue ser
medido.

335

O Sistema Condominial e seus porqus

Na perspectiva em que se insere este caderno a respeito desta questo, o


interesse no o de perscrutar as suas causas e indicar os procedimentos
que conduzam a uma soluo, o que, alis, de h muito se vem investigando,
mas ainda sem obter-se resultados objetivos e, sobretudo, massificados.
Assim, o que aqui interessa sobre o assunto um pouco das conseqncias
que tamanhas perdas determinam para o saneamento como um todo,
particularmente onde afetam o esgotamento sanitrio, e por conseqncia
o modelo condominial, uma de suas formas. Subsidiariamente, imaginase reforar o quanto o mesmo sistema condominial poderia contribuir,
com as suas tcnicas, para o enfrentamento do grave problema, conforme
estudado no Caderno 4, que tratou do sistema condominial nas distribuio
de gua.
No rol dos prejuzos, por exemplo, duas constataes so fundamentais. Uma
que eles ocorrem em cadeia e, s vezes, em cascata, sempre requerendo
vultosos investimentos (com os recursos sempre escassos no setor do
saneamento), e sempre aumentando, bastante, custos operacionais e tarifas.
No primeiro caso, quando os recursos esto indisponveis, podem afastar
os servios do usurio, pela falta da oferta; no segundo, agem de forma
contrria, contribuindo para afastar os usurios do servio, pela elevao que
provocam nas tarifas.
A outra constatao a da forte presena, nas cidades brasileiras, do recurso
ao rodzio na distribuio de gua, onde a insuficincia do produto
obriga a diviso da cidade em setores que se revezam no abastecimento,
da decorrendo duas situaes das mais lastimveis, uma delas mais
especificamente pelo lado econmico, outra pelo social, ambas alimentando
aquela cascata acima referida e criando um verdadeiro ciclo vicioso.
Pelo lado econmico, o que acontece que o rodzio jamais visto, e
reconhecido, como uma conseqncia das perdas (e que deveria ser tratado
sob este prisma), mas, ao contrrio, ele assumido pelo lado contrrio, o da
insuficincia na produo de gua. Da, a busca por novos investimentos,
para a explorao de uma nova fonte de suprimento, contexto que o de
todas as cidades em rodzio, isto implicando dizer-se que so quase todas
as cidades brasileiras. De antemo, cada um desses prximos metros cbicos
captados e tratados representar um investimento e um custo operacional
direto em dobro, j que apenas a sua metade ter sobrevida nos ativos
do servio, sem falar-se que o seu custo especfico sempre crescente na
sucesso dos mananciais explorados a conhecida assertiva de que o
prximo manancial sempre mais caro que o anterior.
Pelo lado social, por sua vez, onde quer que se faa o rodzio, ele ocorre,
invariavelmente, segundo uma lgica perversa, trazendo uma classificao
social pela disponibilidade de gua que acompanha perfeitamente a
disponibilidade de renda: parcelas com muita gua, parcelas com pouca
gua, parcelas mngua de gua. Uma questo que nos pases desenvolvidos
se passa como sendo algo exclusivamente institucional (disponibilidade de
gua encanada conforme as necessidades de cada um), ainda se constitui, no
Brasil, num doloroso problema social.
336

Sistema Condominial

Quanto contribuio do modelo condominial para a reduo das perdas


dos sistemas de abastecimento de gua, ela se d, como j visto, atravs de
pelo menos trs de suas caractersticas tecnolgicas, todas elas amplamente
favorecedoras do controle sobre as redes distribuidoras, quais sejam: a
reduo de 80% das canalizaes das redes de distribuio, a supresso
de quaisquer furos nessas redes para consecuo das ligaes prediais e a
inexcedvel condio oferecida s medies e aos setoriais e condominiais.
Mas essas contribuies, deve-se reconhecer, sero limitadas, no Brasil, dado
que praticamente todas as suas cidades esto, j, com redes convencionais de
distribuio de gua, restando apenas, portanto, para este novo modelo, as
ampliaes ou reposies de redes.

25.2 A INEVITVEL PRIORIDADE DO


ABASTECIMENTO DE GUA
Nas cidades, dificilmente a populao tem outra forma de abastecimento de
gua que no seja a que lhe oferece o servio institucional; mesmo que no
haja a ligao regular, alguma forma encontrada, pelos desatendidos, de
alcanar alguma frao dessa gua oficial. Com efeito, outra fonte, ou no
oferece acesso para sua captao, ou, nos casos de ocorrncia de aqferos
rasos mais fceis de captar, suas guas esto sempre contaminadas por
esgotos, falta da sua regular coleta. Com relao a esse servio de coleta
de esgotos, por seu turno, por precrio que seja, sempre h um servio
capaz de afast-lo do contato imediato das pessoas, ou de escond-lo,
conforme largamente referido nos Cadernos anteriores.
Assim, pois, os sistemas de abastecimento de gua sero sempre prioritrios
em relao aos sistemas de esgotamento sanitrio, o que se constitui em
problema para estes ltimos, na disputa pelos mesmos recursos financeiros
para investimentos e pelas mesmas energias dos prestadores de servio que
tm as duas obrigaes. Em qualquer poca, qualquer circunstncia, a
prioridade sempre ser do abastecimento de gua.
No Brasil de hoje, onde as perdas esto em nveis to elevados e as cidades
esto sempre em busca de investimentos para prximos mananciais, como
visto acima, inevitvel que o esgotamento sanitrio seja dessa forma
penalizado. E uma questo como essa, evidentemente, somente se ir
resolver, em definitivo, com o enfrentamento satisfatrio daquele problema.

25.3 CONSEQNCIAS AMBIENTAIS E SOCIAIS


DOS DFICITS DOS SERVIOS DE ESGOTOS
Numa linguagem bem simples, pode ser dito que os esgotos so formados
de gua, matria orgnica e micrbios. Os dois primeiros constituindo uma
significativa energia potencial em face ao sistema produtivo, e os ltimos,
uma grande ameaa sade da populao. Quando bem processados,
eles so exclusivamente aquela boa energia: timo, se utilizados na
produo; ou razovel, se simplesmente so devolvidos natureza. Em caso
337

O Sistema Condominial e seus porqus

contrrio, ou seja, in natura ou insuficientemente tratados, so agentes da


poluio ambiental e, incorporados aos corpos dgua, ampliam seu poder
disseminador de doenas.
No Brasil, como visto no Caderno 1, so poucas as cidades que coletam e
tratam devidamente seus esgotos. Na sua grande maioria esto presentes,
nelas, aqueles sistemas unitrios que afastam os esgotos das casas e
das ruas e mais depressa os levam aos corpos dgua. As conseqncias
inevitveis e lastimveis! so todas as formas de poluio do ambiente,
particularmente das guas e, em conseqncia, de agresso sade e ao bem
estar da populao.
No preciso um monitoramento apropriado ou informaes quantitativas
mais precisas sobre o desatendimento por sistemas regulares de esgotamento
sanitrio, para que se observe e se sinta apenas com os sentidos, o estado
de canais, rios, mangues e, no raro, praias, pelas cidades do Pas afora, nos
mais diversos nveis de poluio ambiental, muitas vezes a mais completa
degradao. No ser exagero dizer-se, inclusive, que os rios marcadamente
urbanos deste Pas esto nesta deplorvel condio.
Esta questo ambiental, portanto, a qual se associa a ameaa permanente
sade pblica, se constitui no maior apelo, do ponto de vista tcnico, por
sistemas de esgotamento sanitrio no Pas, o que no implica dizer-se que,
no plano poltico-institucional, esteja ela criando, j agora, uma perspectiva
de soluo.

25.4 A QUESTO POLTICA NO SANEAMENTO


J se disse anteriormente, at mesmo neste Caderno, que os pases
desenvolvidos de h muito resolveram os seus problemas de distribuio
de gua e de coleta de esgotos, levando essas questes para um plano
meramente institucional, j que o atendimento pleno da populao se
colocou, desde sempre, como algo indiscutvel. Nesse contexto, a regular
urbanizao de suas cidades, o suficiente nvel de renda da populao e a
disponibilidade de recursos para investimentos foram fatores que sempre
se fizeram extremamente favorveis ao atendimento pleno e regular da
populao, mesmo que utilizando tecnologias menos econmicas como so
os casos dos sistemas ditos convencionais. Os avanos tecnolgicos no setor
estiveram efetivamente presentes, mas sempre ditados pelo desenvolvimento
industrial (melhores equipamentos, melhores materiais, melhores processos
construtivos e operacionais) e pelas crescentes exigncias ambientais (melhor
qualidade da gua de abastecimento, melhor qualidade dos efluentes dos
servios de esgotos). Nessas condies, portanto, repete-se: todos tm
atendidas as suas necessidades, pagam o que lhes sejam cobrado e as questes
do abastecimento de gua e do esgotamento sanitrio esto num mbito
meramente institucional, onde qualquer problema que afete o cidado tem
soluo automtica, a partir de um simples telefonema.
No Brasil, ao contrrio, quase nunca a populao pode estar inteiramente
atendida. No abastecimento de gua, por conta das perdas ou da
338

Sistema Condominial

impossibilidade de investimentos, ou de ambos; no esgotamento sanitrio,


pela indisponibilidade de recursos, quase sempre a presente (aquela
irrecusvel prioridade para os sistemas de gua). Esta circunstncia, ento,
sempre leva os prestadores do servio, em cada instante, a uma escolha
sobre quem ter os servios e quem no os ter, o que configura uma
questo de ordem poltica, e cuja deciso , invariavelmente, pelos mais
ricos. dessa forma que o atendimento por abastecimento de gua, e ainda
mais pelo esgotamento sanitrio, se realiza numa forma praticamente
proporcional ao nvel de renda do cidado. Neste patamar de resoluo, o
saneamento bsico das cidades jamais se fez de forma minimamente justa, o
que leva a poder-se observar, tambm por este ngulo, o estrangulamento do
setor, no Pas.

25.5 AS CRNICAS DEFICINCIAS


OPERACIONAIS
O sistema institucional do saneamento brasileiro desenvolveu, historicamente,
uma hierarquia - de carter, sobretudo, cultural em relao s suas aptides
e gostos no setor, a qual pode ser encontrada, com certeza, no seio de cada
organizao, e deve ser representada na seguinte ordem:
t FNQSJNFJSPMVHBSPHPTUP FBUNFTNPPDVMUP QFMBPCSB UBOUPNBJPS 
melhor: as estaes de tratamento de gua ou de esgotos, as grandes
adutoras, grandes elevatrias, etc;
t FNTFHVJEB BPQFSBPEPTTJTUFNBTEFQSPEVP POEFOBTHSBOEFT
cidades se encontram, facilmente, servios verdadeiramente primorosos;
t OVNUFSDFJSPMVHBSKCBTUBOUFDSUJDPTFTUPPTTJTUFNBTEFEJTUSJCVJP
de gua, que carregam consigo aquela catastrfica perda que, como j
visto, chega, em mdia, metade da gua captada;
t TFHVFTFBPQFSBPEPTTJTUFNBTEFFTHPUBNFOUPTBOJUSJP DPN
muitas lacunas no atendimento, decorrentes da presena dos sistemas
unitrios que lhes antecederam, e com uma forte participao das guas
de chuva a perturbarem o seu funcionamento durante as enxurradas;
muitas vezes, ter ou no ter sistema so opes muito prximas quanto
aos resultados, principalmente na observao dos corpos dgua locais;
t F OBMNFOUF numa ltima posio, os sistemas de gua e de
esgotos, que estejam em reas sub urbanizadas, principalmente,
em favelas; nos morros, a fora da gravidade ajuda os sistemas de
esgotamento, que ganham dos de gua; na plancie, inverte-se essa
condio.
Esse quadro aponta para uma situao de grande injustia, na medida em que
penaliza com piores servios de gua e de esgotos a metade da populao que
j privada de tantas outras coisas, dentre as quais a precria condio urbana.
Particularmente para os sistemas condominiais, quase os nicos presentes nessas
reas crticas, o cenrio em que se tem colocado a sua operao dos mais
precrios em quase todas as situaes existentes.
339

O Sistema Condominial e seus porqus

25.6 A PROBLEMTICA TARIFRIA

A participao da mobilizao
social nas tarifas

Os sistemas tarifrios praticados na maioria dos servios de saneamento das


cidades brasileiras foram estabelecidos sob a influncia do Plano Nacional
de Saneamento - PLANASA, no incio dos anos setenta. Eles tm suas
estruturas conservadas at hoje e, periodicamente, so reajustados quase
sempre alm dos ndices inflacionrios. Os custos a que deveriam atender
nunca so explicitados, da mesma forma que potenciais rendimentos no
esto comprometidos com objetivos conhecidos. Esto menos inseridos
nesse contexto as concessionrias de estados e cidades economicamente mais
desenvolvidos, onde o nvel de renda dos usurios estimulador de maiores
consumos e maiores faturamentos, alm de redutor da inadimplncia e,
principalmente, exigente de melhor qualidade no atendimento.

Certamente pelo inusitado da


participao comunitria em
empreendimentos de engenharia,
no raro o questionamento sobre
o seu custo, e o quanto ele afetaria
(ou deveria afetar) as tarifas; e at
mesmo, sendo ele eventualmente
elevado, o quanto poderia reduzir as
vantagens econmicas oferecidas
pelo modelo condominial.
A respeito do assunto, um reparo
deve ser feito de imediato: o objetivo
a ser cumprido pela mobilizao
comunitria, segundo o modelo
condominial, o de conquista da
adeso do usurio s regras que
esto estabelecidas pelo servio,
cujo custo, onde foi apropriado,
revelou-se to pequeno quanto,
por exemplo, em Braslia ou em
Salvador, justamente onde foram
grandes esses esforos. Outras
metodologias em curso a respeito
da questo, como o caso da
recomendada pela Caixa Econmica
Federal, no Brasil, pretendem
ir muito alm daquele objetivo,
j que se destinam educao
ambiental e ao desenvolvimento
social, e por isso mesmo no devem
ter seus custos atribudos a um
sistema de esgotamento, j que
se destinam a enfrentar questes
acima das necessidades desse
sistema e que so demandas
das prprias comunidades. Elas,
inclusive, transmitem a sensao
de muita informao em pouco
tempo, de tal forma que, se
efetivamente necessrias, deveriam
ser transferidas para o dia-a-dia,
devagar e sempre, ao estilo
do que j bastante praticado
no Sistema de Sade, no seu
programa de agentes comunitrios
que por sinal prestaria grande
servio ao saneamento caso
pudesse, mediante um adequado
entendimento, estender suas aes
tambm para esse campo.

Alm da sobrecarga das perdas no valor desses sistemas tarifrios, algumas


de suas caractersticas que esto generalizadas pelo Pas afora no esto
comprometidas, decididamente, com os melhores propsitos do amplo
atendimento, conforme as consideraes que se seguem.
A primeira dessas caractersticas comum s empresas estaduais de
saneamento, e consiste na adoo de sistema tarifrio nico para todos os
servios do Estado, com a inteno de transferir o que seriam economias de
escala nos grandes servios e nos grandes usurios, para os servios menos
rentveis e os pequenos consumidores. A j referida proporcionalidade entre
nvel de renda e qualidade dos servios prestados, que sacrifica, flagrantemente,
as populaes das pequenas cidades e das grandes periferias urbanas com
a intermitncia e a precria assistncia, uma demonstrao evidente do
quanto no se realiza aquela declarada transferncia. Ao contrrio, a proposta
termina funcionando como mais um fator de concentrao de renda. Outra
conseqncia negativa da medida a estimulao, por igual, aos consumos,
quando os custos da produo da gua so bastante diferentes de localidade
para localidade. A medida, dessa forma, uma negao gritante do princpio
universal de preos proporcionais a custos, sem prejuzo de subsdios que
assegurem direitos legtimos aos mais pobres.
A outra caracterstica que termina penalizando os mais pobres decorrente
da incompleta e muitas vezes precria medio dos consumos que, em tese,
so determinantes dos faturamentos. Na falha ou na falta da correta medio
nos sistemas de gua, as tarifas vo passando a depender cada vez mais dos
consumos avaliados, aos quais corresponde, invariavelmente, uma tarifa
mnima, fixa, que tambm tende a ir alcanando valores cada vez maiores.
Existem empresas em que o faturamento fortemente dependente dessa faixa
de menores consumidores, onde uma sua parcela, no chegando a consumir
o mnimo e pagando a tarifa fixa, est na realidade submetida a um preo
bastante mais elevado. Novamente, portanto, tambm se est diante de uma
outra forma de concentrao de renda, pela via das tarifas do saneamento e
na faixa de consumo onde ela seriam subsidiadas 115.
Uma ltima caracterstica relevante e prejudicial, mais uma vez, aos menores
consumidores tambm atravs da concentrao de renda que proporciona
diz respeito forma de apropriao dos investimentos que so levados s
340

115

Histogramas de consumo demonstram


que mais da metade dos usurios dessa
tarifa mnima (quase sempre 10 m3/ms)
consomem menos da metade do consumo
atribudo, de sorte que terminam pagando o
dobro, ou mais, pelo seu consumo efetivo.

Sistema Condominial

tarifas. que toda a produo de gua considerada conjuntamente, o que


termina levando todos os usurios a esse pagamento integral, quando os
menores consumidores aqueles com consumos na primeira faixa que
perfazem cerca de metade do total nas grandes cidades, terminam pagando
todas as captaes, quando, reunidos, teriam determinado, apenas, a primeira
e mais econmica delas. Ou seja, se todos os usurios consumissem na
primeira faixa dos consumos, a cidade em questo no teria a necessidade de
outro manancial alm desse primeiro.
Em qualquer sistema de gua ou de esgotos, portanto, a prevalecerem
tarifas com tais caractersticas, sero elas obstculos reais aos mais
pobres, tornando-se ainda maiores e mais injustos - quando se tratar
de sistemas condominiais, muito mais econmicos que os convencionais,
caso esta economia no for devidamente considerada. Especificamente
sobre esses sistemas e suas tarifas, alis, deve ser dito que em nenhuma das
suas aplicaes, no Brasil, tiveram eles os seus preos calculados de uma
forma objetiva e correta, especfica a cada caso. Ao contrrio, foram sempre
admitidos como um percentual do valor da conta de gua e, embora sempre
menor que o correspondente aos sistemas convencionais, ainda assim jamais
alcanaram o que seriam os valores justos em funo da diferena de custos.

25.7 O DESCONHECIDO MUNDO DA FAVELA


Os assentamentos sub urbanizados e as favelas das cidades brasileiras, que j
alcanam, talvez, a metade da sua populao urbana, continuam recebendo,
com raras excees, um injusto atendimento por parte dos prestadores de
servio de saneamento. Em todos eles est instalado, como j se disse, um
verdadeiro ciclo vicioso no abastecimento de gua, e que se realimenta em
cadeia pela irregularidade do servio, a inadimplncia no pagamento das
contas e a agresso s instalaes pblicas, com resultados indesejveis
para todos os lados: aos custos, faturamento e arrecadao, pelo lado das
empresas; e insatisfao e prejuzo sade e ao bem-estar, pelo lado da
populao.
A despeito desse quadro, uma verdade inconteste que tm sido
crescentes os fatores favorveis dotao dos servios nessas reas, a saber:
simultaneamente, os investimentos pblicos na dotao dos sistemas fsicos,
os esforos de uma maior adequao tecnolgica desses investimentos e o
poder poltico, de presso, das populaes, em prol dos seus servios. Por
outro lado, tm faltado, quase que sistematicamente, os procedimentos
de operao, manuteno e comercializao que so fundamentais para
que os servios sejam eficientes e permanentes. A situao parece, enfim,
se estabilizar na base do mnimo de ambas as partes: mnimo de
regularidade do servio populao, e mnimo de pagamentos por ela.
No se pode deixar de reconhecer, pelo lado dos prestadores dos servios,
que as suas dificuldades em face da questo - e que chegam a constituir um
verdadeiro impasse - tm, pelo menos, trs diferentes faces, quais sejam:
341

O Sistema Condominial e seus porqus

tQFMPMBEPTPDJBM PQPVDPEPNOJPEPTSFDVSTPTUDOJDPTDPNQBUWFJT
com os requisitos altamente especficos e especiais caractersticos de
tais reas, sobretudo considerando a violncia nelas presente;
t QFMPMBEPQPMUJDP BQPVDBWPOUBEFEPNJOBOUFOPTFOUJEPEFRVFSFS
se, efetivamente, desenvolver um sistema operacional com maiores
cuidados em face dos direitos da populao;
t F QFMPMBEPFDPONJDP VNBWFSEBEFJOEJTDVUWFMBJOEBOP
enfrentada e pouco reconhecida: os elevados custos na rea comercial
dos servios nessas reas, muito maiores que as receitas potenciais,
e muito maiores, tambm, que os seus equivalentes numa rea de
urbanizao regular (uma casa na comunidade da Rocinha, no Rio
de Janeiro, por exemplo, demandaria maiores custos que o maior dos
prdios da mesma cidade).

25.8 AS EMPRESAS E AS MUNICIPALIDADES


No Brasil, como sabido, o poder concedente dos servios de saneamento
das municipalidades, ao passo que a efetiva prestao dos servios est
concentrada nas empresas estaduais de saneamento e, em muito menor
escala, nos prprios municpios em autarquias, empresas pblicas ou, em
nmero irrisrio, empresas privadas. Apenas na Regio Metropolitana de
So Paulo, salvo melhor juzo, alguns servios de abastecimento de gua
esto repartidos entre a empresa estadual e as municipalidades, ao que
parece segundo uma louvvel racionalidade: a primeira com a produo
da gua (tarefa mais grada e apenas tcnica, prpria para quem est
mais distante) e as ltimas com a distribuio de gua (usando a mesma
linguagem, tarefa mais mida, tambm tcnica e mais prpria para quem
est mais por perto), sem falar-se na profunda distino entres as duas
tarefas, que quase nada tm em comum. Este quadro oriundo daquele
j citado do PLANASA, nos anos setenta, quando eram muito diferentes
as condies ento reinantes, j no fosse muito, tambm, a decorrncia
de 40 anos: o regime era autoritrio, os municpios esvaziados, menores
as cidades e muito menores as suas favelas e sub urbanizaes, mais
concentrados nas capitais os conhecimentos tcnicos especficos sobre o
saneamento, etc.
Com as excees que s confirmam a regra (e que ainda assim esto
presentes onde so especiais as conjunturas dos universos onde elas
ocorrem), este modelo gestor, hoje, parece esgotado, sob os vrios aspectos
que o inspiraram: instabilidade econmica de muitas das empresas;
sistemas intermitentes de gua em quase todas (decorrncia das grandes
perdas e menor qualidade operacional); extraordinrio dficit por sistemas
de esgotamento sanitrio; poluio de praticamente todos os recursos
hdricos prximos das cidades; fragilidade da sade e do bem-estar da
populao. Trata-se, assim, de uma questo da maior relevncia, parece
que reconhecida no plano racional das coisas, mas... que permanece
intocada, em detrimento da populao.
342

Sistema Condominial

Esta crtica ao sistema institucional no feita, contudo, para justificar


mudanas que impliquem na sua desestruturao; ou para atender a
interesses escusos e no publicveis; ou para negar a competncia e a
experincia dos seus quadros sobre o saneamento do Pas; o quanto pode
ser ele propiciador de racionalidades e economias de escala; e, finalmente,
ainda, para reduzir a sua importncia, nas atuais condies do Pas, como
garantidor da necessria proteo a to estratgico campo de atividades.
Mas no deixa de apontar para algumas medidas que representariam
mais energia para o setor, mais aproximao com a populao usuria
(sobretudo para aquela mais pobre e, por isso, dependente dessa
aproximao) e, possivelmente, mais justos preos para os servios. As mais
relevantes, salvo melhor juzo, so as que assim se delineiam:
t OBTSFHJFTNFUSPQPMJUBOBTFOPTHSBOEFTTJTUFNBTJOUFHSBEPTEP
Nordeste, que se busquem alternativas semelhantes quelas que
parecem exitosas, utilizadas na Regio Metropolitana de So Paulo;
t OBTDJEBEFTJOUFSNFEJSJBTFQFRVFOBTRVFBJOEBOPEJTQPOIBNEF
sistemas separadores absolutos de esgotos, que sejam feitos esforos
para que as municipalidades possam suspender as suas prticas
com os sistemas unitrios e, isoladamente ou em parceria com as
empresas estaduais, participem do esgotamento sanitrio;
t OBTGBWFMBTFSFBTVSCBOBTEFHSBEBEBT RVFBTNVOJDJQBMJEBEFT
cheguem prximo aos servios locais de distribuio de gua e
de coleta de esgotos, dadas as exigncias de tais reas em relao
a um trabalho quase artesanal de instrues para o uso dos
sistemas, desenvolvimento das instalaes sanitrias prediais e,
possivelmente, o prprio desenvolvimento urbano numa dimenso
mais ampla, ao estilo do que j vem sendo por elas realizado no
setor da sade pblica, com os seus agentes comunitrios.

25.9 CONSERVADORISMO DO SETOR


O sistema institucional do saneamento, no Brasil, tem uma ndole
decididamente conservadora, e que se manifesta nos seus vrios setores
de atividades, suplantando, muitas vezes, iniciativas particulares, de
tcnicos ou dirigentes, no sentido de aes modernizadoras. Isso tem a ver,
possivelmente, com as origens de sua estruturao empresarial, quando
uma forte padronizao, associada a um certo esprito de unificao
quase que em nvel nacional, alcanou o conjunto das empresas estaduais,
determinando-lhes, na prtica, comportamentos, mtodos e paradigmas
que, de to rgidos, produziram-lhes um visvel imobilismo... e uma grande
inrcia! O que rompe essa ndole com certa freqncia so iniciativas
inovadoras da indstria que serve ao setor, e prticas testadas e aprovadas
nas empresas reconhecidas como melhor estruturadas nesse universo, e que
exercem, naturalmente, certa liderana.
Essa tendncia ao imobilismo se mostra de forma mais visvel onde seriam
maiores as necessidades de oportunas mudanas inovadoras, a saber: nas
343

O Sistema Condominial e seus porqus

estruturas administrativas centralizadas nas capitais dos Estados, com os seus


elevados custos; no enfrentamento decisivo e sistemtico em procedimentos
que venham garantir a reverso das perdas nos sistemas de gua; no esforo
de melhor desempenho dos servios nas reas onde esto as populaes
pobres das cidades; e, desta feita atingindo os sistemas condominiais (e,
sobretudo, sua proposta de mobilizao social), na absoro de mudanas no
campo do esgotamento sanitrio que venham a constituir alternativas mais
viveis em face do atendimento pleno da populao (mais ainda quando to
grande a distncia desta condio, no Brasil).
Observando-se a forma de entrada dos sistemas condominiais onde esto
eles hoje, pode ser constatado que em todos os casos foram muito fortes,
seno preponderantes, os fatores externos que influenciaram ou at mesmo
pautaram as decises. De positivo a esse respeito, todavia, a indiscutvel
regresso das reaes corporativas ao novo sistema, aps a adeso, a ele, do
Distrito Federal e da Bahia, pela CAESB e pela EMBASA, respectivamente.

25.10 OS SISTEMAS UNITRIOS


Ainda uma vez se volta a focalizar os sistemas de drenagem implantados
pelas municipalidades e que, na falta de sistemas de esgotamento sanitrio
terminam funcionando, tambm, para esta coleta ou, melhor dizendo, j
comeam com estes dois objetivos. Francamente, eles talvez se constituam no
pior adversrio dos sistemas separadores de esgotos, quaisquer que sejam os
seus modelos, na medida em que criam, no seio da populao, o sentimento
de problema resolvido em relao a esgotos que a leva rejeio de uma
futura ligao ao sistema regular: seus esgotos desapareceram, j investiu
numa ligao e no paga a tarifa mensal, logo....
Alm desse desservio, o tal sistema encareceu a drenagem porque suas
tubulaes precisaram ser levadas a todas as ruas (para a coleta dos esgotos),
quando se fossem exclusivas das guas de chuva, estariam limitadas a apenas
uma parte delas. No que tange a esgotos, segundo uma viso pragmtica,
alcana dois objetivos opostos quanto sua eficincia: afasta os esgotos,
efetivamente, das casas e das ruas, o que no deixa de ser bom, mas os leva
depressa aos corpos dgua, poluindo-os ainda mais celeremente.
Tudo isso uma produo inteiramente institucional, que nas vrias
cidades envolve um prestador de servios de saneamento (que no cumpriu
suas responsabilidades com relao aos esgotos), e uma prefeitura, que
precisa enfrentar a drenagem e termina enfrentando tambm os esgotos,
numa forma perniciosa). No haveria condies para um novo concerto de
aes a esse respeito, em vista de to grandes prejuzos?
Esse quadro ainda se completa em grande parte das cidades inclusive
em algumas capitais com a omisso da macrodrenagem nesses sistemas
unitrios. Os alagamentos inevitveis que da decorrem, alm de seus graves
inconvenientes para a cidade e para a sua populao pela invaso das guas
em ruas e casas, ainda so perniciosos difusores de doenas, j que esto
sempre contaminados por esgotos.
344

Sistema Condominial

26. DEZ CLSSICOS QUESTIONAMENTOS


SOBRE O SISTEMA CONDOMINIAL
Esses questionamentos aqui selecionados so os mais usuais sobre os
sistemas condominiais, e constituem, por excelncia, uma demonstrao
da falta de informaes disponveis sobre o assunto. Possivelmente a leitura
das suas respostas no ser necessria para quem j praticou o sistema
condominial, j leu algo de consistente sobre o assunto ou, ainda melhor,
estudou pelo menos um dos Cadernos precedentes.
Na sua essncia, as questes giram em torno dos conceitos que mais
se distanciam dos sistemas convencionais, quais sejam: as posies
alternativas dos ramais condominiais, a participao comunitria e a
falsa e muitas vezes maliciosa - associao de seus menores custos a uma
baixa qualidade dos sistemas ou ao seu emprego limitado a reas pobres.
As suas respostas, todas elas, certamente foram tiradas dos quatro cadernos
anteriores, apenas que numa forma mais circunscrita quilo que , em cada
caso, o objeto da dvida.
Ainda uma observao se faz necessria, antes das respostas objetivas: o
pedido de pacincia ao leitor, diante de repeties que por certo ele ir
encontrar em grande parte das respostas, o que foi inevitvel uma vez
que as questes suscitadas giram, quase todas elas, em torno de mesmos
temas: os ramais condominiais, as regras que os definem, sua construo e
manuteno.

Sendo to bom e barato, por que ainda no se


espalhou?
Essa indagao comporta pelo menos trs caminhos na sua resposta, todos
eles sem oferecer concluses objetivas, alm de vrias outras conjecturas de
menor importncia.
Primeiramente, merece uma considerao o fato de que a implantao de
sistemas de esgotos sanitrios no tem sido, historicamente, no Brasil, uma
ao prioritria dos concessionrios do saneamento bsico e das prefeituras,
em face de dois programas que no param de crescer nas cidades, onde,
um deles, quase decorrncia do outro. A referncia para as ampliaes
dos sistemas de abastecimento de gua, ou mais especificamente para os
seus sistemas de produo, e para aquela pavimentao de vias largamente
comentada em cadernos anteriores dessa srie, que trazem consigo intensivos
sistemas de drenagem.
As ampliaes da produo se intensificam dentro dos concessionrios
dos dois sistemas e so alimentadas e comandadas pelas elevadas perdas
ocorrentes no abastecimento de gua urbano, situao, como j se disse,
que leva cada cidade busca permanente de um prximo manancial, em
detrimento de vrios outros importantes investimentos no seu mbito, e
345

O Sistema Condominial e seus porqus

principalmente, no campo do esgotamento sanitrio e no combate efetivo das


prprias perdas.
A pavimentao, uma obrigao da municipalidade e viva demanda da
populao, no podendo aguardar a implantao de sistemas coletores
de esgotos pelos concessionrios, para que ento se realizasse numa forma
racional, termina incorporando os j discutidos sistemas unitrios que,
a pretexto de realizarem a drenagem, terminam coletando os esgotos e
escondendo o seu problema nos cursos de gua. Esta, portanto, seria uma
razo objetiva para reduzir obras de esgotos e, com elas, a aplicao dos
vrios modelos de sistemas, inclusive o condominial.
O segundo caminho que pode explicar uma adeso aos sistemas
condominiais inferior ao que a justificariam os seus benefcios econmicos,
est, possivelmente, no mbito e na forma em que se processa a escolha do
modelo a adotar. que observando-se os vrios universos que adotaram os
sistemas condominiais, particularmente os mais exaustivamente discutidos
nos Caderno 3 e 4, se torna evidente que a opo por eles se realizou de
maneira especial, em cada caso, com grande influncia de um decisor mais
sensvel aos apelos caractersticos desse modelo, principalmente os de
natureza poltica: a participao comunitria e a reduo de investimento que
se traduz automaticamente em maior nmero de atendidos. Mas esta forma
de opo no a mais comum. De fato, o usual que o decisor resolva que
vai implantar sistema de esgotos, mas sem uma preocupao mais objetiva
com a modalidade desse sistema, mais ainda com eventuais inovaes que
a tragam consigo, cabendo aos escales tcnicos esta escolha mais concreta.
Nesse caso, prevalece, invariavelmente, a tradio, a prxis, a vontade da
mquina!... Salvo melhor juzo, os sistemas condominiais jamais se iniciaram
em qualquer parte por este caminho.
O terceiro, finalmente, se compe dos fatos presentes na histria de apenas
25 anos do modelo condominial, marcada por uma extrema carncia de
documentao tcnica especfica e, sobretudo, propagandstica, a seu
respeito, mas que apesar disso atende atualmente cerca de 5 milhes de
habitantes, unnime em pelo menos quatro Estados brasileiros (Braslia,
Rio Grande do Norte, Pernambuco e Bahia) e caminha para uma forte
adeso noutros pases da Amrica Latina, como a Bolvia, o Equador,
o Paraguai e o Peru. Neste ltimo, o seu Programa de Ampliacin de
la Cobertura PAC (gua e esgotos) se destina a cerca de 1 milho de
habitantes, na cidade de Lima. Faltam, por outro lado, as condies para
que se possa avaliar o quanto tais resultados, em presena daquelas tais
dificuldades, constituam um bom ou um mau indicador em termos de
quantidade e de receptividade. Alm disso, tambm, verdadeiro que,
principalmente o seu desenho que racionaliza o traado das redes e
conduz a formidveis economias nos investimentos e nos transtornos
prprios da construo tem influenciado um grande nmero de sistemas
que se alinhariam conforme o modelo mais convencional, mas que,
francamente, j adotam os ramais condominiais de passeio e a rede mais
curta ou rede simplificada ditadas por esses ramais, fato que no deixa de
ser indicador, tambm, de uma tendncia ao novo modelo.

346

Sistema Condominial

No seria ele um sistema de baixo custo, para


pobres?
Ficando-se apenas com os empreendimentos condominiais abordados nos
Cadernos 3 e 4, so muito evidentes os bairros de plena urbanizao ali
contemplados e que demonstram a suficincia e a adaptabilidade, plenas,
deste modelo, aos mais sofisticados padres de urbanizao. Isso contraria
qualquer insinuao presente na questo aqui considerada. Em cada caso,
respeitando-se a posio mais adequada para os ramais condominiais e
os seus dimensionamentos sob os rigores da hidrulica. Rememorandose aqueles Cadernos num tal contexto, seria o caso de destacar-se, dentre
os empreendimentos ali citados, o atendimento a situaes particulares
como os Lagos Norte e Sul de Braslia, bairros dos mais sofisticados na sua
urbanizao; a rea do Comrcio, em Salvador, com seus grandes edifcios
e seu setor porturio; nesta mesma cidade, as suas praias da Pennsula,
ocupadas por pessoas das classes mdia e al