Você está na página 1de 348

PORTUGUÊS ± CÂMARA DE BH

Aula 00 ± Felipe Luccas Rosas

Lista de questões

1. (CESPE / UNB- SEDF /2017)


Presentes no último parágrafo do texto, os vocábXORV ³TXDOLGDGH´
³SHUVSHFWLYD´ ³HVVDV´ ³FRQMXQWR´ H ³FKDPDGD´ FRQWrP JUXSRV GH GXDV
letras que representam um só fonema, constituindo o que se denomina
dígrafo ou digrama.
2. (CONSULPLAN / HOB / Agente Administração / 2015)
Julgue o item a seguir: Na palaYUD ³TXLQ]H´ ³TX´ FRQILJXUD-se como um
dígrafo.
3. (CONSULPLAN / Prefeitura Caratinga-MG / 2015)
São palavras transcritas do texto que apresentam dígrafos, EXCETO:
a) Caminho.
b) Discussão.
c) Corrupção.
d) Infraestrutura.
4. (CONSULPLAN / HOB / Agente Administração / 2015)
-XOJXHRLWHPDVHJXLU(P³UHGHPRFUDWL]DomR´KiXPDGtJUDIRQDTXDUWD
sílaba.
5. (FUMARC / BHTRANS / Assistente Adm. / 2003)
Ambas as palavras contêm exemplo de dígrafo em:
a) questionário/recursos;
b) perspectiva/descer;
c) bairro/maravilhosa;
d) passividade/telespectador.
6. (FUNDATEC / SEFAZ RS / Técnico / 2014)
Considere as assertivas abaixo sobre acentuação gráfica, letras e fonemas.
, $VSDODYUDVµLUi¶ HµDWp¶VmRDFHQWXDGDVHPYLUWXGHGD PHVPDUHJUDH
nenhuma delas possui mais letras do que fonemas.
,, 7DQWR HP µSDtVHV¶ TXDQWR HP µSDtV¶ RFRUUH GLWRQJR H HP DPEDV R
número de letras difere do número de fonemas.
,,,µYiULRV¶HµIXQFLRQiULR¶FRQWLQXDULDPDVHUSDODYUDVGDOtQJXDSRUWXJXHVD
caso o acento fosse retirado.
Quais estão incorretas?
a) Apenas I.
b) Apenas II.
c) Apenas III.
d) Apenas I e II.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 71 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

e) Apenas II e III..
7. (CONSULPLAN / JUATUBA / AUX. ADM. / 2015)
Assinale a afirmativa grafada INCORRETAMENTE.
a) Quanto tempo perdido...
b) Ter um amigo é algo raro.
c) O grupo de pessoas está imcompleto.
d) Cada um foi para o seu lado viver a vida.
8. (CONSULPLAN / CFESS / 2017)
Assinale a alternativa em que o encontro vocálico está corretamente
analisado.
a) poética ± hiato.
b) mangueira ± tritongo.
c) leitor ± ditongo oral crescente.
d) irreverência ± ditongo nasal decrescente..
9. (CONSULPLAN / Prefeitura Cascavel / 2016)
São palavras transcritas do texto que apresentam ditongo, EXCETO:
a) Erótico.
b) Infecção.
c) Necessária.
d) Apaixonado.
e) Adolescência.
10. (CONSULPLAN / TST Analista / 2012)
$SDODYUD³KRUURUHV´DSUHVHQWD
a) Ditongo.
b) Dígrafo.
c) Tritongo.
d) Encontro vocálico.
e) Hiato.
11. (CONSULPLAN / HOB / Agente Administração / 2015)
³)D]DOJXQVDQRVreina entre nós o diagnóstico de déficit de atenção para um
número assustador de crianças´ ž† Nessa frase, as palavras sublinhadas
apresentam, respectivamente,
a) ditongo, hiato, dígrafo e dígrafo.
b) dígrafo, encontro consonantal, hiato e dígrafo.
c) ditongo, encontro consonantal, dígrafo e hiato.
d) encontro consonantal, hiato, dígrafo e ditongo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 72 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

12. (CONSULPLAN / HOB / Agente Administração / 2015)


-XOJXHRLWHPDVHJXLU1RWHUPR³FDIHLFXOWRUHV´KiXPGLWRQJRQDVHJXQGD
sílaba.
13. (CONSULPLAN / HOB / Agente Administração / 2015)
-XOJXHRLWHPDVHJXLU+iHP³PRQDUTXLD´XPGLWRQJRQDVtODEDILQDO
14. (CESPE / FUB / 2016)
O arquiteto Oscar Niemeyer transformou as ideias em prédios
$DXVrQFLDGHDFHQWRDJXGRHP³LGHLDV´HVWiHPFRQIRUPLGDGHFRPDVUHJUDV
ortográficas vigentes.
15. (CONSULPLAN / CFESS / 2017)
Acentuar corretamente as palavras faz parte do apreço que se deve ter com
a norma culta na redação de um texto. A alternativa que apresenta uma
palavra do texto que é acentuada graficamente por motivo DISTINTO das
demais é
a) Últimas. b) Zoológico. c) Agradável. d) Ornitólogo.
16. (CESPE / Defensoria Pública da União / 2016)
3UHVHQWHVQRWH[WR RVYRFiEXORV³FDUiWHU´ ³LQWUDQVIHUtYHO´H³yUJmRV´VmR
acentuados em decorrência da regra gramatical que classifica as palavras
paroxítonas.
17. (CONSULPLAN / Soldado / CBM-PA / 2016)
Dentre os pares a seguir, assinale a alternativa em que todas as palavras
foram acentuadas de acordo com a mesma justificativa para acentuação de
palavras da língua portuguesa.
a) Há, série.
b) Nós, próprios.
c) Iníqua, ninguém.
d) Próximo, específico.
e) Também, tendências.
18. (CESPE / DEPEN / 2015)
Julgue o próximo item, relativo às ideias e às estruturas linguísticas do texto
II.
$VSDODYUDV³LQGLYtGXRV´H³SUHFiULDV´UHFHEHPDFHQWRJUiILFRFRm base em
justificativas gramaticais diferentes.
19. (CESPE / Auditor do TCU / 2015)
No que se refere às ideias e aos aspectos linguísticos do texto acima, julgue
o item.
$VSDODYUDV³OtTXLGD´³S~EOLFR´³yUJmRV´H³HSLVyGLFDV´REHGHFHPjPHVPD
regra de acentuação gráfica.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 73 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

20. (CESPE / FUB / 2015)


Com relação às ideias e às estruturas do texto acima, julgue o item que se
segue.
2V DFHQWRV JUiILFRV GDV SDODYUDV ³ELRHVWDWtVWLFD H ³HVSHFtILFRV WrP D
mesma justificativa gramatical.
21. (Ministério Público da União / 2015)
Com relação às ideias e às estruturas linguísticas do texto I, julgue o item
que se segue.
$SDODYUD³FtYHOUHFHEHDFHQWRJUiILFRHPGHFRUUrQFLDGDPHVPDUHJUDTXH
determina o emprego de acento em amável e útil.
22. (TELEBRÁS / 2015)
Julgue o próximo item, a respeito das ideias e estruturas linguísticas do texto
Os territórios inteligentes.
$SDODYUD³HVWi´UHFHEHDFHQWRJUiILFRHPGHFRUUrQFLDGDPHVPDUHJUDTXH
GHWHUPLQDRHPSUHJRGRDFHQWRQRYRFiEXOR³WUrV´
23. (Quadrix / CRM-ES / Agente Administrativo / 2016)

As palavras "só", "está" e "médico" aparecem acentuadas no segundo balão


da charge. Sobre elas, assinale a alternativa correta.
a) A acentuação é adequada nos três casos devido à mesma regra.
b) O uso do acento agudo é obrigatório nos três casos, mas cada uma
dessas palavras segue uma regra diferente.
c) Duas dessas palavras são acentuadas pela mesma regra.
d) Uma das três palavras não deveria ter sido acentuada.
e) O uso do acento agudo está correto nos três casos, mas em um deles
também se poderia usar o circunflexo.
24. (FGV / Professor de Português / 2016)
Em uma prova de Português, uma das questões solicitava a separação
silábica da palavra importância e o gabarito seguido pela professora era o

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 74 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

de que a palavra deveria ser separada da seguinte forma: im-por-tân-cia.


Assinale a opção que indica o comentário correto sobre a questão.
a) O gabarito está incorreto, porque se trata de uma palavra com hiato.
b) O gabarito está correto, já que essa é a única separação silábica
possível.
c) O gabarito está correto, mas incompleto, pois outra separação é
possível.
d) O gabarito está incorreto, pois a acentuação mostra que se trata de
proparoxítono.
e) O gabarito está correto, pois se trata de um ditongo crescente e não de
um hiato.
25. (FMP / Ag. Fiscal da Receita / Pref. Porto Alegre / 2012)
De acordo com as regras de acentuação gráfica e ortografia, julgue o item:
O substantivo PACIÊNCIA é acentuado por ser uma paroxítona terminada
em ditongo crescente ou por ser uma proparoxítona eventual ou relativa.
26. (CESPE / Supremo Tribunal Militar / 2011)
A regra de acentuação gráfica que justifica o emprego do acento gráfico em
³DHURSRUWXiULR´ p D PHVPD TXH MXVWLILFD R HPSUHJR GR DFHQWR HP
³PHWHRUROyJLFD´
27. (ESAF / APO-MPOG / 2015)
O acento nDV SDODYUDV ³YpVSHUDV´ ³FLrQFLDV´ H ³HFRQ{PLFDV´ MXVWLILFD-se
devido à mesma regra de acentuação gráfica.
28. (CONSULPLAN / Aux. Adm. / Pref. Caratinga-MG / 2015)
São termos acentuados pela mesma razão, EXCETO:
a) Políticas.
b) Inúmeros.
c) Ministério.
d) Oncológicos.
29. (CONSULPLAN / Analista Judiciário / TSE / 2012)
Assinale a palavra que NÃO tenha sido acentuada pelo mesmo motivo que
as demais.
a) substituído
b) polícia
c) jurisprudência
d) saqueável
30. (SUFRAMA / 2014)
No que diz respeito ao texto, julgue o item.
$SDODYUD³SUHMXt]RV´UHFHEHDFHQWRJUiILFRSRUTXHWRGDVDVSURSDUR[tWRQDV

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 75 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

devem ser acentuadas.


31. (CAIXA ECONÔMICA FEDERAL / MÉDICO / 2014)
2 HPSUHJR GR DFHQWR JUiILFR HP ³LQFOXtUDP´ H ³Q~PHUR´MXVWLILFD-se com
base na mesma regra de acentuação.
32. (TRIBUNAL DE JUSTIÇA-CE / 2014)
2HPSUHJRGRDFHQWRJUiILFRQRVYRFiEXORV³UH~QHP´H³IHQ{PHQR´MXVWLILFD-
se com base na mesma regra de acentuação.
33. (FUB / 2015)
Em relação ao fragmento de texto acima, julgue os próximos itens. Os
DFHQWRVJUiILFRVGDVSDODYUDV³SDtVHV´H³SROtWLFDV´WrPDPHVPDMXVWLILFDWLYD
gramatical.
34. (CONSELHO NACIONAL DE JUSTIÇA / 2013)
A mesma regra de acentuação gráfica justifica o emprego de acento gráfico
QDVSDODYUDV³FRQVWUXtGD´H³SRVVtYHLV´
35. (TRT DF e TO / 2013)
$VSDODYUDV³SDtVHV´³IDPtOLDV´H³QtYHLV´VmRDFHQWXDGDVGHDFRUGRFRPD
mesma regra de acentuação gráfica.
36. (ANAC / Técnico Administrativo / 2016)

a) Acentua-VH R YHUER ³p´ O  TXDQGR iWRQR SDUD GLIHUHQFLi-lo da


FRQMXQomR³H´
E ³9RFr´ O pSDODYUDDFHQWXDGDSRUVHUSDUR[tWRQDWHUPLQDGDQDYRJDO
³H´IHFKDGD
F ³'HVSDFKi-ORV´ O VHDFHQWXDSHORPHVPRPRWLYRGH³GHYHUi´ O 
G 2FRUUHDFHQWRJUDYHHP³jEXVFDSHVVRDO´ O HPUD]mRGRHPSUHJR
de locução com substantivo no feminino.
H  2 DFHQWR DJXGR HP ³JUiYLGDV´ O  VH GHYH SRU VH WUDWDU GH SDODYUD
paroxítona terminada em ditongo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 76 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

37. (IESES / Pref. SJC-SC / 2017)


Releia esse período do texto: ³$QRV GHSRLV HP  RV VHWH SDtVHV GH
língua portuguesa (Timor-Leste não pôde ser incluído na lista, pois se
tornaria independente apenas em 2002) consolidaram as Bases Analíticas da
2UWRJUDILD6LPSOLILFDGDGD/tQJXD3RUWXJXHVDGH´
Analise as proposições a seguir sobre a acentuação gráfica nesse período.
Em seguida assinale a alternativa que contenha a análise correta sobre as
mesmas.
,$SDODYUD³SDtVHV´pDFHQWXDGDSHORIDWRGHGXDVYRJDLVVHHQFRQWUDUHP
em sílabas diferentes, formando um hiato.
,,$SDODYUD³S{GH´HVWiFRQMXJDGDQRSUHWpULWRSHUIHLWRHUHFHEHXDFHQWR
para diferenciá-ODGDIRUPD³SRGH´QRWHPSRSUHVHQWH
,,, $VVLP FRPR ³DQDOtWLFDV´ D SDODYUD ³OtQJXD´ p DFHQWXDGD SRU VHU
proparoxítona.
,92WHUPR³LQFOXtGR´UHFHEHDFHQWRSRUVHUXPDR[tWRQDWHUPLQDGDHP³R´
a) Estão corretas apenas as proposições I e II.
b) Estão corretas apenas as proposições III e IV.
c) Estão corretas apenas as proposições I e III.
d) Estão corretas apenas as proposições II e IV.
38. (CONSULPLAN / Prof. Português / 2010)
Cada alternativa a seguir apresenta um princípio ortográfico seguido de dois
exemplos. A exemplificação está correta somente em:
a) São acentuadas todas as palavras oxítonas terminadas em a, e, o, em
VHJXLGDVRXQmRGH³V´também e já.
b) Todas as palavras proparoxítonas são acentuadas: década e porém.
c) Acentua-se a segunda vogal tônica do hiato: subtraídas e ótimo.
d) Acentuam-se os monossílabos tônicos terminados em a, e, o (s): há e
só.
e) Acentuam-se com acento agudo os ditongos tônicos éi, éu, ói: vídeo e
sério.
39. (Consulplan / Advogado / Embrapa / 2007)
³)RUWH H GRQR GH ERD PXVFXODWXUD HOH WHP LQVWLQWR DJUHVVLYR´ 6H
pluralizarmos o pronome ele, da frase anterior, teremos a forma verbal:
a) têem b) têm c) terão d) teriam e) tenham.
40. (CESPE / Instituto Rio Branco / 2016)
O Sr. Menotti del Picchia ainda não pôde naturalmente desvendar o segredo
da arte. Se no buscar a expressão natural do seu lirismo alcançou a arte,
não se despojou ainda das incertezas dessa procura, de certa fraqueza de
técnica. Defeitos são todos estes transitórios, quase necessários em quem
apenas se inicia.
Julgue (C ou E) o item seguinte, relativo a acentuação de palavras e a

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 77 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

aspectos gramaticais do texto.


$IRUPD³S{GH´SRGHULDVHUFRUUHWDPHQWHVXEVWLWXtGDSRUSRGHYLVWRTXHR
seu tempo verbal é depreendido pelo contexto do parágrafo e que o acento
nela empregado é opcional.
41. (MPE SC / 2014 / adaptada)
Assinale a alternativa em que todas as palavras estão escritas corretamente,
de acordo com o sistema ortográfico vigente.
a) Os corruptos não vêm que o dia do basta chegou!
b) Foi uma grande idéia levar o povo as ruas para chamar a atenção.
F  'H QDGD DGLDQWD JULWDU ³%DVWD´ VH DV SHVVRDV PDQWHP VHXV DWRV
corruptivos.
d) A corrupção não vai parar só porque as pessoas têm saído pelas ruas do
país.
42. (Auditor Rio Grande do Sul / 2014) Adaptada
Desde o início da década passada, os diversos governos que se alternaram
no Estado vêm (IV) fechando postos fiscais...
Julgue: Acentua-VHDSDODYUDµYrP¶SDUDGLIHUHQFLi-la, em situação de uso,
quanto à flexão de número
43. (GUARDA MUNICIPAL /PREF. DE PAULÍNIA / 2016)
As duas palavras do texto 2 que recebem acento gráfico por razões
diferentes são:
a) homicídio/média;
b) país/juízes;
c) histórico/pública;
d) secretários/relatório;
e) está/é.
44. (IF-MS / Técnico de Laboratório / 2016)
Em 16 de dezembro de 1990 foi assinado em Lisboa o Acordo Ortográfico da
Língua Portuguesa, por Portugal, Brasil, Angola, São Tomé e Príncipe, Cabo
Verde, Guiné-Bissau, Moçambique e, posteriormente, por Timor Leste. No
Brasil, o Acordo foi aprovado pelo Decreto Legislativo nº 54, de 18 de abril
de 1995. Segundo o Novo Acordo Ortográfico da Língua Portuguesa algumas
palavras perderam o acento agudo. Assinale a opção que apresenta uma
palavra que não é mais acentuada devido ao Acordo Ortográfico referido e
que está em vigor desde 2013.
a) Chapeus. b) Papeis. c) Trofeu. d) Feiura. e) Piaui.
45. (IBFC / TCM RJ / Técnico de Controle Externo / 2016)
Analise as afirmativas abaixo, dê valores Verdadeiro (V) ou Falso (F) quanto
ao emprego do acento circunflexo estabelecido pelo Novo Acordo
Ortográfico.
() O acento permanece na grafia de 'pôde' (o verbo conjugado no

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 78 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

passado) para diferenciá-la de 'pode' (o verbo conjugado no presente).


() O acento circunflexo de 'pôr' (verbo) cai e a palavra terá a mesma
grafia de 'por' (preposição), diferenciando-se pelo contexto de uso.
() a queda do acento na conjugação da terceira pessoa do plural do
presente do indicativo dos verbos crer, dar, ler, ter, vir e seus derivados.
Assinale a alternativa que apresenta a sequência correta de cima para baixo.
a) V F F
b) F V F
c) F F V
d) F V V
46. (CESPE / PC-GO / 2016)
2HPSUHJRGRKtIHQQRYRFiEXOR³EHP-HVWDU´MXVWLILFD-se pela mesma regra
ortográfica que justifica a grafia do antônimo desse vocábulo: mal-estar.
47. (TCM RJ / 2016)

48. (Consulplan / TRF Analista / 2017)


Leia as frases seguintes. Em uma delas há INCORREÇÃO quanto à ortografia
das palavras. Assinale-a.
a) O não preconceito seria bem vindo para que os homens tivessem mais
paz no seu dia-a-dia.
b) O preconceito é arqui-inimigo da paz entre os homens, inquieta os
espíritos e promove o desequilíbrio social.
c) O preconceito é algo tão arraigado no homem que, para alguns, é
extremamente penosa a lide com a diversidade.
d) Medo e preconceito se inter-relacionam desde o surgimento do homem.
Urge mudar esse destino a que o homem está fadado..
49. (IF-MS / Secretário Executivo / 2016)
Assinale o segmento do texto inteiramente correto quanto às normas do
Novo Acordo Ortográfico da Língua Portuguesa (2009):
a) Há inclusive uma teoria sobre o que acontece com a comedia: as pessoas
usam a comunicação de uma forma divertida, e é por isso que rimos.
E 2*RYHUQRGH&KLSUHIDODHP³HVIRUoRVLQWHQVRV´R%DQFR&HQWUDOHP
³HVIRUoRV VREUH-KXPDQRV´ 6HMD TXDO for a expressão, as autoridades
cipriotas dizem-se fortemente empenhadas em permitir que as agências dos
bancos reabram na quinta-feira.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 79 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

c) Parte da nova geração chega às empresas mal educada. Ela não chega
mal-escolarizada, chega mal educada. Não tem noção de hierarquia, de
metas e prazos e acha que você é o pai dela.
d) Os bovinos vêem e percebem o mundo que os rodeia de uma maneira
diferente e peculiar.
e) O mandatário alviverde revelou achar um absurdo a idéia de um possível
gramado sintético no Allianz Parque.
50. (FGV / TNS / Revisor / 2014)
As opções a seguir apresentam vocábulos grafados segundo as regras do
Acordo Ortográfico anterior. Assinale a opção que indica o vocábulo que não
teve sua grafia alterada, segundo as novas regras.
a) AntiǦsimbólico b) Colmeia c) CoǦréu d) Freqüência e) Jibóia
51. (IF-MS / Técnico de Laboratório / 2016)
Segundo o Novo Acordo Ortográfico da Língua Portuguesa, algumas regras
do uso do hífen foram alteradas. Assinale a opção que apresenta uma
palavra corretamente grafada segundo o Acordo Ortográfico referido.
a) Sub-reino.
b) Infra-estrutura
c) Anti-rábico
d) Microondas
e) Hiperrequintado.
52. (ESAF / Contador-FUNAI / 2016)
A mata preservada do Parque Indígena do Xingu segue previlegiando [1]
os chamados ³VHUYLoRV VLVWrPLFRV´ $ QDWXUH]D contribue [2] para o
equilíbrio do clima e o bem-estar [3] das pessoas, seja na forma de
umidade do ar, que leva chuva pelo Brasil a fora [4], seja na manutenção
da biodiversidade, da polinização, da absorsão [5] de carbono.
Assinale a opção cujo número corresponde ao segmento corretamente
grafado.
a) 1 b) 2 c) 3 d) 4 e) 5
53. (CONSULPLAN / TJ-MG / ESTAGIÁRIO / 2016)
Há três vocábulos que foram grafados, propositadamente, com alguma
INCORREÇÃO. São eles:
a) Regozija / isenta / ativismo.
b) Hegemonia / cerne / hipótese.
c) Tenções / excessão / adiversários.
d) Facticidade / perversões / ressentimentos.
54. (FUNDATEC /Agente de Combate a Endemias / 2015)
Fragmentos de texto:
³«DHVFDVVHBGHiJXDSDUDSRSXODo}HVHPFUHVFLPHQWR«´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 80 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

³«OLTXLGRXDVWHQB}HVHQWUHRVSDtVHVQHVVDiUHD«´
³«DWDBDGHFRRSHUDomRVXSHUDDLQFLGrQFLDGHFRQIOLWRVJUDYHV«´
Assinale a alternativa que preenche, correta e respectivamente, as lacunas
das palavras das linhas 01, 11 e 20.
a) s ± ss ± ch
b) z ± s ± ch
c) z ± s ± x
d) s ± ss ± x
e) z ± ss ± x
55. (ANAC / TÉCNICO ADMINISTRATIVO / 2016)
a)No caso de sentir-se prejudicado ou de ter seus direitos desrespeitados, o
passageiro de avião deve dirijir-se primeiro à empresa aérea contratada,
para reinvindicar seus direitos como consumidor.
b)É possível, também, registrar reclamação contra a empresa aérea na
ANAC, que analizará o fato.
c)Se a ANAC constatar descomprimento de normas da aviação civil, poderá
aplicar sanção administrativa à empresa.
d)No entanto, a ANAC não é parte na relação de consumo firmada entre o
passageiro e a empresa aérea, razão pela qual não é possível buscar
indenização na Agência.
e)Para exijir indenização por danos morais e/ ou materiais, consulte os
órgãos de defesa do consumidor, e averigúe antecipadamente se está de
posse dos comprovantes necessários.
56. (ANAC / ANALISTA ADMINISTRATIVO / 2016)
Assinale a opção correspondente a erro de grafia inserido no texto.
a) controvérsia
b) converjências
c) intensa
d) convencer
e) inesquecível
57. (CONSULPLAN / TJ-MG / 2014)
Assinale a alternativa em que a justificativa para o emprego da inicial
maiúscula encontraǦse INCORRETA.
a)³>@SULPHLURǦministro da Bélgica [...]´ ± nome de lugar
b)³>@FRQYHUVDQGRSHOR0HVVHQJHU>@´ ± nome personificado
c)³>@GLVFXUVRTXHID]LDQR3DUODPHQWR>@´ ± nome de instituição
d)³>@ GH XPD SRQWD j RXWUD GD $YHQLGD 3DXOLVWD >@´ ± nome de
logradouro público

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 81 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

58. (VUNESP / TJM SP / 2017)


Assinale a alternativa que preenche, respectivamente, as lacunas da frase,
conforme a norma-padrão da língua.
_______________. anos, estudiosos________ acerca da contribuição que o
conhecimento dos buracos negros pode trazer_____________ nossas vidas.
a) Há ... têm questionado-se ... a
b) Há ... têm se questionado ... a
c) Há ... têm se questionado ... à
d) A ... têm questionado-se ... a
e) A ... têm se questionado ... à
59. (CONSULPLAN / CBM-PA / BOMBEIRO / 2016)
³1mR Ki SUREOHPD HP FRQVXPLU R SUREOHPD SDVVD D H[LVWLU TXDQGR R
consumo determina a vida. Isso é extremamente perigoso, principalmente
quando os filhos chegam à adolescência. Há um mercado generoso de oferta
de drogaV´
O verbo haver, utilizado no trecho em destaque, no sentido de existir,
também pode ser empregado em algumas expressões que indicam tempo.
Seu emprego está correto em:
a) Partiriam dali há duas horas.
b) Tais fatos aconteceram há dez anos.
c) O projeto terá início daqui há duas semanas.
d) Daqui há dois meses, assumirá o novo cargo.
e) Estamos há apenas algumas horas do início do evento.
60. (DPE-MT / Assistente Administrativo / 2015)
Na frase ³1mR HQWHQGR por que QmR VH OHJDOL]D R MRJR QR %UDVLO´ o termo
sublinhado tem a grafia em dois termos exatamente pelo mesmo motivo que
em
$ ³$OHJDOL]DomRGRMRJRpRPRWLYRSRUTXHOXWDDOHLWRUD´
% ³3RUTXHUD]mRQmRVHOHJDOL]DRMRJR"´
& ³'HVFRQKHoRSRUTXHDOHJDOL]DomRGRMRJRpSURLELGD´
' ³(VVHpRFDPLQKRSRUTXHHOHYHLR´
( ³2SURMHWRSRUTXHPHHPSHQKRpGHJUDQGHXWLOLGDGH´
61. (CONSULPLAN / TJ-MG / 2014)
Analisando a ortografia das palavras da frase ³&DUDYRFrWa ai o dia todo
fazendo o que"´ YHULILFDǦse que, de acordo com a norma culta, algumas
palavras não foram acentuadas. Quantas palavras encontramǦse escritas de
forma INCORRETA?
a) 1.
b) 2.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 82 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

c) 3.
d) 4.
62. (PROFESSOR / PREFEITURA DE CUIABÁ / 2016)
³0DVRVGHVDILRVSHUPDQHFHPSRXFRDQWHVGRLQtFLRGD&RQIHUrQFLDGR&OLPD
de Paris, que em dezembro reunirá 195 delegações a fim de manter o
DXPHQWRFRQVWDQWHGDWHPSHUDWXUDJOREDO´
1HVVHVHJPHQWRGRWH[WRRYRFiEXOR³DILP´pJUDIDGRHPGXDVSDODYUDVR
TXH WHP XP VHQWLGR GLIHUHQWH GR YRFiEXOR ³DILP´ JUDIDGR FRPR XPD Vy
palavra.
Assinale a opção que indica a frase cujo termo sublinhado apresenta grafia
correta.
a) Todo o Congresso discutia a cerca do desmatamento.
b) Por ventura o desmatamento diminuiu no Brasil?
c) Discutiu-se muito, sobre tudo, o essencial para a proteção do meio
ambiente.
d) O motivo por que ocorreu o desmatamento é que não houve fiscalização.
e) Houve uma calamidade natural, por tanto ninguém é culpado.

Lista mais questões comentadas

63. (CONSULPLAN / Aux. Adm. / Juatuba / 2015)


As palavras estão, quanto à acentuação, devidamente justificadas, EXCETO:
a) último ± proparoxítona.
b) nós ± monossílaba tônica.
c) irá ± R[tWRQDWHUPLQDGDHP³D´
d) lágrima ± SDUR[tWRQDWHUPLQDGDHP³D´
64. (CONSULPLAN / Ag. de Administração / HOB / 2015)
Assinale a alternativa em que todas as palavras foram acentuadas pelo
mesmo motivo.
a) saúde ± boné ± distraídas.
b) remédio ± possível ± fúria.
c) alguém ± homogêneo ± número.
d) músculos ± diagnóstico ± públicas.
65. (CONSULPLAN / Ad. Adm. Cantagalo / 2013)
$SDODYUD³GRPpVWLFR´pDFHQWXDGDSHODPHVPDUD]mRTXHDSDODYUD
a) daí.
b) dócil.
c) mantém.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 83 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

d) ecóloga.
e) será.
66. (CONSULPLAN / Motorista / Cantagalo / 2013)
$SDODYUD³YLYrQFLD´pDFHQWXDGDSHODPHVPDUD]mRTXHDSDODvra:
a) lê.
b) crítica.
c) técnica.
d) possível.
e) experiência.
67. (CONSULPLAN / CISAMAPI / 2011)
Assinale a alternativa INCORRETA quanto à acentuação.
a) pés: monossílaba tônica.
b) inútil: proparoxítona.
c) só: monossílaba tônica.
d) último: proparoxítona.
H VHUiR[tWRQDWHUPLQDGDHP³D´
68. (CONSULPLAN / Ass. Adm. / Natividade / 2014)
Assinale a alternativa em que todas as palavras são acentuadas pelo mesmo
motivo.
a) avô / deverá / até
b) além / táxi / silêncio
c) infância / pássaros / está
d) sensível / símbolo / gráfica
69. (CONSULPLAN / GMA / Natividade / 2014)
Assinale o par de palavras que é acentuado pela mesma razão.
a) gás ± é
b) prédios ± três
c) também ± água
d) síndicos ± convivência
70. (CONSULPLAN / Prefeitura - Olinda / 2015)
O par de vocábulos, acentuado pela mesma regra, é
a) pés ± atrás.
b) única ± líquido.
c) história ± bibelô.
d) também ± remédio

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 84 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

71. (CONSULPLAN / Soldado CBM / TO / 2013)


Dentre os pares apresentados, indique aquele em que as palavras possuem
a mesma justificativa para a acentuação.
a) útil ± só
b) aceitará ± época
c) rádio ± privilégios
d) benéficos ± episódio
72. (CONSULPLAN / BANESTES / ASSISTENTE / 2013)
³3HVVRDV EHP-humoradas fazem _____________ para manter uma vida
social saudável, por isso são _____________ num mundo em que imperam
SHVVRDV BBBBBBBBBBBBB H GLItFHLV´ Assinale a alternativa que completa
correta e sequencialmente a afirmativa anterior.

a) conseções / exceções / jeniozas


b) conseções / esseções / geniozas
c) concessões / exseções / jeniosas
d) conceções / exceções / geniosas
e) concessões / exceções / geniosas
73. (CONSULPLAN / CM CARATINGA / ASG / 2015)
Assinale a afirmativa que apresenta ERRO de ortografia.
a) A água possui uma série de características peculiares.
b) O Sistema Cantareira, principal manancial de São Paulo, registrou a
maior alta desde o início da crise hídrica.
c) A chuva em regiões de cabesceira, por exemplo, pode recarregar o lençol
freático e, assim, aumentar o volume de água dos rios.
d) A poluição hídrica compromete a qualidade da água, prejudicando a
biodiversidade, bem como o abastecimento de água e a produção de
alimentos.
74. (CONSULPLAN / PATOS-MG / MOTORISTA / 2015)
Assinale a afirmativa que apresenta ERRO de grafia.

a) O tratamento para casos de aborto requer o controle da hemorragia e a


prevenção de infecção uterina.
b) O aborto é considerado inevitáveu quando apresenta dor ou
sangramento intoleráveis com dilatação do colo do útero.
c) O aborto induzido quando realizado por profissionais capacitados e em
boas condições de higiene é um procedimento seguro para a mãe.
d) Algumas mulheres possuem uma maior dificuldade em levar a gravidez
até ao fim e, por isso, estas deverão ser acompanhadas semanalmente pelo
médico.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 85 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

75. (CONSULPLAN / CANTAGALO / MOTORISTA / 2013)


Assinale a afirmativa grafada INCORRETAMENTE.
a) Ler é interpretar o mundo.
b) Educar é uma virtude admirável.
c) A educação desenvolve progressos.
d) Devemos ler e pensar sobre o prossesso de criação.
e) Os adolescentes têm chances de se desenvolverem na escola.
76. (CONSULPLAN / NATIVIDADE / GMA / 2014)
Assinale a afirmativa que apresenta ERRO de grafia.
a) Ter vizinhos amigos garante a segurança.
b) Nossos vizinhos são amigos e companheiros.
c) O bom vizinho garanteǦnos paz e tranquilidade.
d) Os moradores do prédio fizeram uma sindicânscia.
77. (CONSULPLAN / Ass. de Manut. Elétrica / CBTU / 2014)
Analise a palavra destacada no trecho ³>@HQIUHQWDUDPFRUDMRVDPHQWHRV
governos militares pela salvaguarda [...]" Considerando que essa palavra
está adequada quanto à acentuação gráfica, assinale a alternativa
INCORRETA a respeito da sua pronúncia.
D $SDODYUDQmRpSURSDUR[tWRQD6HIRVVH WHULDDFHQWRQR³YD MiTXH
toda proparoxítona é acentuada graficamente.
E (ODpR[tWRQDHFRPRWHUPLQDHP³DQmRpDFHQWXDGDSois oxítonas
com essa terminação não recebem acento gráfico.
F  (OD p SDUR[tWRQD H FRPR WHUPLQD HP ³D QmR p DFHQWXDGD SRLV
paroxítonas com essa terminação não recebem acento gráfico.
G 1mRKiSRVVLELOLGDGHDOJXPDGH³VDOVHUDVtODEDW{QLFDMiTXe a tônica
nunca se posiciona à esquerda da antepenúltima sílaba.
78. (CONSULPLAN / Analista Gestão / CBTU / 2014)
Considerando a acentuação gráfica das palavras, analise as afirmativas a
seguir.

,$VSDODYUDV³UiSLGR´H³~OWLPDV´VmRDFHQWXDGDVHPGHFRUUrncia de mesma
regra gramatical.
,,$VSDODYUDV³GpFDGDV´H³IHQ{PHQRV´VmRDFHQWXDGDVHPGHFRUUrQFLDGH
diferentes regras gramaticais.
,,,2SOXUDOGH³LQGLVFXWtYHO´pDFHQWXDGRHPGHFRUUrQFLDGHPHVPDUHJUD
gramatical que justifica o acento gráfico em ³VXVWHQWiYHLV´

Está(ão) correta(s) apenas a(s) afirmativa(s).


a) I

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 86 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

b) II
c) I e II.
d) I e III.
79. (CONSULPLAN / Ass. Securitário / Banestes / 2013 )
Assinale a alternativa em que todas as palavras são acentuadas
graficamente pelo mesmo motivo.
a) está / já / você
b) álibi / poético / mínima
c) infância / sério / alguém
d) psíquicos / fáceis / íntimos
e) convivência / difícil / paciência
80. (CONSULPLAN / Analista Judiciário / TRE-MG / 2013)
Assinale a alternativa em que todas as palavras são acentuadas
graficamente pelo mesmo motivo.
a) é ± têm ± ética
b) só ± porém ± política
c) até ± também ± mínimo
d) democrática ± ético ± único
e) excluído ± legítimas ± ilegítima
81. (CONSULPLAN / Aux. Adm. / PREF. Dq. Caxias-RJ / 2015)
Assinale a alternativa em que todas as palavras são acentuadas pelo mesmo
motivo.
a) difícil ± tênis ± sofá.
b) silêncio ± mínimo ± até.
c) país ± contribuído ± laboratório.
d) lágrimas ± dívidas ± astronômicas.
82. (CONSULPLAN / Motorista / AGP Londrina / 2011)
A acentuação das palavras encontra-se corretamente justificada, EXCETO
em:
a) vítimas: proparoxítona.
b) é: monossílaba tônica.
F WDPEpPSDUR[tWRQDWHUPLQDGDHP³HP´
G HVWiR[tWRQDWHUPLQDGDHP³D´
e) lágrimas: proparoxítona.
83. (CONSULPLAN / Fiscal / Uberlândia / 2012)
As palavras a seguir estão corretamente acentuadas, EXCETO:
a) Bambú.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 87 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

b) Fiéis .
c) Órfão.
d) Consciência.
e) Científico.
84. (CONSULPLAN / Aux. Sec. / CMSAG / 2011)
A acentuação das palavras encontra-se corretamente justificada, EXCETO
em:
a) é: monossílaba tônica
b) máximo: proparoxítona
F QLQJXpPSDUR[tWRQDWHUPLQDGDHP³HP´
G HVWiR[tWRQDWHUPLQDGDHP³D´
H UHVSRQViYHOSDUR[tWRQDWHUPLQDGDHP³/´
85. (CONSULPLAN / Aux. Serg. / CMSAG / 2011)
$VVLQDOHDVHJXLUXPDSDODYUD³SURSDUR[tWRQD´
a) Há.
b) Proteínas.
c) Décadas.
d) Família.
e) Só.
86. (CONSULPLAN / IBGE / 2011)
Justifica-VH FRUUHWDPHQWH D DFHQWXDomR GRV YRFiEXORV ³HVWi´ ³DOpP´ H
³WrP´UHVSHFWLYDPHQWHDVHJXLU
a) Proparoxítona, monossílabo tônico, oxítona terminada em ³P´
E 3DUR[tWRQDWHUPLQDGDHP³D´SDUR[tWRQDWHUPLQDGDHP³P´PRQRVVtODER
tônico.
F  3DUR[tWRQD WHUPLQDGD HP ³D´ SURSDUR[tWRQD IRUPD GD  SHVVRD GR
singular de um verbo.
d) Vogal tônica do ditongo aberto em final de palavra, proparoxítona, oxítona
tHUPLQDGDHP³HP´
H  2[tWRQD WHUPLQDGD HP ³D´ R[tWRQD WHUPLQDGD HP ³HP´ IRUPD GD 
pessoa do plural de um verbo.
87. (CONSULPLAN / Motorista / Monte Belo / 2011)
A acentuação das palavras está corretamente justificadas, EXCETO em
a) família: proparoxítona.
b) é: monossílaba tônica.
c) econômica: proparoxítona.
G VXVWHQWiYHOSDUR[tWRQDWHUPLQDGDHP³/´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 88 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

e) época: proparoxítona.
88. (CONSULPLAN / IBGE / 2011)
$V SDODYUDV ³PpGLFRV´ ³QRWtFLD´ ³SDtVHV´ ³SRUpP´ VmR DFHQWXDGDV
obedecendo, respectivamente, às mesmas regras que as seguintes palavras
a) áreas, construído, família, têm
b) número, áreas, construído, refém
c) solitários, séculos, independência, levá-los
d) séculos, solitários, assistência, têm
e) décadas, necessários, construído, têm
89. (CONSULPLAN / CREA-RJ / 2011)
$SDODYUD³S~EOLFR´WHPFRUUHWDPHQWHMXVWLILFDGRRDFHQWRJUiILFRGHDFRUGR
com a seguinte regra e exemplo:
a) Acentuam-se todas as palavras proparoxítonas. Ex.: víssemos.
b) Acentuam-se as palavras paroxítonas que terminam em i, is, o, os, us,
um, uns. Ex.: táxi.
c) Acentuam-se as palavras oxítonas terminadas em a, as, e, es, o, os, em,
ens. Ex.: supôs.
d) Existem algumas palavras que recebem acento excepcional, para que
sejam diferenciadas, na escrita, de suas homófonas. Ex.: É o caso de
³S~EOLFR´H³SXEOLFR´
H 4XDQGRDVHJXQGDYRJDOGRKLDWRIRU³L´RX³X´W{QLFRVDFRPSDQKDGRV
ou não de s, haverá acento. Ex.: saúva.
90. (CONSULPLAN / COFEN / 2011)
Assinale a alternativa em que as três palavras são acentuadas pela mesma
razão:
a) você / vêm / está
b) orgânicos / químicos / freático
c) é / mês / até
d) proteína / contribuído / família
e) reciclável / indício / habitável
91. (CONSULPLAN / CESAN / 2011)
A acentuação das palavras está corretamente justificada em:
a) também: paroxítona terminada em ³HP´
b) físico: proparoxítona.
c) índice: paroxítona terminada em ditongo.
d) há: monossílaba átona.
H VXVWHQWiYHOR[tWRQDWHUPLQDGDHP³O´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 89 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

92. (CONSULPLAN / Prof. Português / 2010)


³'HGLFDU-se à UHODomRpLPSRUWDQWH´É correto afirmar que o sinal gráfico
empregado na palavra destacada nessa frase é denominado:
a) Trema.
b) Acento agudo.
c) Crase.
d) Acento circunflexo.
e) Acento grave.
93. (CONSULPLAN / Recepcionista / 2010 )
³8PDSHVVRDé JUDQGHTXDQGRSHUGRD´A palavra destacada é acentuada
pelo mesmo motivo que a seguinte palavra:
a) única
b) há
c) egoísmo
d) será
e) ausência
94. (CONSULPLAN / Analista Judiciário / TER-RS / 2008)
O par de vocábulos acentuados pela mesma razão é:
a) atraíssem / espírito
b) água / substância
c) porém / caráter
d) lá / até
e) perceptível / mistério
95. (CONSULPLAN / Téc. Informática / CODEVASF / 2008)
Assinale a alternativa em que as palavras são acentuadas pela mesma razão,
respectivamente de: conferência, potável, farmacêutica e além:
a) água, indústria, décadas, está
b) incidência, substâncias, retórica, saúde
c) substâncias, público, últimas, países
d) secretário, países, dólares, está
e) malária, acessível, básica, reféns

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 90 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

96. (CONSULPLAN / Téc. Administrativo / TRE-RS / 2008)

A respeito das palavras acentuadas no texto é correto afirmar que:


a) Todas as palavras receberam acento pelo mesmo motivo.
b) O til da palavra coração também pode ser considerado um sinal de
acentuação.
c) Apenas as palavras será e dicionários receberam acento pelo mesmo
motivo.
d) Apenas as palavras pântano e dicionários receberam acento pelo mesmo
motivo.
e) Será, dicionários e pântanos são acentuadas por motivos diferentes.
97. (CONSULPLAN / Téc. Informática / SDS-SC / 2008)
A alternativa em que o uso do acento gráfico obedece à mesma regra é:
a) pêlo, ótima, úteis
b) óleo, ótima, Ásia
c) óleo, Ásia, delícia
d) aliás, já, biguá
e) chapéu, vocês, aí
98. (CONSULPLAN / Analista de Sistemas / Chesf / 2007)
As palavras mês, está e água, respectivamente, recebem acento pelo mesmo
motivo que:
a) Baú, sofá, possível.
b) Até, já, ausência.
c) Nós, até, canário.
d) Caí, será, última.
e) Pés, saúde, notícia.
99. (CONSULPLAN / Analista de Sistemas / INB / 2006)
A alternativa em que as três palavras são acentuadas pela mesma razão é:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 91 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

a) Energético ± década ± responsável.


b) País ± característica ± construídas.
c) Média ± petróleo ± dependência.
d) Atrás ± óleo ± gás.
e) Responsáveis ± indústria ± será.

Gabaritos

1. INCORRETA
2. CORRETA
3. LETRA D
4. INCORRETA
5. LETRA C
6. LETRA E
7. LETRA C
8. LETRA A
9. LETRA A
10. LETRA B
11. LETRA C
12. CORRETA
13. INCORRETA
14. CORRETA
15. LETRA C
16. CORRETA
17. LETRA D
18. INCORRETA
19. INCORRETA
20. CORRETA
21. CORRETA
22. INCORRETA
23. LETRA B
24. LETRA C
25. CORRETA
26. INCORRETA
27. INCORRETA
28. LETRA C
29. LETRA A
30. INCORRETA
31. INCORRETA
32. INCORRETA
33. INCORRETA
34. INCORRETA
35. INCORRETA
36. LETRA C
37. LETRA A
38. LETRA D
39. LETRA B
40. INCORRETA
41. LETRA D
42. CORRETA
43. LETRA E
44. LETRA D
45. LETRA A

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 92 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 00 ± Felipe Luccas Rosas

46. CORRETA
47. LETRA D
48. LETRA A
49. LETRA B
50. LETRA B
51. LETRA A
52. LETRA C
53. LETRA C
54. LETRA C
55. LETRA D
56. LETRA B
57. LETRA B
58. LETRA B
59. LETRA B
60. LETRA C
61. LETRA C
62. LETRA D
63. LETRA D
64. LETRA D
65. LETRA D
66. LETRA E
67. LETRA D
68. LETRA A
69. LETRA A
70. LETRA B
71. LETRA C
72. LETRA E
73. LETRA C
74. LETRA B
75. LETRA D
76. LETRA D
77. LETRA B
78. LETRA D
79. LETRA B
80. LETRA D
81. LETRA D
82. LETRA C
83. LETRA A
84. LETRA C
85. LETRA C
86. LETRA E
87. LETRA A
88. LETRA B
89. LETRA A
90. LETRA B
91. LETRA B
92. LETRA E
93. LETRA B
94. LETRA B
95. LETRA E
96. LETRA E
97. LETRA C
98. LETRA C
99. LETRA C

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 93 de 93


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

VXMHLWRHQWmRR³TXH´VHUiVXMHLWR´

9 Sujeito: Estes são os atletas que representarão o nosso país.


9 Objeto Direto: Comprei o fone que você queria.
9 Objeto Indireto: Este é o curso de que preciso.
9 Complemento Nominal: Estas são as medicações de que ele tem
necessidade.
9 Agente da Passiva: Este é o animal por que fui atacado.
9 Adjunto Adverbial: O acidente ocorreu no dia em que eles chegaram.
(adjunto adverbial de tempo).
9 Predicativos do sujeito: Ela era a esposa que muitas gostariam de ser.
Pronome de tratamento: concordam com a terceira pessoa, mas se
referem à segunda. O macete é pensar na concordância com o pronome ³9RFr´.
Vossa senhoria nomeará seu substituto. (E não Vosso ou Vossa. Concordância
com senhoria, o núcleo da expressão. 2YHUERWDPEpPQmRp³QRPHDUHLV´)
Os Adjetivos e Locuções de voz passiva concordam com o sexo da pessoa a que
se refere, não com o substantivo que compõe a locução (Excelência, Senhoria).
Sua Excelência X Vossa Excelência
8VDPRV³6XD([FHOrQFLD´SDUDVHUHIHULUDXPDWHUFHLUDSHVVRDH³9RVVD([FHOrQFLD´
para nos referirmos diretamente à autoridade.

Lista das questões comentadas

1. (CONSULPLAN / PREF. DQ CAXIAS / AUX ADM / 2015)


³1D~OWLPDquartaǦfeira, estávamos eu, ...´. A palavra sublinhada faz o plural
da mesma forma que:
a) arcoǦíris.
b) beijaǦflor.
c) guardaǦcivil.
d) abaixoǦassinado.
2. (CESPE / TL / Agente de Polícia Legislativa / 2014)
A atividade policial pode ser verificada em quase todas as organizações políticas que
conhecemos, desde as cidades-estado gregas até os Estados atuais. Entretanto, o
seu sentido e a forma como é realizada têm variado ao longo do tempo. A ideia de
polícia que temos hoje é produto de fatores estruturais e organizacionais que
moldaram seu processo histórico de transformação.
Considerando os sentidos e aspectos linguísticos do texto acima, julgue o item
a seguir.
$VXEVWLWXLomRGH³FLGDGHV-HVWDGR´SRU³cidades-estados" não prejudicaria a

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 100 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

correção gramatical do texto.


3. (CESPE / SEDF / 2017)
Mesmo sem insistir em tal ou qual ação secundária das novas condições de
vida física e social e de contato com os indígenas (e posteriormente com os
africanos), é obvio que a língua popular brasileira tinha de diferençar-se
inelutavelmente da de Portugal, e, com o correr dos tempos, desenvolver um
coloquialismo.
2VYRFiEXORV³DIULFDQRV´H³FRUUHU´RULJLQDOPHQWHSHUWHQFHQWHVjFODVVHGRV
adjetivos e dos verbos, respectivamente, foram empregados como
substantivos no texto.
4. (CESPE / TJ / TRE-ES / 2011)
Convocada por D. Pedro em junho de 1822, a constituinte só seria instalada
um ano mais tarde, no dia 3 de maio de 1823, mas acabaria dissolvida seis
meses depois, em 12 de novembro.
Com base nas estruturas linguísticas e semânticas do texto acima, julgue o
item.
No primeiro parágrafo do texto, as formas nominais "Convocada", "instalada"
e "dissolvida" têm como substantivos correlatos, respectivamente,
convocação, instalação e dissolvição.
5. (CESPE/ SEDF / 2017)

O emprego do diminutivo no texto está relacionado à expressão de afeto e ao


gênero textual: carta familiar.
6. (CESPE / SEDF / 2017)
Eu seria o último dos mortais a duvidar que os bons escritores foram
abençoados com uma dose inata de fluência mais sintaxe e memória para as
palavras. Ninguém nasceu com competência para redigir.
A SDODYUD³~OWLPR´IRLHPSUHJDGDFRPYDORUGHVXEVWDQWLYR
7. (CONSULPLAN / TSE / TÉCNICO / 2012)
Analogamente, você ficará bem se levar um bom vinho para o almoço de Dia
das Mães na casa da sogra. Experimente, porém, sacar a carteira e estender-
OKH5DRILPGDUHIHLomRHVHWRUQDUi³SHUVRQDQRQJUDWD´SDUDVHPSUH

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 101 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

naquele lar.
Essas incongruências chamaram a atenção de economistas comportamentais,
que desenvolveram modelos para explicá-las. Aparentemente, vivemos em
dois mundos distintos, o das relações sociais e o da economia de mercado.
Enquanto o primeiro é regido por valores como amor e lealdade, o segundo
tem como marca indexadores monetários e contratos. Sempre que
misturamos os dois registros, surgem mal-entendidos.
O economista Dan Ariely vai mais longe e propõe que, no mundo das relações
sociais, o presente serve para aliviar culpas: ofereça ao presenteado algo de
que ele goste, mas acha bobagem comprar, como um jantar naquele
restaurante chique ou um perfume um pouco mais caro. O que você está lhe
dando, na verdade, é uma licença para ser extravagante.

Assinale a palavra que, no texto, exerça papel adjetivo.


a) dois (L. 1) b) mais (L. 14) c) bem (L. 16) d) regido (L. 8)
8. (FGV / MPE / Técnico / 2016)
Segundo o gramático Celso Cunha, os adjetivos em língua portuguesa
expressam qualificações, características, estados e relações; o adjetivo abaixo
que expressa relação é:
a) fácil entendimento;
b) linguagem objetiva;
c) profissionais qualificados;
d) prática clínica;
e) informação transparente.
9. (CONSULPLAN / CFESS / ASS. TÉCNICO / 2017)
Das frases a seguir, apenas uma apresenta adjetivo no superlativo absoluto
sintético. Assinale-a.
a)O bem-te-vi é tão grande quanto o sabiá.
b) O bem-te-vi é o maior pássaro dessa mangueira.
F ³«TXHUHMXiVWRGRVD]XLVGHFRUILQtVVLPD«´
G ³«DQGDPPXLWRUHEHOGHVHQRYLGDGHLUDV«´
10. (CONSULPLAN / PREF. CANTAGALO / DENTISTA / 2013)
1DIUDVH³E no entanto, ela continua afiadíssima, encaixando-se nas mãos da
cozinheira...´, há um adjetivo no grau
a) comparativo de igualdade.
b) superlativo absoluto analítico .
c) superlativo absoluto sintético.
d) comparativo de superioridade.
e) superlativo relativo de superioridade.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 102 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

11. (FGV / CODEMIG / Advogado Societário / 2015)


³$ PDLRU DPHDoD j GHPRFUDFLD j MXVWLoD VRFLRHFRQ{PLFD H DR FUHVFLPHQWR
econômico neste país é que predomina a ideia de controle monopolista de
algumas empresas sobre a economia". (Nelson Mandela)
Assinale o comentário adequado aos componentes da citação de Nelson
Mandela sobre democracia:
D RYRFiEXOR³PDLRUHTXLYDOHjIRUPDVXSHUODWLYDGRDGMHWLYR³JUDQGH
E RDFHQWRJUDYHHP³jGHPRFUDFLDWHPVHXHPSUHJRMXVWLILFDGRSRUUD]mR
GLIHUHQWHGRWHUPR³jMXVWiça socioeconômica";
F QRWHUPR³QHVWHSDtVDIRUPDGRGHPRQVWUDWLYR³HVWHpMXVWLILFDGDSHOD
referência ao tempo presente;
G DH[SUHVVmR³pTXHWHPYDORUH[SOHWLYRRXVHMDSRGHVHUUHWLUDGDGRWH[WR
sem prejuízo da forma ou do sentido;
e) o conectRU³VREUHHVWiPDOHPSUHJDGRGHYHQGRVHUVXEVWLWXtGRSRU³VRE
12. (Comvest / UFAM / 2016)
Assinale a alternativa na qual consta frase que tem um adjetivo expresso no
grau superlativo absoluto sintético:
a) Não visitar as cidades barrocas de Minas tornou a minha viagem
paupérrima
b) Devido à falta de leitura, a redação dos alunos que prestam vestibular é
muito fraca
c) O inverno deste ano foi mais rigoroso do que o do ano passado
d) Eduardo é o aluno mais inteligente da classe
e) Ganhei uma camisa amarelo-limão, cor da qual não gosto muito.
13. (CONSULPLAN / ASSISTENTE SOCIAL / 2015)
³'LQKHLURpDFRLVDPDLVLPSRUWDQWHGRPXQGR´
Nessa frase, há um adjetivo no grau
a) comparativo de igualdade.
b) comparativo de superioridade.
c) superlativo absoluto analítico.
d) superlativo relativo de superioridade.
14. (FGV / Analista Portuário / CODEBA / 2016)
A frase a seguir em que o adjetivo sublinhado permanece com o mesmo
significado independentemente de estar anteposto ou posposto ao substantivo
é:
a) Cuidado com todas as atividades que requeiram roupas novas.
b) O que é a felicidade além da simples harmonia entre o homem e a vida
que ele leva?
c) Um bom lugar para começar é de onde você está.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 103 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

d) A humanidade está adquirindo toda tecnologia certa pelas razões erradas.


e) Um cozinheiro famoso possui sempre uma velha panela de estimação.
15. (CESPE / Anvisa / 2016)
Para falar de saúde, precisamos aprender o idioma da saúde. Não é fácil. A
SUySULDSDODYUD³VD~GH´TXHXVDPRVVREUHWXGRSDUDalguém que espirra, soa
SURVDLFDFRQYHQFLRQDOEDEDFDDWp³eRPDLVWRORYRFiEXORHPQRVVRLGLRPD´
disse, com desprezo, o iconoclasta Oscar Wilde.
No que se refere às ideias e às estruturas linguísticas do texto, julgue o item
seguinte.
Caso se alterassH D RUGHP GRV WHUPRV HP ³R LFRQRFODVWD 2VFDU :LOGH´ O4)
para o Oscar Wilde iconoclasta, haveria mudança do significado original do
WH[WR PDV DV IXQo}HV VLQWiWLFDV GH ³2VFDU :LOGH´ H GH ³LFRQRFODVWD´
permaneceriam inalteradas.
16. (VUNESP / Oficial Promotoria / MPE-SP / 2016)
No trecho ± Bombeiros mineiros deverão receber treinamento... ±, a
expressão em destaque é formada por substantivo + adjetivo, nessa ordem.
Essa relação também se verifica na expressão destacada em:
a) Entrou silenciosamente, com um espanto indisfarçável.
b) Estiveram presentes à festa meus estimados padrinhos.
c) Trata-se de um lutador bastante forte e preparado.
d) A imprudente atitude do advogado trouxe-me danos.
e) Alguma pessoa teve acesso aos documentos da reunião?
17. (FGV / OF. CHANCELARIA / MRE / 2016)
Os adjetivos mostram diferentes valores em nossa língua; o valor indicado
inadequadamente é:
a) rochas distantes/localização;
b) pés sobre-humanos/qualidade;
c) grandes naus/característica;
d) pés redondos/forma;
e) pés barrentos/matéria.
18. (FGV / COMPESA / 2016)
Em todas as frases a seguir, as locuções adjetivas sublinhadas foram
substituídas por adjetivos.
Assinale a fra se em que a substituição foi inadequada.
D ³1XQFDQLQJXpPFRQVHJXLUiLUDRIXQGRGHXPULVRde criança´LQIDQWLO
E ³8PEHErpDRSLQLmRde Deus GHTXHDYLGDGHYHULDFRQWLQXDU´GLYLQD
F  ³2V DYDUHQWRV VmR FRPR DV EHVWDV de carga: carregam o ouro e se
DOLPHQWDPGHDYHLD´FDUUHJDGDV
G ³2VSDUDQRLFRVWrPLQLPLJRVde verdade´YHUGDGHLUos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 104 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

H  ³(VWDU FRP UDLYD p VHYLQJDU GDV IDOKDV dos outros HP QyV PHVPRV´ 
alheias.
19. (CESPE / Telebrás / 2015) Adaptada
´VHGHVWDFDDFULDomRGHXPDDJrQFLDUHJXODGRUDLQGHSHQGHQWHHDXW{QRPD
D$1$7(/´
$ VXEVWLWXLomR GH ³DXW{QRPD´ SRU FRP autonomia prejudicaria a correção
gramatical do texto.
20. (CESPE / TRE-RS / 2015) Adaptada
³$QHFHVVLGDGHGHFRQYRFDomRGHJUDQGHQ~PHURGHHOHLWRUHVSDUDDWXDUFRPR
HVFUXWLQDGRUHVWDPEpPWUD]JUDQGHPDOHItFLR´
2VWHUPRV³GHFRQYRFDomRH³GHJUDQGHQ~PHUo de eleitores" desempenham
a mesma função sintática.
21. (FGV / DPE-RO / Analista / 2015)
O termo sublinhado que funciona como adjetivo do termo anterior é:
a) construção da ponte;
b) invasão do terreno;
c) análise dos documentos;
d) clima da região;
e) observação dos astros.
22. (CESPE / STJ / 2012)
A um coronel que se queixava da vida de quartel, um jornalista disse:
² E o senhor não sabe como é chato militar na imprensa.
Com relação às ideias e aos aspectos linguísticos do trecho acima, julgue o
item a seguir. Na construção do sentido do texto, destaca-se a ambiguidade
GRYRFiEXOR³PLOLWDU´TXHQRFRQWH[WRHPTXHDSDUHFHSRGHVHUFODVVLILFDGR
ora como substantivo, ora como verbo.
23. (CESPE / SEDF / 2017)

&RPRPRGLILFDGRUDGDVSDODYUDV³SUD]HU´H³HQJUDoDGLQKD´DSDODYUD³PXLWR´
que as acompanha é, do ponto de vista morfossintático, um advérbio.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 105 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

24. (Comperve / Guarda Legislativo / 2016)


Primeiramente, porque tem um portfólio de produtos extremamente amplo,
que deve ser integrado a diversas tecnologias de diferentes marcas e aspectos.
A palavra extremamente
D UHGX]RVHQWLGRGRVXEVWDQWLYR³SRUWIyOLR´
E PRGLILFDRVHQWLGRGRVXEVWDQWLYR³SURGXWRV´
F DFHQWXDRVHQWLGRGRDGMHWLYR³DPSOR´
G FRPSOHWDRVHQWLGRGDIRUPDYHUEDO³WHP´
25. (CONSULPLAN / PREF. CASCAVEL / AG. COMUNIT. / 2016)
No trecho ³2XWURIDWRULPSRUWDQWHDVHUOHYDGRHPFRQVLGHUDomRpRJUDQGH
apelo erótico emitido pelos meios de comunicação, frequentemente
direcionado ao DGROHVFHQWH´, a expressão destacada exprime ideia de
a) modo. b) ordem. c) dúvida. d) escolha. e) inclusão.
26. (CONSULPLAN / PREF. CARATINGA / AUX. ADM. / 2015)
Assinale a afirmativa, transcrita do texto, que exprime circunstância de modo.
D ³R%UDVLODLQGDSUHFLVDSHUFRUUHUXPORQJRFDPLQKR´
E ³,QIHOL]PHQWHR%UDVLODLQGDWHPPXLWRTXHDSUHQGHUHPHOKRUDU´
F ³7RUQRX-se lugar comum dizer que o Brasil têm inúmeros problemas
e que há enormes dificuldades em VHUHPVROXFLRQDGRV´
G ³$OpPGLVVRPXLWDVYH]HVDVGRHQoDVGRVSDFLHQWHVHQFDPLQKDGRVDRV
hospitais poderiam ser evitadas, com ações mais efetivas na área da
prevenção ou se traWDGDVHPHVWiJLRLQLFLDO´
27. (FCC / TRT-MG / Analista Judiciário / 2015)
A guerra continua, está aí, espalhada pelo mundo, camuflada por diferentes
nomenclaturas, inconfundível, salvo em breves hiatos sem hostilidades, porém
com intensos ressentimentos.
Justifica-se o emprego do advérbio aí, na frase, do seguinte modo:
a) a palavra delimita o lugar da guerra, aquele em que o interlocutor se
encontra.
b) a palavra remete ao lugar a que se fez referência anteriormente: ao
espaço dos Aliados
c) a palavra tem o sentido de "nesse ponto", como em "É aí que está o X da
questão".
d) a palavra compõe expressão que tem o sentido de "apresenta-se por
lugares incertos, de modo disseminado".
e) a palavra tem seu sentido associado ao da palavra inconfundível, para
expressarem, juntas, a ideia de "contorno único".
28. (CESPE / Diplomata / 2015) Adaptada
Distingo, no português histórico, dois períodos principais: o português antigo,

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 106 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

que se escreveu até os primeiros anos do século XVI, e o português moderno.


Robustecida e enriquecida de expressões novas, a linguagem usada nas
crônicas desse segundo período, que relatam os descobrimentos em África e
Ásia e os feitos das armas lusitanas no Oriente, culmina no apuro e no gosto
GR SRUWXJXrV PRGHUQR G¶2V /XVtDGDV   e R VpFXOR GD 5HQDVFHQoD
literária, e tudo quanto ao depois se escreve é a continuação da linguagem
desse período. E como não ficou estacionário o português moderno,
denominou-se quinhentista, seiscentista, setecentista a linguagem própria a
cada era. Reservo a denominação de português hodierno para as mudanças
características do falar atual criadas ou fixadas recentemente, ou recebidas do
século XIX, ou que por ventura remontam ao século XVIII.
(PWH[WRVFRQWHPSRUkQHRVDH[SUHVVmR³SRUYHQWXUD´WHPFRPRYDULDQWHR
vocábulo porventura, cujo sentido equivale a talvez.
29. (Vunesp / UNIFESP / Téc. Segurança do Trabalho / 2016)
Observe as passagens:
± «Hagora quer começar uma carreira médica.;
± «HOHWHPDQRVIsto mesmo, 80.;
± Talvez a expectativa de vida não permita.
As expressões destacadas expressam, respectivamente, sentido de
a) lugar, modo e causa.
b) tempo, afirmação e dúvida.
c) afirmação, afirmação e dúvida.
d) tempo, modo e afirmação.
e) modo, dúvida e intensidade.
30. (CESPE / Polícia Federal / 2014)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 107 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

2VWHUPRV³/i´ O H³Fi´ O VmRXWLOL]DGRVFRPRUHFXUVRVSDUDH[SUHVVDU


circunstância de lugar, o primeiro referindo-VH D ³RXWUDV SDUWHV GR PXQGR´
(l.8) e o segundo, ao Brasil.
31. (IFBC / EBSERH / 2017)
4XH p TXH YRFr Mi OHX GH PLP"³ ³4XDVH WXGR só falta A cidade sitiada e A
OHJLmRHVWUDQJHLUD´
1D IDOD ³Quase tudo, só falta A cidade sitiada e A legião estrangeira´ R
vocábulo em destaque denota um sentido de:
a) retificação. b) explicação. c) exclusão. d) adição. e) anulação.
32. (FCC / SEDU-ES / 2016)
Um dos elementos mais importantes na organização do texto de Clarice
Lispector é o advérbio de tempo, como o que se encontra grifado em:
I. Jamais esquecerei o meu aflitivo e dramático contato com a eternidade.
II. E eis-me com aquela coisa cor-de-rosa, de aparência tão inocente, tornando
possível o mundo impossível do qual eu já começara a me dar conta.
III. ± E agora que é que eu faço? ± perguntei para não errar no ritual que
certamente deveria haver.
IV. Enquanto isso, eu mastigava obedientemente, sem parar.
Atende ao enunciado APENAS o que consta de
a) I, II e IV.
b) II e IV.
c) II e III.
d) I e III.
e) I, III e IV.
33. (CESPE/ ANCINE / ESPECIALISTA / 2013)
A supressão da expressão ³e  TXH´, no trecho ³eQRDXJHGDHPRomRQR
palco que o esSHFWDGRU GH WHDWUR UHFRUUH DRV ELQyFXORV´, não prejudicaria o
sentido original do texto, podendo o segmento ser corretamente reescrito da
seguinte forma: No auge da emoção no palco, o espectador de teatro recorre
aos binóculos.
34. (CESPE / CEEE-RS / ADMINISTRADOR / 2005)
Na frase "São as pessoas raivosas que mudam o mundo", as palavras "São" e
"que" podem ser ambas retiradas sem que ocorra erro gramatical ou qualquer
prejuízo para a argumentação do texto.
35. (Ministério Público-SC / Promotor de Justiça / 2016)
Em ³(VVDWDPEpPpDSULPHLUDYH]´há ideia de inclusão.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 108 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

36. (CESPE / Auditor / TCE-RN / 2015)

Considerando as estruturas linguísticas e os sentidos do texto Uma breve


história do controle, julgue o próximo item.
2VDGYpUELRV³,QLFLDOPHQWH´ / H³ORJR´ / DWXDPFRPRVHTXHQFLDGRUHV
textuais cuja função é organizar a sequência temporal relativa ao registro das
atividades contábeis na Mesopotâmia.
37. (KLC / Enfermeiro / 2016)
I - ³'RVFOLHQWHVGD3ODQHW+RVSLWDOVmRFDVDLVKRPRVVH[XDLVTXHTXHUem
WHUILOKRVELROyJLFRV´
II ± ³2VRXWURVVmRFDVDLVKHWHURVVH[XDLVJHUDOPHQWHFRPPDLVGHDQRV´
Assinale o que for correto sobre o emprego dos numerais nessas expressões.
a) Em I e II, os numerais são escritos em romano, classificados como
ordinais.
b) Em I e II, os numerais são escritos em arábico, classificados como
ordinais.
c) Em I e II, os numerais são escritos em romano, classificados como
fracionários.
d) Em I e II, os numerais são escritos em arábico, classificados como
multiplicativos.
e) Em I e II, os numerais são escritos em arábico, classificados como
cardinais.
38. (IOBV / Procurador Municipal / 2016)
Quanto à classificação dos numerais, os que indicam o aumento proporcional
de quantidade, podendo ter valor de adjetivo ou substantivo são os numerais:
a) Multiplicativos. b) Ordinais. c) Cardinais. d) Fracionários.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 109 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

39. (FGV / AL-BA / Redação e Revisão Legislativa / 2014)


Assinale a opção em que o vocábulo a está classificado erradamente.
a) A contar com ele, todos estaríamos perdidos. / conjunção condicional
b) Eu não conheço a que está de roupa clara. / pronome demonstrativo
c) Na opção a o erro de concordância é visível. / numeral ordinal
d) Esse é o leite classe a. / adjetivo
e) Não sei a que se refere o texto. / preposição
40. (FGV / Funarte / 2014)
Há, no texto da crônica, um conjunto de elementos que expressam
quantidade. A alternativa em que o termo sublinhado NÃO tem esse valor é:
D  ³+i HP QRVVR SRYR duas constantes que nos induzem a sustentar que o
%UDVLOpR~QLFRSDtVEUDVLOHLURGHWRGRRPXQGR´
E ³$GLDPRVWXGR REHPHRPDO RERPHRPDXTXHQmRVH FRQIXQGHP
mas tantas YH]HVVHGHVHPSDUHOKDP´
F ³6yDPRUWHHDSURPLVVyULDVmRmais ou menos pontXDLVHQWUHQyV´
G ³HQFRQWUHLQRILPGRYROXPHalgumas informações essenciais sobre nós e
VREUHDQRVVDWHUUD´
H  ³(QWUH poucos endereços de embaixadas e consulados, estatísticas,
LQGLFDo}HVFXOLQiULDVRDXWRULQWHUFDORXRVHJXLQWHWySLFR´
41. (FGV / Técnico Legislativo / 2012) Adaptada
Assinale a palavra que, no texto, exerça papel adjetivo.
a) dois´SDUDFLWDUDSHQDVGRLVSHFDGLOKRV´
b) promovido´como defensor do ambiente por ter promovido´
F EHP´os super-mercados acabam se dando bem´
d) pagos´que terão de ser pagos pelos consumidores´
e) estorvo´as sacolas são um estorvo´
42. (CESPE / AUDITOR / TCE-ES / 2012) Adaptada
Julgue o item subsequente. 2HPSUHJRGRSOXUDOHP³2,4 ELOK}HV´HGRVLQJXODU
HP ³ 1,2 ELOKmR´ GHYH-se à presença GRV QXPHUDLV ³´ H ³´
respectivamente.
43. (CESPE / SEDF / 2017)
O aspecto da implantação do português no Brasil explica por que tivemos, de
início, uma língua literária pautada pela do Portugal contemporâneo.
O emprego do artigo definido imediatamente DQWHVGRWRS{QLPR³3RUWXJDO´
torna-VHREULJDWyULRGHYLGRjSUHVHQoDGRDGMHWLYR³FRQWHPSRUkQHR´
44. (CONSULPLAN / PREF. CASCAVEL / TÉC. TOPOGR. / 2016)
De acordo com o texto, assinale a alternativa INCORRETA.
A) A exposição na internet influencia no desenvolvimento da criança.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 110 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

B) Para as crianças as profissões mais atraentes estão ligadas à internet.


C) As respostas das crianças em relação à profissão estão ligadas ao que elas
conhecem do mundo.
D) Apesar da internet proporcionar um sucesso momentâneo, isso não afeta o
emocional das crianças que desfrutam dele.
E) A ausência de espaço público para interação é um dos motivos que levam
as crianças a recorrerem aos canais na internet.
45. (CONSULPLAN / PREF. COIMBRA / AUX. ADM. / 2014)
³6HJXQGRRVWpFQLFRVVHQmRIRUVRFRUULGDHVVDiUYRUHGHYHUiPRUUHUGHQWUR
em breve: pois a pancada que a atingiu afetouǦa na profundidade da sua vida.´
(2º§) Os termos anteriormente destacados podem ser classificados, respectiǦ
vamente, como
A) artigo, preposição e artigo. D) artigo, preposição e preposição.
B) artigo, pronome e pronome. E) pronome, pronome e preposição.
C) preposição, pronome e artigo.
46. (FGV / Auditor / ISS Cuiabá / 2016)
Assinale a opção que indica a frase em que a preposição de tem sua presença
na frase por uma exigência de um termo anterior.
$ ³PLQKDPHPyULDWUD]RVWHPSRVGHHVWXGR´
% ³PHXVDQRVGH(QVLQR0pGLRIRUDPVLPPXLWRVLJQLILFDWLYRV´
& ³WHQKRSOHQDFRQVFLrQFLDGHTXHXPHQVLQRLQRYDGRUSRGHVXUJLU´
' ³XPDURGDGHFRQYHUVDQDHVFROD´
( ³QRVSHUPLWHHQWUDUHPFRQWDWRGHIRUPDVLVWHPiWLFD´

47. (CESPE / SEDF / 2017)


Quanta inútil retórica se tem desperdiçado para provar que todos os nossos
PDOHVILFDULDPUHVROYLGRV«
$ SUHSRVLomR ³SDUD´ LQWURGX] QR período em que ocorre, uma ideia de
finalidade..
48. (CONSULPLAN / PREF. CONGONHAS / PROFESSOR / 2010)
2VWHUPRVGHVWDFDGRVHP³Para FRQWURODU´³!mas QmRFRQWULEXHP´ H³Por
issoQmRID]VHQWLGR´expressam, respectivamente, ideia de:
a) Finalidade, oposição, conclusão.
b) Conclusão, explicação, conclusão.
c) Finalidade, explicação, explicação.
d) Conclusão, oposição, explicação.
e) Explicação, oposição, causa.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 111 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

49. (CESPE/ DIPLOMATA / 2015)


A omissão da preposição ³Dem ³WRPDQGRSRUEDVHDQós mesmos" e em ³$
conclusão a que devemos chegar" prejudicaria a correção gramatical desses
dois trechos.
50. (CESPE / Telebrás / 2015) Adaptada
O sinal indicativo de crase em ³SURWHomRjVUHGHV´ justifica-se pela contração
da preposição a, exigida pelo substantivo ³SURWHomR´ com o artigo definido
feminino as, que determina o vocábulo ³UHGHV´
51. (CESPE / TEFC / Apoio Técnico e Administrativo / 2007)
Num país territorialmente gigante, em que a censura restringe o
acesso à rede para milhões de usuários, a Internet tende a se tornar a
ferramenta de maior integração nacional ao aproximar moradores urbanos e
rurais, que falam dialetos variados, mas que têm apenas um tipo de escrita.
A respeito das estruturas e das ideias do texto acima, e considerando a atual
fase de modernização econômica da China, que busca acompanhar a evolução
tecnológica mundial em marcha, julgue os itens seguintes.
O vocábulo inicial do texto, "Num", corresponde, no padrão culto da língua, à
contração entre Nem e um.
52. (ESAF / CGU / Auditoria e Fiscalização / 2012)
Assinale o conectivo que provoca erro gramatical e/ou incoerência textual ao
preencher a lacuna do fragmento abaixo:
A dívida pública mobiliária tem algumas características específicas. No que diz
respeito à participação dos indexadores da dívida, continua crescendo a
participação dos títulos atrelados à Selic (64,6% do total), ___________ sua
alta rentabilidade, segurança e liquidez; enquanto os títulos prefixados
mantêm uma posição em torno de 35,5%. Quanto ao prazo, os títulos emitidos
pelo BCB e pelo Tesouro Nacional têm prazo médio de 40,19 meses.
a) devido à
b) ademais de
c) em face de
d) em função de
e) haja vista
53. (FGV / Prefeitura de Paulínia / Engenheiro / 2016)
³2IDODUpSHULJRVRSDUDDVQRVVDVLOXV}HV´
Sobre os componentes do fragmento acima, assinale a afirmativa incorreta.
D 2WHUPR³RIDODU´pXPH[HPSORGHSDODYUDVXEVWDQWLYDGD
E  1R DGMHWLYR ³SHULJRVR´ R VXIL[R -oso forma adjetivos a partir de
substantivos.
c) A preposiomR³SDUD´PRVWUDYDORUGHILQDOLGDGH
G 2SURQRPHSRVVHVVLYR³QRVVDV´WHPYDORUXQLYHUVDO

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 112 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

H 2DGMHWLYR³SHULJRVR´H[SUHVVDXPDRSLQLmRGRHQXQFLDGRU-
54. (Cespe / FUB / Cargos de Nível Médio / 2011)
Em ³LPSRUWDUGRV(VWDGRV8QLGRVGD$PpULFD´, a preposição de, contida em
³GRV´ expressa ideia de procedência.
55. (CESPE / TJ-ES / Analista Judiciário / 2011)
A substituição da locução ³D ILP GH´ DJDFKDU-se sob o túmulo a fim de
escapar dos golpes...) por para manteria a correção gramatical e o sentido
original do texto.
56. (FGV / Auditor / ISS-Cuiabá / 2016)
³eGLVVRTXHWUDWDDHGXFDomRIRUPDULQGLYtGXRVHQJDMDGRVXQVFRPRVRXWURV
socialmente e que saibam conviver. Está aí também a grande diferença da
HGXFDomRIDPLOLDUTXDQGRFRQYLYHPRVDSHQDVFRPQRVVRVSDUHV´
Nesse segmento do texto, o termo aí
(A) tem como referente o momento de engajamento social.
(B) refere-se a um lugar, mais especificamente, o espaço escolar.
(C) liga-se a um termo anterior, representativo de uma ação.
(D) indica simultaneamente tempo e lugar como realidades indistintas.
(E) possui valor estilístico, sendo semanticamente expletivo.
57. (CESPE / SEDF / 2017)
Caso o vocábulo ³FHUWR´, em ³XP FHUWR FRQWH~GR´, fosse deslocado para
imediatamente após ³FRQWH~GR´ VHULDP DOWHUDGRV R VHQWLGR H DV UHODo}HV
sintáticas entre os termos da oração em que o trecho ocorre.
58. (IBFC / EBSERH / Advogado / 2017)
(P ³Há algum tempo venho afinando certa mania´, nota-se que o termo
destacado pertence à seguinte classe gramatical:
a) substantivo. b) adjetivo. c) pronome. d) advérbio. e) interjeição.
59. (CONSULPLAN / PREFEITURA DE CASCAVEL-PR / 2016)
De acordo com a classe de palavras, assinale a relação INCORRETA.
a) ³'HVVDIRUPDRMRYHPVHYrIUHQWHDXPHQRUPHOHTXHGHSRVVLELOLGDGHV
e opções e, por sua vez, quer explorar e experimentar tudo DVXDYROWD´±
Pronome.
E ³2EVHUYD-se, também, que muitas jovens abrem mão do preservativo
por medo de serem abandonadas ou maltratDGDV SRU VHXV SDUFHLURV´ ±
Advérbio.
F  ³([LVWHP algumas características comportamentais, socioeconômicas e
biológicas que fazem com que os jovens sejam um grupo propenso à infecção
SHOR+,9´ ± Conjunção.
G ³2XWURIDWRU importante a ser levado em consideração é o grande apelo
erótico emitido pelos meios de comunicação, frequentemente direcionado ao
DGROHVFHQWH´ ± Adjetivo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 113 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

H  ³$ DGROHVFrQFLD p XP SHUtRGR GD YLGD FDUDFWHUL]DGR SRU LQWHQVR


crescimento e desenvolvimento, que se manifesta por transformações físicas,
SVLFROyJLFDVHVRFLDLV´ ± Preposição. -
60. (Procurador Jurídico / Mongaguá / 2016)
2XVRGH³bastante´HVWiLQFRUUHWRHP
a) Ficamos bastante distante da igreja.
b) Estamos bastante felizes com a decisão de Carla.
c) Existem bastantes carros no estacionamento.
d) Possuíamos planos bastantes para continuar no trabalho.
e) O juiz apresentou provas bastante para condenar o réu.
61. (IFBC / MGS / Técnico Contábil / 2016)

$FODVVHJUDPDWLFDOGDSDODYUD³PHLR´presente na tira acima é:

a) numeral b) adjetivo c) substantivo d) advérbio


62. (CESPE / CPRM / 2013) Adaptada
³$SHVDUGHFHUWDUHWHQomRHPRYDORUGDPDLRULDGRVPHWDLVWHQGHD
FRQWLQXDUHPDOWD´
Com relação aos sentidos e às estruturas linguísticas do texto acima, julgue
os itens que se seguem.
Feitas as necessárias alterações na grafia das palavras, o deslocamento do
YRFiEXOR ³FHUWD´ SDUD ORJR DSyV R VXEVWDQWLYR D TXH VH UHIHUH PDQWHULD D
correção gramatical e o sentido original do texto.
63. (CESGRANRIO / IBGE / SUPERVISOR / 2016) Adaptada
Em ³A barriga dos pobres já não ronca. Seu vazio não tem o conforto da
pUR[LPLGDGHGDSUy[LPDFRPLGD´, o pronome em destaque apresenta como
referente a palavra
a) fome b) Deus c) nós d) refeições e) barriga
64. (CESPE / Técnico Bancário / CEF / 2014) Adaptada
A moeda, como hoje é conhecida, é o resultado de uma longa evolução. No

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 114 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

início, não havia moeda, praticava-se o escambo. Algumas mercadorias, pela


sua utilidade, passaram a ser mais procuradas do que as outras. Aceitas por
todos, assumiram a função de moeda, circulando como elemento trocado por
outros produtos e servindo para avaliar-lhes o valor.
(P³servindo para avaliar-lhes o valor´RSURQRPH³lhes´TXHUHWRPD³outros
produtos´HTXLYDOe, em sentido, ao pronome seu.
65. (CESPE / Antaq / 2014) Adaptada
Um dos principais desafios para o Brasil é conhecer a amazônia. Sua vocação
eminientemente hídrica impõe, ao longo dos séculos, a necessidade de
deslocamento de seus habitantes através dos rios.
(PUHODomRDRWH[WRDFLPDMXOJXHRLWHPDVHJXLURSURQRPH³6XD´UHIHUH-se
DRDQWHFHGHQWH³$PD]{QLD´
66. ( FGV / CODEBA / 2016)
³$OJXPDVGDVVHVV}HVGHLQTXpULWRVmRWUDQVPLWLGDVSRUFDQDLVGHWHOHYLVmRH
acompanhadas por milhares de brasileiros interessados no resultado das
LQYHVWLJDo}HVFRQGX]LGDVSRUVHXVUHSUHVHQWDQWHVOHJLVODWLYRV´
Sobre os componentes desse segmento do texto, assinale a afirmativa
inadequada.
D ³WUDQVPLWLGDV´³DFRPSDQKDGDV´H³FRQGX]LGDVVmRSDODYUDVIRUPDOPHQWH
idênticas.
E   ³PLOKDUHV GH EUDVLOHLURV´ HTXLYDOH VHPDQWLFDPHQWH D ³EUDVLOHLURV DRV
PLOKDUHV´
F ³QRUHVXOWDGRGDVLQYHVWLJDo}HV´IXQFLRQDFRPRFRPSOHPHQWRGRDGMHWLYR
³LQWHUHVVDGRV´
G 2SRVVHVVLYR³VHXV´WHPSRUUHIHUHQWH³EUDVLOHLURV´
H $IRUPD³VHVV}HV´HVWiLQFRUUHWDGHYHQGRVHUVXEVWLWXtGDSRU³VHo}HV´
67. (Cesgranrio / UNIRIO / Pedagogo / 2016)
Em ³1RGLDVHJXLQWH RVMRUQDLVGLULDPTXHIRUDRPDLVTXHQWH deste verão
TXHLQDXJXUDRVpFXORHRPLOrQLR´o pronome destacado
a) torna ambíguo o termo referido.
b) marca a temporalidade do enunciado.
c) afasta o leitor da narração.
d) descentraliza o foco narrativo.
e) introduz um caráter irônico ao texto.
68. (FEPESE / Prefeitura de Florianópolis / 2016)
Analise a frase abaixo:
³2KRPHPHDPXOKHUHVWDYDP sorrindo.
_______________porque foi promovido;
_______________por ter recebido um aumento.
Assinale a alternativa que completa corretamente as lacunas da frase.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 115 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

D (VWH‡HVWD
E (VWH‡HVVD
F (VVH‡HVVD
G $TXHOH‡HVVD
H $TXHOH‡HVWD
69. (CONSULPLAN / CFESS / ASS. TÉCNICO / 2017)
³O que leva a crer no desaparecimento do bem-te-YLVmRDVPXGDQoDV´ ž†
A partícula grifada no excerto anterior, classifica-se como
A) artigo definido. C) pronome demonstrativo.
B) pronome pessoal. D) pronome de tratamento.
70. (CESPE / MPE-SC / 2016)
³$ )DPtOLD 6FKUPDQQ GH QDYHJDGRUHV EUDVLOHLURV FKHJRX DR SRQWR PDLV
distante da Expedição Oriente, a cidade de Xangai, na China. Depois de 30
anos de longas navegações, essa é a primeira vez que os Schürmann aportam
em solo chinês. A negociação para ter a autorização do país começou há mais
de três anos, quando a expedição estava em fase de planejamento. Essa
também é a primeira vez que um veleiro brasileiro recebe autorização para
DSRUWDUHPVRORFKLQrVGHDFRUGRFRPDVDXWRULGDGHVGRSDtV´
Na linguagem formal não se pode empregar este/esse indistintamente. O
pronome esse, por exemplo, informa o tempo não muito distante do momento
da fala/escrita ou é empregado ao se fazer referência a algo anteriormente
mencionado. Assim, ele está bem colocado, nas duas vezes em que aparece
no texto.
71. (Fumarc / CBTU / 2016)
Em ³2r[LWRHPQRVVDHGXFDomRSDVVDSRUXPDHYROXomRVHPHOKDQWH à que
aconteceu nos desportos ± da emoção para a razão´à é:
a) artigo definido.
b) pronome demonstrativo.
c) pronome indefinido.
d) preposição.
72. (IFSUL-MG / Assistente de Administração / 2016)
O psiquiatra norte-americano Ivan Goldberg publicou um artigo satírico em
seu site pessoal no qual ele descrevia um problema recém-descoberto e
batizado como IAD (sigla para Internet Addiction Disorder, ou Desordem do
Vício em Internet).
Hoje em dia temos milhares de casos em todo o planeta, incluindo no Brasil,
onde ainda é bastante difícil encontrar tratamento especializado para quem
sofre desse mal.
$VH[SUHVV}HVGHVWDFDGDVGRVWUHFKRV³QRTXDOele GHVFUHYLDXPSUREOHPD´
H ³SDUD TXHP VRIUH dessH PDO´ SHUWHQFHP D XPD FDWHJRULD GH SDODYUDV GD
língua que têm por função:
a) Indicar a retomada de informações introduzidas previamente em outras

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 116 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

passagens do texto.
b) Sinalizar as relações (temporais, causais, adversativas, por exemplo)
existentes entre blocos de informações.
c) Apresentar um cenário em cujo interior informações subsequentes devem
ser interpretadas.
d) Sintetizar as novas informações constantes no parágrafo seguinte.
73. (CONSULPLAN/PREF. SABARÁ / ADMINISTRADOR / 2017)
(P³dos quais QDVFHPRXWUDVSLFDGDV´ ž† RWHUPRHPGHVWDTXHWHP
como referente que retoma um objeto introduzido no texto:
A) Outras picadas.
B) Abertura de ramais.
C) Ramais secundários.
D) Regiões como a Amazônia.
74. (Vunesp / TJM-SP / Escrevente Judiciário / 2017)
8PWHUPRTXHH[SUHVVDVHQWLGRGH³SRVVH´HVWiGHVWDFDGRHP
a) Mas, por incontáveis gerações, eles não se destacaram...
b) ... da miríade de outros organismos com os quais partilhavam...
c) .. você poderia muito bem observar certas características...
d) ... idosos cansados que só queriam ficar em paz...
e) ... eles eram animais insignificantes, cujo impactosobre o ambiente...
75. (CONSULPLAN/PREF. SABARÁ / ADMINISTRADOR / 2017)
&DVRRWHUPR³GLILFXOGDGHV´WLYHVVHVLGRLQWURGX]LGRQRWH[WRDQWHULormente ao
WUHFKR³YHQFHUDVGLILFXOGDGHV´ ž†  KDYHULDFRUUHomRJUDPDWLFDOHFRHVLYD
sua substituição por:
A) Vencê-las. B) Vencê-lhes. C) Vencer-nas. D) Vencer-lhes.
76. (CONSULPLAN / TRF 2ª REGIÃO / ANALISTA / 2017)
$FHUFD GR YRFiEXOR ³onde´ QR WtWXOR ³Onde o Direito e a Literatura se
encontram´ GH DFRUGR FRP D DSOLFDomR e relação estabelecida, é correto
afirmar que
A) tem função anafórica no discurso como substituto de um circunstante
locativo.
B) faculta-VH D JUDILD ³GRQGH´ WHQGR HP YLVWD R VHQWLGR original que lhe é
atribuído.
C) emprega-se de modo absoluto como visto no verso ³0RURRQGHQmRPRUD
QLQJXpP´
D) tal advérbio interrogativo foi empregado em uma pergunta indireta em
referência a lugar.
77. (FCC / TRT 3ªREGIÃO / ANALISTA / 2015)
É adequado o seguinte comentário:
Em "A orientadora do grupo, a qual é excelente, faltou hoje", emprega-se o
que está em destaque para evitar o duplo sentido que o emprego da palavra
"que", em seu lugar, originaria.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 117 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

78. (FCC / TRT 14ª Região / 2016)


³,VWRSRGHGHVSHUWDUa atenção de outras pessoas que tenham documentos em
casa e se disponham a trazer para a Academia, que é a guardiã desse tipo de
acervo, que é muito difícil de ser guardado em casa, pois o tempo destrói e
aqui temos a melhor técnica de conservação de documentos", disse Cavalcanti.
O termo sublinhado faz referência a
a) pessoas. b) acervo. c) Academia. d) tempo. e) casa.
79. (CESPE / Prefeitura de SP / 2016) Adaptada
Assinale a opção correta a respeito dos aspectos linguísticos e dos sentidos do
último período do primeiro parágrafo do texto II: ³2V lixões deverão dar lugar
a aterros sanitários, que, se não representam uma solução perfeita, ao menos
são locais mais adequados para o depósito dos rejeitos, uma vez que evitam
problemas como os citados DQWHULRUPHQWH´
2SURQRPH³TXH´HP³TXH  DRPHQRVVmRORFDLVPDLVDGHTXDGRV´UHIHUH-
VHD³DWHUURVVDQLWiULRV´
80. (FCC / TCE-CE / Técnico / 2015)
Empregam-se corretamente as expressões destacadas em:
a) O crime racial constitui uma maneira de penalizar aqueles de que se
deixam levar por atitudes que rejeitam um outro a quem se é diferente.
b) As ações movidas por preconceito, aonde se observa um juízo prévio de
um indivíduo de que não se conhece muito bem, devem ser repreendidas.
c) A propagação de preconceitos, fenômeno pelo qual todos podemos ser
responsáveis, deve ser abrandada por penalizações rigorosas, às quais os
infratores estejam sujeitos.
d) O preconceito é uma maneira com que os grupos sociais encontraram para
excluir aqueles que são considerados estranhos e de quem não se confia.
e) As leis são um meio ao qual o preconceito pode ser contido, mas não
extinto, pois ele estará presente mesmo nas culturas às quais o punem com
rigor.
81. (FCC / TRT 14ª REGIÃO / Oficial de Justiça / 2016)
Está plenamente adequado o emprego de ambos os elementos sublinhados
em:
Mesmo àqueles meninos estudiosos não falta tempo para os joguinhos
eletrônicos com cujos se entretêm.
82. (FCC / TRT 14ª REGIÃO / Oficial de Justiça / 2016)
Está plenamente adequado o emprego de ambos os elementos sublinhados
em: As narrativas clássicas, a cuja mágica oralidade sentimo-nos presos,
competem com os meios da informática.
83. (FCC / Auditor Fiscal / ISS-Teresina / 2016)
A frase que está clara e correta, segundo a norma-padrão da língua, é:
Era seu intúito articular ações de erradicação da mendigância, para o quê

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 118 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

contava com a idoneidade dos colaboradores e sobretudo, com a discrição que


elas deveriam merecer.
84. (CESPE / DPU / 2016)
O vocábulo ³TXH´em ³LQFDSD]GHDUFDUFRPRVFXVWRVTXHXPDOLGHMXGLFLDO
LPS}H´, funciona como pronome relativo e retoma o termo antecedente.
85. (CESPE / TJ-DF / 2015) Adaptada
Acerca dos aspectos linguísticos do texto apresentado, julgue o item seguinte.
´os juízes que se deparam com o tema dos conflitos familiares e da violência
GRPpVWLFDDVVLVWHPDFHQDVGHYLROrQFLDH[WUHPD´o ³TXH" é um elemento
expletivo, empregado apenas para dar realce a ³2VMXt]HV
86. (Ministério Público / Rio Grande do Sul / 2016)
Assinale a alternativa que preenche correta e respectivamente as lacunas dos
enunciados abaixo.
1. Vossa Senhoria _____ apresentar imediatamente o relatório referente à
viagem.
2. Prezado Senador, é com alegria que recebemos a informação de que Vossa
Senhoria já está _____ da cirurgia.
3. Prezado Senador, informamos a Vossa Senhoria que o Senhor Ministro não
poderá _____ esta semana.
a) deve ± recuperado ± recebê-lo
b) deveis ± recuperada ± receber-vos
c) deveis ± recuperado ± receber-vos
d) deve ± recuperada ± recebê-lo
e) deve ± recuperado ± receber-vos

87. (CESPE / Técnico / TRE-MS / 2013)


Considerando a concordância dos pronomes de tratamento, uma comunicação
dirigida ao presidente do Senado Federal deverá ser redigida da seguinte
maneira: Vossa Excelência será informado da tramitação do projeto em pauta.
88. (CESPE / AnaTA / MDIC / 2014)
Levando em consideração as normas constantes do Manual de Redação da
Presidência da República, julgue o seguinte item. Em ³9RVVD([FHOrQFLDGHYH
HVWDU VDWLVIHLWD FRP RV UHVXOWDGRV GDV QHJRFLDo}HV´ o adjetivo estará
corretamente empregado se dirigido a ministro de Estado do sexo masculino,
pois o termo ³VDWLVIHLWD´ deve concordar com a locução pronominal de
tratamento ³9RVVD([FHOrQFLD´
89. (CESPE / SEDF / 2017) Adaptada
É evidente que a interlocução comunicativa permite o entendimento,
proporciona o intercâmbio de ideias e nos faz refletir e argumentar com mairo
propriedade em defesa de nossos direitos como cidadãos...

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 119 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

De acordo com as estruturas linguísticas do texto, julgue o item: o pronome


³QRV´H[HUFHDIXQomRGHFRPSOHPHQWRGDIRUPDYHUEDO³UHIOHWLU´
90. (CONSULPLAN / CBTU / TÉC. SEG. TRABALHO / 2014)
1R WUHFKR ³O general destina-se a missão mais importante: apanha dois
paralelepípedos e concentra-se na façanha de colocar um em cima do outro.
Vendo-o em tarefa tão insignificante, pergunto-lhe para que aqueles
paralelepípedos tão sabiamente colocados um sobre o outro´, as palavras
destacadas foram utilizadas com a finalidade de
a) indefinir o sujeito.
b) expressar uma circunstância.
c) retomar um termo expresso anteriormente.
d) antecipar um termo que ainda será mencionado.
91. (FGV / Analista / Câmara Municipal Caruaru / 2015)
Em relação ao emprego tradicional dos pronomes pessoais, assinale a opção
que indica a frase que está totalmente correta.
a) Essas roupas estão aí para mim levar para casa.
b) Entre mim e minha namorada não há problemas.
c) Observei eles da janela de meu quarto.
d) Todos saíram com nós depois de meia hora.
e) Ao mar, foi-lhe jogado o corpo do marinheiro.
92. (FCC / SEFAZ-PE / Auditor Fiscal do Tesouro / 2014)
A substituição do elemento grifado pelo pronome correspondente foi realizada
de modo INCORRETO em:
a) pôs em evidência o fator comum = pô-lo em evidência
b) eliminou imediatamente a variante = eliminou-na imediatamente
c) arremedar a marcha desgovernada de um tabético = arremedá-la
d) trocou por outras as botinas escarrapachadas = trocou-as por outras
e) ela destruía a unidade física do tipo = ela a destruía
93. (CONSULPLAN / CFESS / ASS. TÉCNICO / 2017)
³ DSDUHFHX XP EHP-te-vi caprichoso, muito moderno, que se recusava a
articular as três sílabas tradicionais do seu nome, limitando-VHDJULWDU³WH
vi! ...te-YLFRPDPDLRULUUHYHUrQFLDJUDPDWLFDO´ ž†
A narradora fala de irreverência gramatical porque se trata
A) de uma inadequação vocabular.
B) do emprego de linguagem coloquial.
C) de um erro de concordância nominal.
D) de uma impropriedade do uso do pronome átono.
94. (CONSULPLAN / HOB / ENFERMEIRO / 2015)
A alteração na ordem da palavra em destaque promoveu um desvio da norma-
padrão em, EXCETO:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 120 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

D ³(VFXWHRTXHlhe GLJR  ´ ± Escuta o que digo-lhe.


E    ³1mR se admite mais o portunhol de anWHV´ ± Não admite-se mais o
portunhol de antes.
F ³Me parece um bom nome SDUDXPFXUVRGHJUHJR´ ± Parece-me um bom
nome para um curso de grego.
G  ³$JRUD me diga: quantos cursos de gregR YRFr FRQKHFH QD FLGDGH"´ ±
Agora diga-me: quantos cursos de grego você conhece na cidade?
95. (Cesgranrio / IBGE / 2016)
O pronome oblíquo está colocado de acordo com a norma-padrão em:
a) Eles estão por toda parte, mas ninguém nota-os.
b) Vivemos em uma sociedade que pouco se importa com essa questão.
c) Encontraremo-los em muitas cidades.
d) Nos sensibilizamos, porém nada fazemos.
e) É preciso trabalhar para que resolva-se o problema.
96. (FCC / TRE-AP / Técnico Judiciário / 2015)
Michelangelo resistiu a pintar a capela...
...que afligem os seres humanos...
O jovem Michelangelo penou para demonstrar o valor de seu gênio...
Fazendo-se as alterações necessárias, os elementos sublinhados acima foram
corretamente substituídos por um pronome, respectivamente, em:
a) lhe pintar ± lhes afligem ± o demonstrar
b) pintar-lhe ± afligem-QRVíGHPRQVWUDU-lhe
c) pintá-la ± afligem-lhes ± demonstrá-lo
d) pintá-la ± os afligem ± demonstrá-lo
e) pintar-lhe ± os afligem ± lhe demonstrar
97. (Fumarc / CBTU / 2016)
A posição do pronome oblíquo destacado é facultativa em: ³>@ RX TXH
paradoxalmente, se sente na obrigação de estudar escondido e jactar-se de
não fazê-lo´
98. (CESPE / TCE-PA / 2016)
Haveria prejuízo da correção gramatical do texto caso a partícula ³VH´ no
trecho ³4XDQGR D JHQWH VH KDELWXD D YHQHUDU RV GHFUHWRV GD 3URYLGrQFLD´
fosse deslocada para imediatamente após a forma verbal ³KDELWXD´
escrevendo-se habitua-se.
99. (CESPE / TCE-PA / 2016)
Julgue o item que se segue.
A correção gramatical do texto seria mantida caso, no trecho ³QmR VH SRGH
admitir que seja H[HFXWDGD´a partícula ³VH´fosse empregada imediatamente

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 121 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

após a forma verbal ³SRGH´² escrevendo-se da seguinte forma: pode-se.


100. (CESPE / DPU / 2016) Adaptada
Com esse trabalho nós estamos garantindo seu acesso à justiça e aos direitos
para que FRQVLJDP VH EHQHILFLDU GH RXWUDV SROtWLFDV S~EOLFDV´ H[SOLFD D
coordenadora do Departamento de Atividade Psicossocial.
Seria mantida a correção gramatical do período caso a partícula ³VH´em ³VH
EHQHILFLDU´, fosse deslocada para imediatamente após a forma verbal
³EHQHILFLDU´² escrevendo-se beneficiar-se.
101. (CESPE / TRE-PI / 2016) Adaptada
Entretanto, esse é um cenário que se repete em diversas nações tidas como
desenvolvidas e com maior tradição democrática, como é o caso da França
A correção e o sentido original do texto seriam mantidos caso se substituísse
o trecho ³TXHVHUHSHWH´ por que repete-se.
102. (CESPE / Agente da PF / 2012) Adaptada
³1DVVRFLHGDGHVWUDGLFLRQDLVHPTXHDSXQLomRpGHFLGLGDSRUXPDDXWRULGDGH
superior a todos, as execuções podem ser públicas: a coletividade festeja o
soberano que se encarregou da justiça ± TXHDOtYLR´
De acordo com o texto, nas sociedades tradicionais, os cidadãos sentem-se
aliviados sempre que um soberano decide infligir a pena de morte a um infrator
porque se livram das ameaças de quem desrespeita a moral que rege o
FRQYtYLRVRFLDOFRPRHYLGHQFLDRHPSUHJRGDLQWHUMHLomR³TXHDOtYLR´ O3).
103. (CESPE / TRE-BA / 2010)
Em ³R[DOi FRQFOXDV D YLDJHP´, o vocábulo ³R[DOi´ pode ser substituído por
tomara que, mantendo-se, assim, o sentido do trecho em que se insere.
104. (CRF-RJ / Agente Administrativo / 2015)

Releia a seguinte passagem da tirinha: ³1RVVD(QWmRHOHWDPEpPpSmR-duro!"


Agora, assinale a alternativa incorreta quanto às palavras nela encontradas.
a) A pDODYUD³WDPEpPQRFRQWH[WRHPTXHDSDUHFHSHUWHQFHDXPDFODVVH
de palavras invariáveis.
b) $ SDODYUD ³HOH QR FRQWH[WR HP TXH DSDUHFH SHUWHQFH j FODVVH GRV
pronomes pessoais.
c) $ SDODYUD ³QRVVD QR FRQWH[WR HP TXH DSDUHFH SHUWHQFH j FODVVH GRV
pronomes possessivos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 122 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

d) $ SDODYUD ³p QR FRQWH[WR HP TXH DSDUHFH SHUWHQFH D XPD FODVVH GH
palavras variáveis.
e) 2FRPSRVWR³SmR-duro", no contexto em que aparece, pertence à classe dos
adjetivos.

Lista mais questões comentadas

105. (CONSULPLAN / PREF. CASCAVEL / AG. COMUNIT. / 2016)


De acordo com a classe de palavras, assinale a relação INCORRETA.
D ³'HVVDIRUPDRMRYHPVHYrIUHQWHDXPHQRUPHOHTXHGHSRVVLELOLGDGHV
e opções e, por sua vez, quer explorar e experimentar tudo a VXDYROWD´ ±
Pronome.
E ³2EVHUYD-se, também, que muitas jovens abrem mão do preservativo por
medo de serem abandonadas ou maltratDGDVSRUVHXVSDUFHLURV´± Advérbio.
F  ³([LVWHP algumas características comportamentais, socioeconômicas e
biológicas que fazem com que os jovens sejam um grupo propenso à infecção
SHOR+,9´ ± Conjunção.
G ³2XWURIDWRU importante a ser levado em consideração é o grande apelo
erótico emitido pelos meios de comunicação, frequentemente direcionado ao
DGROHVFHQWH´± Adjetivo.
H  ³$ DGROHVFrQFLD p XP SHUtRGR GD YLGD FDUDFWHUL]DGR SRU LQWHQVR
crescimento e desenvolvimento, que se manifesta por transformações físicas,
SVLFROyJLFDVHVRFLDLV´ ± Preposição.
106. (CONSULPLAN / PREF. COIMBRA / AUX. ADM. / 2014)
Súplica por uma árvore
Um dia, um professor comovido falavaǦme de árvores. Seu avô conhecera
AndersenǦAndersen, esse pequeno deus que encantou para sempre a infância,
todas as infâncias, com suas maravilhosas histórias. Mas, além de conhecer
Andersen, o avô desse comovido professor legara a seus descendentes uma
recordação extremamente terna: ao sentir que se aproximava o fim de sua
vida, pediu que o transportassem aos lugares amados, onde brincara em
menino, para abraçar e beijar as árvores daquele mundo antigo ± mundo de
sonho, pureza, poesia ± povoado de crianças, ramos, flores, pássaros... O
professor comovido transportavaǦse a esse tempo de ternura, pensava nesse
avô tão sensível, e continuava a participar, com ele, dessa cordialidade geral,
desse agradecido amor à Natureza que, em silêncio, nos rodeia com a sua
proteção, mesmo obscura e enigmática.
LembreiǦme de tudo isso ao contemplar uma árvore que não esqueço, e cujo
tronco há quinze dias se encontra todo ferido, lascado pelo choque de um táxi
desgovernado. Segundo os técnicos, se não for socorrida, essa árvore deverá
morrer dentro em breve: pois a pancada que a atingiu afetouǦa na
profundidade da sua vida.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 123 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

³LembreiǦme de tudo isso...´ (2º§). Os termos anteriormente sublinhados


A) referemǦse ao professor comovido ao falar em árvores.
B) resumem todas as lembranças da infância da narradora.
C) referemǦse ao professor comovido citado no início do texto.
D) servem para desenvolver a narrativa do acontecimento no texto.
E) funcionam como referência históricoǦcientífica do assunto a ser narrado.
107. (CONSULPLAN / MAPA / ADMINISTRADOR / 2014)

Quanto à linguagem utilizada na mensagem expressa nos cartazes levados


SHORV SHUVRQDJHQV GD FKDUJH p FRUUHWR DILUPDU TXH D VXEVWLWXLomR SRU ³Me
sigam até a verdade´LPSOLFDULD
a) uma aproximação maior com o público leitor através do uso de uma
linguagem atual.
b) inadequação linguística, incorrendo em incompreensão da mensagem a
ser transmitida.
c) desacordo do uso quanto à colocação do pronome oblíquo de acordo com
a norma padrão.
d) uma manifestação de caráter popular em que há preocupação com o uso
da norma padrão da língua.
108. (CONSULPLAN / MAPA / AG. ATIV. ADROPECUÁ. / 2014)
1D H[SUHVVmR ³2V F{PRGRV VmR ridiculamente SHTXHQRV´ R WHUPR HP
destaque está diretamente ligDGR DR DGMHWLYR ³SHTXHQRV´ H HVWDEHOHFH QD
frase, uma relação de sentido de
a) meio.
b) causa.
c) modo.
d) intensidade.
109. (CONSULPLAN / PREF. CANTAGALO / DENTISTA / 2013)
Analise as frases.
,³&RQKHoRPXLWDVSHVVRDVTXHHVWmRHQYHOKHFHQGRmal´
,,³$FDERXpFODURsem neQKXPJHPLGRRXUHVPXQJR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 124 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

,,,³1HODRFRUWHGLiULRGRVGLDVa YDLFRQVXPLQGR´
,9³9DLYHUa natureza deveria ter feito os homenVHQYHOKHFHUHPGLIHUHQWH´
Os termos grifados são, respectivamente,
a) conjunção, pronome, artigo e artigo.
b) adjetivo, advérbio, preposição e artigo.
c) advérbio, preposição, pronome e artigo.
d) adjetivo, preposição, artigo e preposição.
e) advérbio, numeral, pronome e preposição.
110. (CONSULPLAN / TJ-MG / JUIZ LEIGO / 2015)
Magistrado faz sentença em linguagem coloquial para combater
³MXULGLTXrV´
Ao decidir que uma das partes deveria indenizar a outra, João Batista Danda
disse que o valor a ser SDJRQmRSRGHVHU³WmRSHVDGRTXHYLUHXPLQIHUQR´
O mundo das leis não precisa ser um universo indecifrável. Para provar isso,
um magistrado gaúcho redigiu uma sentença trocando o tom pomposo do
Direito pela linguagem do dia a dia. O resultado foi um texto de fácil
compreensão e uma repercussão maior do que ele imaginava: virou notícia no
meio jurídico ² e fora dele.
A ideia surgiu quando João Batista de Matos Danda, então juiz do Tribunal
Regional do Trabalho da 4ª Região, viuǦse completamente perdido em uma
conversa com a filha. Por mensagem, a jovem contava sobre um novo
emprego, na área do marketing.
² (ODHVFUHYHXH[SUHVV}HVFRPR³VWDUWXS´³LQFXEDGD´³WUDQVPtGLD´³'1$GH
PDUFD´ $t HX SHUJXQWHL ³PLQKD filha, o que tu estás falando exatamente?
7UDGX]SRUIDYRU´² conta Danda, ainda achando graça do papo que não lhe
fez sentido.
Ao se dar conta de que a linguagem técnica acaba restringindo o entendimento
a poucos, geralmente aqueles que trabalham na mesma área, o juiz, então,
se propôs ser mais claro em suas decisões ² desafio que levou com certo
exagero em abril passado, quando foi relator no processo em que o pedreiro
Lucas de Oliveira pedia vínculo de emprego e indenização por danos morais,
após sofrer acidente em uma obra particular, de propriedade de Itamar
Carboni.
'DQGDIRLGLUHWRQDH[SOLFDomRGRUROR³7Uês meses depois de iniciada a obra,
o pedreiro caiu da sacada, um pouco por falta de sorte, outro pouco por falta
de cuidado, porque ele não tinha e não usava equipamento de proteção. Ele,
Itamar, ficou com pena e acabou pagando até o serviço que o operário ainda
QmRWLQKDWHUPLQDGR´GLVVHRMXL]QD sentença.
Lá pelas tantas do acórdão, ao falar do processo de revisão da sentença, o
PDJLVWUDGRVROWRXHVVD³SDUDMXOJDUGH novo, vou ler as declarações de todos
mais uma vez e olhar os documentos. Pode ser que me convença do contrário.
0DVSRGHVHUTXHQmR9DPRVYHU´
É um texto tão coloquial que parece não ter nada de mais, certo? Errado. O

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 125 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

próprio juiz conta como normalmente essa ideia seria escrita, em um processo
³QRUPDO´
² Inconformado com a sentença, que julgou improcedente a ação, recorre o
reclamante buscando sua reforma quanto ao vínculo de emprego e indenização
por acidente de trabalho. Com contrarrazões sobem os autos a este tribunal.
É o relatório. Passo a decidir.
Na decisão, Danda defendeu que não havia vínculo de emprego na situação,
mas que isso não impedia o trabalhador de receber indenização por danos
PRUDLV $ UHSDUDomR VHJXQGR R MXL] ³VHUYH SDUD DPHQL]DU XP SRXFR R
sofrimento de Lucas, mas também serve para Itamar lembrar que tem
obrigação de cuidar da segurança daqueles que trabalham na sua casa, mesmo
TXDQGRQmRVmRHPSUHJDGRV´

³2 VHQWLGR GH WHPSRUDOLGDGH H[SUHVVR QR GLVFXUVR UHIHUHǦse a uma ocasião
arbitrária, reconhecível pelos interlocutores relativamente a um ponto de
referência LQVWLWXtGRQRSUySULRGLVFXUVR´2H[SUHVVRDQWHULRUPHQWH pode ser
exemplificado através do destacado em:
$ ³3DUDSURYDULVVRXPPDJLVWUDGRJD~FKRUHGLJLXXPDVHQWHQoDWURFDQGRR
tom pomposo do Direito pela linguagem do dia a dia´ ž†
% ³$LGHLDVXrgiu quando João Batista de Matos Danda, então juiz do Tribunal
Regional do Trabalho da 4ª Região, viuǦse completamente perdido em uma
FRQYHUVDFRPDILOKD´ ž†
&  ³$R VH GDU FRQWD GH TXH D OLQJXDJHP WpFQLFD DFDED UHVWULQJLQGR R
entendimento a poucos, geralmente aqueles que trabalham na mesma área,
o juiz, entãoVHSURS{VVHUPDLVFODURHPVXDVGHFLV}HV>@´ ž†
' ³$UHSDUDomRVHJXQGRRMXL]µVHUYHSDUDDPHQL]DUum pouco o sofrimento
de Lucas, mas também serve para Itamar lembrar que tem obrigação de cuidar
da segurança daqueles que trabalham na sua casa, mesmo quando não são
HPSUHJDGRV¶´ ž†
111. (CONSULPLAN / TRE-MG / ANALISTA / 2013)
³2V UHFXUVRV GH LQWHJUDomR KHUPHQrXWLFD GLVSRQtYHLV DR DSOLFDGRU
contemporâneo, são suficientes para exigir, dos agentes públicos, a conduta
SROLWLFDPHQWHYLUWXRVDHFRQVWLWXFLRQDOPHQWHSRVLWLYDGDTXHVHHVSHUDGHOHV´
Considerando o período anterior, assinale a alternativa correta.
D 2DGMHWLYR³GLVSRQtYHLV´GLIHUHQWHGH³VXILFLHQWHV´UHIHUH-VHD³UHFXUVRV´
E 2DGYpUELR³SROLWLFDPHQWH´WHPDIXQomRGHFDUDFWHUL]DURSURFHVVRYHUEDO
F  2 SURQRPH ³TXH´ UHSUHVHQWD R DQWHFHQGHQWH ³FRQGXWD´ VXEVWDQWLYR Mi
referido.
G  $ VXEVWLWXLomR GR WHUPR ³GRV´ SRU ³GH´ HP ³GRV DJHQWHV´ SUHVHUYD R
sentido original.
e  2 WHUPR ³GHOHV´ SUHMXGLFD D FRHVmR WH[WXDO DR DPSOLDU R VHQWLGR GH
³DJHQWHVS~EOLFRV´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 126 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

112. (CONSULPLAN / TRT 13ª REGIÃO / ESTAGIÁRIO / 2012)


(P³No dia em que a mulher descobre que o homem, pelo simples fato de ser
seu marido, é seu cônjuge, coitado dele.", o termo destacado denota a ideia
de
a) intensidade.
b) modo.
c) lugar.
d) tempo.
e) causa.
113. (CONSULPLAN / TSE / ANALISTA / 2012)

Assinale a palavra que, no texto, NÃO exerça papel pronominal.


a) onde (L. 15)
b) muito (L. 8)
c) qualquer (L. 34)
d) outros (L. 15)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 127 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

114. (CONSULPLAN / TSE / ANALISTA / 2012)

Assinale a alternativa em que a alteração da primeira fala do quadrinho tenha


respeitado a norma culta.
a) Sua Senhoria ouvistes falar do menino que morreu comendo sucrilhos?
==c0834==

b) Vossa Senhoria ouvistes falar do menino que morreu comendo sucrilhos?


c) Vossa Excelência ouviu falar do menino que morreu comendo sucrilhos?
d) Sua Senhoria ouviste falar do menino que morreu comendo sucrilhos?
115. (CONSULPLAN / TSE / TÉCNICO / 2012)
Mas, se ousar oferecer-lhe dinheiro para o mesmo fim, torna- se um simples
cafajeste. Assinale a alternativa em que a alteração da estrutura anterior tenha
sido feita em consonância com a norma culta.
a) Mas, caso ofereça-lhe dinheiro para o mesmo fim, tornará-se um simples
cafajeste.
b) Mas, caso lhe ofereça dinheiro para o mesmo fim, tornar-se-á um simples
cafajeste.
c) Mas, se tiver oferecido-lhe dinheiro para o mesmo fim, se tornará um
simples cafajeste.
d) Mas, se tiver lhe oferecido dinheiro para o mesmo fim, tornará-se um
simples cafajeste.
116. (CONSULPLAN / CREA-RJ / TÉCNICO / 2011)
Quanto à classe de palavras, assinale a relação INCORRETA:
D ³3RGHULDORXYDUPHOKRUos DPLJRV´ DUWLJR
E ³Não sei se muita gente haverá reparado nisso ± ´ DGYpUELR
F  ³( DV surpresas GH SDODYUDV TXH QXQFD VH WLQKDP YLVWR QHP RXYLGR´
(substantivo)
G ³Vêm RVTXHDFUHGLWDPHPH[HPSORVFpOHEUHV´ YHUER
H ³6HPIDODUTXHantes GRUHLWDPEpPHVWiRSUHVLGHQWH´ SURQRPH
117. (CONSULPLAN / PREF. CONGONHAS / PROFESSOR / 2010)
Os terPRVGHVWDFDGRVHP³Para FRQWURODU´³!mas QmRFRQWULEXHP´ H³Por
issoQmRID]VHQWLGR´expressam, respectivamente, ideia de:
a) Finalidade, oposição, conclusão.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 128 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

b) Conclusão, explicação, conclusão.


c) Finalidade, explicação, explicação.
d) Conclusão, oposição, explicação.
e) Explicação, oposição, causa.
118. (CONSULPLAN / PREF. CONGONHAS / PROFESSOR / 2010)
Quanto à classe gramatical das palavras sublinhadas, tem-se a
correspondência correta em:
D ³(VWDPRVID]HQGRFRPRDPRUo que já fizeraPFRPRVH[R´± pronome
demonstrativo
E  ³1D GpFDGD SDVVDGD SDUHFLD que tínKDPRV UHLQYHQWDGR R VH[R´ ±
pronome relativo
F ³TXHORJRse FRQVRPH´ ± conjunção
G  ³ R GLiORJR p IXQGDPHQWDO SDUD  a manutenção dos espaços..´ ±
preposição
H ³HYROWDUa DEDVWHFHURDPRU´ ± artigo
119. (CONSULPLAN / PREF. CONGONHAS / PROFESSOR / 2010)
A expressão destacada foi corretamente substituída pela forma átona do
pronome pessoal em:
D ³OLYURVVREUHDPRUFUX]DUDPseu caminho´± cruzaram-lhe
E ³UHLQYHQWDGRo sexo´ ± reinventado-lo
F ³7UDQVIRUPDPRVo sexo HPYHUGDGH´ ± transformamo-lo
G ³$YLGDVHPDPRUSRGHID]HUsentido´ ± fazer-lhe
H ³$QWHVTXHVHIUXVWUHPas expectativas´ ± frustrem-as
120. (CONSULPLAN / RECEPCIONISTA / 2010)
1R WUHFKR ³8PD SHVVRD p JUDQGH quando SHUGRD ´ D SDODYUD GHVWDFDGD
denota ideia de:
a) Finalidade.
b) Tempo.
c) Explicação.
d) Condição.
e) Oposição.
121. (CONSULPLAN / RECEPCIONISTA / 2010)
³eDsua sensibilLGDGHVHPWDPDQKR´2SURQRPHGHVWDFDGRDQWHULRUPHQWHp
a) Pessoal.
b) Possessivo.
c) Demonstrativo.
d) Indefinido.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 129 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

e) Interrogativo.
122. (CONSULPLAN / ENGENHEIRO CIVIL / 2010)
(P³(UDPTXDWURKRUDVGDPDQKmquando seu pai sofreu um colapso cardíDFR´
(1º§), a palavra sublinhada tem valor semântico de:
a) Modo.
b) Comparação.
c) Intensidade.
d) Tempo.
e) Consequência.
123. (CONSULPLAN / AUX. ADM. / DQ. DE CAXIAS-RJ / 2015)
³1D~OWLPDquartaǦfeira, estávamos eu,...´. A palavra sublinhada faz o plural
da mesma forma que:
a) arcoǦíris.
b) beijaǦflor.
c) guardaǦcivil.
d) abaixoǦassinado.
124. (CONSULPLAN / CM-CARATINGA / OFICIAL ADM. /2015)
³2OKDPRV SHOD IULQFKD H DOL HVWDYD R YHOKR ladrão,´ ž†  $ SDODYUD
sublinhada, nessa frase, faz o plural da mesma forma que
a) pão.
b) irmão.
c) colchão.
d) bênção.
125. (CONSULPLAN / TSE / TÉCNICO /2012)
Em vales-presentes, o plural se fez com a flexão dos dois elementos. Assinale
a palavra composta em que se devem pluralizar igualmente os dois elementos.
a) reco-reco
b) tique-taque
c) guarda-roupa
d) primeiro-ministro
126. (CONSULPLAN / CANTAGALO / MOTORISTA /2013)
Assinale a única palavra que encontra-se no aumentativo.
a) Criação.
b) Redação.
c) Avaliação.
d) Dramalhão.
e) Elaboração.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 130 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

127. (CONSULPLAN / CESAN / ADVOGADO / 2011)


³>@ TXH IRL PROGDGD GXUDQWH DQRV SHOD ação GRV YHQWRV H GD iJXD´ Se
SOXUDOL]DUPRV R YRFiEXOR HP GHVWDTXH REWHUHPRV D IRUPD ³Do}HV´ $
alternativa que contém um vocábulo que admite duas formas de plural é:
a) Construção.
b) Verão.
c) Cidadão.
d) Especulação.
e) Região.
128. (CONSULPLAN / MOTORISTA /2011)
Assinale a relação de diminutivos correta.
a) futuro / futurismo
b) terra / terrota
c) chuva / chuvisco
d) vida / vidão
e) mundo / mundaço
129. (CONSULPLAN / CMSAG / A.S.G. /2011)
Assinale a seguir a única palavra no masculino:
a) Soja.
b) Alimento.
c) Lentilha.
d) Ervilha.
e) Planta.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 131 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 01 ± Felipe Luccas Rosas

Gabaritos

1. LETRA C 34. INCORRETA 67. LETRA B 99. INCORRETA


2. CORRETA 35. CORRETA 68. LETRA E 100. CORRETA
3. CORRETA 36. CORRETA 69. LETRA C 101. INCORRETA
4. INCORRETA 37. LETRA E 70. CORRETA 102. INCORRETA
5. CORRETA 38. LETRA A 71. LETRA B 103. CORRETA
6. CORRETA 39. LETRA A 72. LETRA A 104. LETRA C
7. LETRA A 40. LETRA C 73. LETRA C 105. LETRA C
8. LETRA D 41. LETRA A 74. LETRA E 106. LETRA B
9. LETRA C 42. CORRETA 75. LETRA A 107. LETRA C
10. LETRA C 43. CORRETA 76. LETRA C 108. LETRA D
11. LETRA A 44. LETRA D 77. CORRETA 109. LETRA C
12. LETRA A 45. LETRA B 78. LETRA B 110. LETRA C
13. LETRA D 46. LETRA C 79. CORRETA 111. LETRA C
14. LETRA C 47. CORRETA 80. LETRA C 112. LETRA D
15. INCORRETA 48. LETRA A 81. INCORRETA 113. LETRA C
16. LETRA A 49. CORRETA 82. CORRETA 114. LETRA C
17. LETRA E 50. CORRETA 83. INCORRETA 115. LETRA B
18. LETRA C 51. INCORRETA 84. CORRETA 116. LETRA E
19. INCORRETA 52. LETRA B 85. INCORRETA 117. LETRA A
20. CORRETA 53. LETRA C 86. LETRA A 118. LETRA A
21. LETRA D 54. CORRETA 87. CORRETA 119. LETRA C
22. CORRETA 55. CORRETA 88. INCORRETA 120. LETRA B
23. INCORRETA 56. LETRA C 89. INCORRETA 121. LETRA B
24. LETRA C 57. CORRETA 90. LETRA C 122. LETRA D
25. LETRA A 58. LETRA C 91. LETRA B 123. LETRA C
26. LETRA B 59. LETRA C 92. LETRA B 124. LETRA C
27. LETRA D 60. LETRA E 93. LETRA D 125. LETRA D
28. CORRETA 61. LETRA D 94. LETRA C 126. LETRA D
29. LETRA B 62. INCORRETA 95. LETRA B 127. LETRA B
30. CORRETA 63. LETRA E 96. LETRA D 128. LETRA C
31. LETRA C 64. CORRETA 97. CORRETA 129. LETRA B
32. LETRA D 65. CORRETA 98. CORRETA
33. CORRETA 66. LETRA E

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 132 de 132


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

Lista de questões

1. (CESPE / SEDF / 2017)


Falamos não só de uma crise ecológica, mas também de uma crise civilizatória
de amplas dimensões.
Considerando as ideias e estruturas linguísticas do texto, julgue o item a
VHJXLU$H[SUHVVmR³PDVWDPEpP´LQWURGX]QRSHUtRGRHPTXHRFRUUHXPD
ideia de oposição.
2. (Instituto Excelência / Proc. Jurídico / 2017 ) Adaptada
Considere o seguinte trecho do texto:
³2SRHPDVHQKRUHV
não fede
QHPFKHLUD´
1HVVD FRQVWUXomR D FRQMXQomR ³QHP´ XQH GXDV RUDo}HV coordenadas
expressando entre elas uma relação de adição.
3. (Consultec / Procurador / Ilhéus / 2016)
As expressões em negrito, no fragmento ³não só no concernente à
sexualidade, mas também na DTXLVLomRGHEHQVGHFRQVXPR´, estabelecem
entre as mensagens ideia de oposição..
4. (CESPE / SEE-DF / 2017)
A muitos desses pregoeiros do progresso seria difícil convencer de que a
alfabetização em massa não é condição obrigatória nem sequer para o tipo de
cultura técnica e capitalista que admiram.
A supressão do vocábuOR³QHP´SUHVHUYDULDRVHQWLGRHDFRUUHomRJUDPDWLFDO
do texto.
5. (CESPE / PRF / 2013) Adaptada
Ainda hoje, em certos lugares, a previsão da pena de morte autoriza o Estado
a matar em nome da justiça. Em outras sociedades, o direito à vida é inviolável
e nem o Estado nem ninguém tem o direito de tirar a vida alheia.
Dado o fato de que nem equivale a e não, a supressão da conjunção e
empregada logo após inviolável manteria a correção gramatical do texto.
6. (IF-PE / Auxiliar Administrativo / 2016)
No trecho ³2 VLVWHPD TXH QmR Gi GH FRPHU tampouco dá de amar´ D
conjunção destacada estabelece, entre as orações, a relação de
a) conclusão. b) adversidade. c) adição. d) explicação. e) alternância..
7. (CONSULPLAN / TRF 2ª REGIÃO / TÉC. SEG. E TR. / 2017)
(P³2WHPDPDLVLPSRUWDQWHno entanto, não é que as estruturas se ampliem
VHPSUH´ ž†), a correção semântica é preservada substituindo-se o termo
destacado por

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 67 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

A) pois. B) por isso. C) contudo. D) portanto.


8. (CESPE / SEE-DF / 2017)
A conjunção ³(QWUHWDQWR´ tem, no período em que se insere, sentido
conclusivo, equivalendo, semanticamente, a Portanto.
9. (CONSULPLAN / Aux. Adm. / Pref. Caratinga-MG / 2015)
No trecho ³$LPSODQWDomRGR6LVWHPDIRLGHJUDQGHYDOLDQRVHWRUGDVD~GH
do brasileiro, porém, hoje, sabe-se que esse Sistema não funciona
essencialmente conforme seus princípios..´a palavra destacada pode
ser substituída, sem perda semântica, por
a) porque.
b) portanto.
c) desde que.
d) no entanto.
10. (FCC / SEGEG-MA / Técnico Receita Estadual / 2016)
Ainda assim, atravessou aquele 27 de julho em relativa normalidade.
Porém, não houve resultado.
Sem prejuízo da correção e do sentido, os elementos sublinhados acima podem
ser substituídos, respectivamente, por:
a) Desse modo ± Conquanto
b) Com isso ± No entanto
c) Não obstante ± Contudo
d) Portanto ± Embora
H 7RGDYLDí3RUTXDQWR
11. (IF-TO / Secretário Executivo / 2017)
Ao longo do texto, a conjunção mas foi usada várias vezes. Em qual das
alternativas a substituição da conjunção mas altera o sentido do enunciado no
texto?
a) No entanto a gente ouve.
b) Pelo contrário também de gente bem de vida, para quem é mais fácil
não discutir deveres e obrigações com os filhos.
c) Não obstante eu e minha mulher cometemos um crime.
d) Similarmente só terão empregos e oportunidades se souberem o que são
limites, deveres, obrigações.
e) Todavia um dia os filhos terão de aprender a viver em sociedade.-
12. (CESPE / Prefeitura de São Paulo / 2016)
...O Brasil é um país de cidades novas. A maior parte de seus núcleos urbanos
surgiu no século passado. Há cidade, entretanto, que já existem há bastante
tempo...
No textoDFRQMXQomR³HQWUHWDQWR´ introduz, no período em que ocorre, uma

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 68 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

ideia de
a) oposição. b) adição. c) condição. d) causa. e) consequência.
13. (IBFC / EBSERH / 2017)
Para relacionar as orações, em ³(XVDELDID]HUSLSDe KRMHQmRVHLPDLV´,
o autor faz uso de uma conjunção que deve ter seu sentido inferido pelo
contexto. Trata-se do valor semântico de:
a) adição. b) conclusão. c) explicação. d) alternância. e) oposição.
14. (Funcab / CRC-RO / 2016)
O JORNAL E SUAS METAMORFOSES
Um senhor pega um bonde após comprar o jornal e pô-lo debaixo do
braço. Meia hora depois, desce com o mesmo jornal debaixo do mesmo braço.
Mas já não é o mesmo jornal, agora é um monte de folhas
impressas que o senhor abandona. Mal fica sozinho na praça, o monte de
folhas impressas se transforma outra vez em jornal, até que um rapaz o
descobre, o lê, e o deixa transformado num monte de folhas impressas.
Mal fica sozinho no banco, o monte de folhas impressas se transforma
outra vez em jornal, até que uma velha o encontra, o lê e o deixa transformado
num monte de folhas impressas. A seguir, leva-o para casa e no caminho
aproveita-o para embrulhar um molho de celga*, que é para que servem os
jornais após essas excitantes metamorfoses.

No início do segundo parágrafo, o vocábulo MAS introduz uma relação de


b) conseqüência. b) causa. c) quebra de expectativa. d) conclusão.
e)explicação.
15. (FGV / Procurador Municipal / Paulínia / 2016)
$VVLQDOHDRSomRTXHLQGLFDDIUDVHPDFKDGLDQDHPTXHDFRQMXQomR³H´WHP
valor adversativo.
D ³2SRYRLQJrQXRHVHPIpGDVYHUGDGHVTXHUDRPHQRVFUHUQDIiEXODH
SRXFRDSUHoRGijVGHPRQVWUDo}HVFLHQWtILFDV´
E ³2SmRGRH[tOLRpDPDUJRHGXUR´
F ³+iDPLJRVGHRLWRGLDVHLQGLIHUHQWHVGHRLWRDQRV´
G  ³$ DPL]DGH OKH IDUi HVTXHFHU R DPRU p PDLV VHUHQD TXH HOH H WDOYH]
PHQRVH[SRVWDDSHUHFHU´
H ³2FDVDPHQWRpERPHWHPVHXVLQFRQYHQLHQWHVFRPRWXGRQHVWHPXQGR
16. (FGV / TJ-AM / Oficial de Justiça / 2013)
Assinale o segmento em que a conjunção "E" tem valor de oposição e não de
adição.
a) "Construir presídios E dar tratamento digno ao preso não rendem votos"
b) "Daí porque se discute tanto um novo Código Penal, como se fossem
frouxas as 117 leis penais especiais E os 1.170 crimes tipificados de que

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 69 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

dispomos".
c) "Inclusive trazendo de volta a ideia da maioridade penal, que na prática
significa transformar menino em delinquente E sujeitá-lo à crueldade das
prisões".
d) "O que a juventude precisa é de amparo, de oportunidade, de educação,
E não de medidas que visem a puni-la"
e) "Lins era um humanista por excelência E sempre achou equivocada a
política...".
17. (COSEAC / Prefeitura de Niterói-RJ / Professor / 2016)
A substituição do conectivo em destaque altera o sentido fundamental do
enunciado em: ³D LQIOXrQFLD QmR IRL GR QHJUR HP VL MAS do escravo e da
HVFUDYLGmR´senão.
18. (COSEAC / Prefeitura de Niterói-RJ / Professor / 2016)
A substituição do conectivo em destaque altera o sentido fundamental do
enunciado em: ³1mRSXGHUDPRVHVFUDYRVQHJURVPDQWHUtQWHJUDVXDFXOWXUD
NEM XWLOL]DU  VXDVWpFQLFDVHPUHODomRDRQRYRPHLR´e não.
19. (FCC / TRE-PB / 2015)
E, no entanto, o cinema chegou num ponto em que é capaz de expressar...
Sem prejuízo da correção e do sentido, o elemento sublinhado acima pode ser
substituído por:
a) porquanto
b) em detrimento disso
c) desse modo
d) embora
e) todavia.
20. (CESPE / FUB / 2015) Adaptada
A redação acima poderia ter sido extraída do editorial de uma revista, mas é
parte do texto O oxente e o OK...
No que se refere aos sentidos, à estrutura textual e aos aspectos gramaticais
do texto, julgue o item a seguir.
2HOHPHQWRFRHVLYR³PDV´LQLFLDXPDRUDomRFRRUGHQDGDTXHH[SULPHDLGHLD
de concessão em uma sequência de fatos.
21. (FGV / Auditor Fiscal de Niterói-RJ / 2015)
O segmento do texto, abaixo transcrito, em que o conectivo E tem valor de
oposição é:
D  ³QRVVRV ILOKRV SRVVXHP EULQTXHGRV GH YHUGDGH FDL[DV H FDL[DV GH
EULQTXHGRVTXHHOHVGHL[DPGHODGRHPTXHVWmRGHGLDV´
E  ³7HPRV MDUGLQV HTXLSDGRV FRP FDUULQKRV GH PmR WHVRXUDV SRG}HV H
FRUWDGRUHVGHJUDPDV´
F ³7HPRVPiTXLQDVGHUHPRHPTXHnunca nos exercitamos, mesa de jantar

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 70 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

HPTXHQmRFRPHPRVHIRUQRVWULSORVHPTXHQmRFR]LQKDPRV´
G ³6mRRVQRVVRVEULQTXHGRVFRQVRORVjVSUHVV}HVLQFHVVDQWHVSRUFRQVHJXLU
o dinheiro para comprá-ORVHTXHHPQRVVDEXVFDGHOHVQRVLQIDQWLOL]DP´
H ³1D minha vida, devo admitir que andei fascinado pelo brilho do consumo
HDRPHVPRWHPSRHQRMDGR´
22. (IBADE / SEDUC-RO / 2016)
As conjunções destacadas em: ³XVR LQGHYLGR GH DEUHYLDo}HV IRUPDOLGDGHV
ORA excessivas ORA inexistentes" expressam, no contexto, ideia de:
a) oposição b) alternância. c) conclusão. d) explicação. e) adição.
23. (CESPE / FUB / 2015)
Ser objeto de referência, seja na Web, seja em publicações científicas,
constitui fator importante em avaliações globais.
A respeito das ideias e das estruturas linguísticas do texto, julgue o item
subsecutivo.
$V UHODo}HV HVWDEHOHFLGDV SHOR HPSUHJR GD H[SUHVVmR ³VHMD   VHMD´ TXH
poderia ser corretamente substituída pelo par quer (...) quer, indicam termos
sintaticamente dependentes entre si.
24. (IDECAN / UFPB / 2016)
No trecho ³(VVDVSHVVRDVIDPRVDVUHSUHVHQWDPXPDVpULHGHFDUDFWHUtVWLFDV
valorizadas pelos adolescentes: às vezes a rebeldia ou a aparente
independênciajVYH]HVDEHOH]DRXDIDPD´as expressões ³jVYH]HV´e ³RX´
conferem ao período ideia de, respectivamente:
a) Tempo e alternância.
b) Somatório de ideias e escolha.
c) Alternância de tempo e espaço.
d) Consequência e oposição de ideias no espaço..
25. (CESPE / SEDF / 2017)

No segundo período do texto, a FRQMXQomR ³RX´ HVWi DVVRFLDGD DR YDORU GH
LQFOXVmRHDFRQMXQomR³H´DVVRFLDGDDRYDORUGHVHTXHQFLDomRWHPSRUDO
26. (CESPE / TRE-PE / 2017)
Como lembra Marilena Chaui, a cidadania se define pelos princípios da
democracia, significando necessariamente conquista e consolidação social e
política. A cidadania requer instituições, mediações e comportamentos
próprios, constituindo-se na criação de espaços sociais de lutas (movimentos
sociais, sindicais e populares) e na definição de instituições permanentes para
a expressão política, como partidos, legislação e órgãos do poder público.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 71 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

Distingue-se, portanto, a cidadania passiva, aquela que é outorgada pelo


Estado, com a ideia moral do favor e da tutela, da cidadania ativa, aquela que
institui o cidadão como portador de direitos e deveres, mas essencialmente
criador de direitos para abrir novos espaços de participação política.

1R~OWLPRSHUtRGRGRWH[WRRYRFiEXOR³SRUWDQWR´LQWURGX]XPDLGHLDGH
a) tempo. b) consequência. c) conclusão. d) explicação. e) adição.
27. (CESPE / Polícia Científica / 2016)
³É importante, pois, que o médico estabeleça o momento de ocorrência do
êxito letal com a maior precisão possível.´
1RWH[WRDFRQMXQomR³SRLV´LQWURGX]QRSHUtRGRHPTXHRFRUUHXPDLGHLDGH
a) conclusão. b) explicação. c) causa. d) finalidade. e) consequência..
28. (COSEAC / PREF. DE NITERÓI-RJ / Administrador / 2016)
Permita-me que lhes confesse que o Brasil é a minha morada. O meu teto
quente, a minha sopa fumegante. É casa da minha carne e do meu espírito. O
alojamento provisório dos meus mortos. A caixa mágica e inexplicável onde se
abrigam e se consomem os dias essenciais da minha vida.
É a terra onde nascem as bananas da minha infância e as palavras do meu
sempre precário vocabulário. Neste país conheci emoções revestidas de
opulenta carnalidade que nem sempre transportavam no pescoço o sinete da
advertência, justificativa lógica para sua existência.
Sem dúvida, o Brasil é o paraíso essencial da minha memória. O que a vida ali
fez brotar com abundância, excedeu ao que eu sabia. Pois cada lembrança
brasileira corresponde à memória do mundo, onde esteja o universo
resguardado. Portanto, ao apresentar-me aqui como brasileira,
automaticamente sou romana, sou egípcia, sou hebraica. Sou todas as
civilizações que aportaram neste acampamento brasileiro.
³3RUWDQWR DR DSUHVHQWDU-me aqui como brasileira, automaticamente sou
URPDQDVRXHJtSFLDVRXKHEUDLFD´ ž†
O período transcrito acima, em relação ao que lhe antecede no texto, exprime
o sentido de:
a) adição. b) conclusão c) explicação. d) concessão. e) conformidade.
29. (CESPE / TCE-SC / 2016)
O fenômeno da corrupção, em virtude de sua complexidade e de seu potencial
danoso à sociedade, exige, além de uma atuação repressiva, também uma
ação preventiva do Estado. Portanto, é preciso estimular a integridade no
serviço público, para que seus agentes sempre atuem, de fato, em prol do
interesse público.
Julgue o próximo item, relativos a aspectos linguísticos e às ideias do texto.
Seria mantida a correção gramatical do texto VHRYRFiEXOR³3RUWDQWR´fosse
substituído por ³Por conseguinte´.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 72 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

30. (CESPE / TCU / 2015) Adaptada


Em relação a aspectos linguísticos do texto, julgue o próximo item. Sem
SUHMXt]RGRVHQWLGRGRWH[WRRWHUPR³GHVWDUWH´ 5 SRGHULDVHUVXEVWLWXtGR
por contudo ou todavia.
31. (CESPE / FUB / 2015) Adaptada
Como a população cresce em número e em capacidade de consumo, também
aumenta o desejo de que a economia utilize mais recursos de base biológica,
recicláveis e renováveis, logo, mais sustentáveis² e essa é a base da
bioeconomia.
2 YRFiEXOR ³ORJR´ SRU LQGLcar conclusão de ideia anterior, poderia ser
substituído pela expressão por conseguinte, o que manteria a correção
gramatical e a coerência textual.
32. (CONSULPLAN / TRF 2ª REG. / TÉCNICO / 2017)
No desenvolvimento textual, é notório que o emprego de conectivos e
operadores argumentativos contribui para a eficácia da argumentação, deste
modo, a sua ampla compreensão se faz necessária. Nesta perspectiva, em
³>@HQWHQGH-se que a atuação das novas mídias é de suma importância, pois
possibilita a expansão da informação, a práxis ambiental, o debate e as
DVSLUDo}HV GRV FLGDGmRV >@´ (7º§) pode-se afirmar acerca do termo
destacado que
A) articula, em um enunciado, tese e argumento estabelecendo uma ligação
semântica em que há uma relação de explicação.
B) relaciona o argumento que o antecede ao que o sucede, tornando-os
equivalentes quanto à ênfase que lhes é atribuída.
C) orienta para uma conclusão implícita em relação à informação antecedente
de modo que sua função é finalizar o ponto de vista exposto.
D) indica uma pressuposição em relação ao assunto antes de sua enunciação,
evidenciando sua importância no desenvolvimento da argumentação.
33. (CONSULPLAN / Aux. Saúde Bucal / CODESP / 2013)
No trecho ³VRXREULJDGRDHOLPLQDUDPDL~VFXODpois o computador, para
melhor e mais rapidamente nos servir, acha que eu vou escrever o que não
TXHURQHPSUHFLVRHVFUHYHU´o conectivo destacado estabelece com a ideia
que o antecede uma relação de
a) oposição.
b) conclusão.
c) explicação.
d) comparação.
e) consequência.
34. (FUNDEP / Assistente Social / 2017)
Releia o trecho a seguir.
³>@DLQIUDHVWUXWXUDpRHVTXHOHWRGDVFLGDGHVpois a partir dela é possível
GLUHFLRQDURFUHVFLPHQWRXUEDQR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 73 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

A conjunção destacada confere às orações uma ideia:


a) conclusiva.
b) condicional.
c) explicativa.
d) alternativa.
35. (CESPE / TCU / 2015) Adaptada
-XOJXHRLWHPTXHVHVHJXH$LGHLDLQWURGX]LGDSHODFRQMXQomR³SRUTXDQWR´
SRGHULDVHUH[SUHVVDWDPEpPSRU³FRQTXDQWR´
36. (VUNESP / TJ-SP / 2012)
A Groenlândia nunca derreteu tanto
No verão da Groenlândia, é normal que suas camadas de gelo se derretam.
Em julho de 2012, no entanto, em apenas quatro dias (de 9 a 12), a superfície
gelada sofreu um derretimento nunca antes observado: a área descongelada
passou de 40 para 97%. Apesar de os cientistas definirem o fenômeno como
"extremo", eles explicam que não há motivos para alarde: experimentos
apontaram que nos últimos dez milênios, houve um vasto derretimento a cada
150 anos. As informações são da Nasa.

O sentido da conjunção destacada no texto também está presente na seguinte


passagem, adaptada do editorial da Folha de S.Paulo, de 02.06.2012:
a) Heloisa, minha mulher, ficou logo sabendo, mas quis me poupar. Ele era
nosso amigo.
b) No dia 26, voltei para casa. Horas depois, liguei o computador e abri a lista
de mensagens.
c) Assim que abri os olhos, li a notícia: "Morreu Pery Ribeiro.".
d) No dia 24 de fevereiro, eu estava no CTI de um hospital, recém-saído de
uma cirurgia, quando morreu o cantor Pery Ribeiro.
e) O cuidado de Heloisa foi inútil, pois havia uma TV no CTI, bem à minha
frente.
37. (CONSULPLAN / TRF 2ª REGIÃO / TÉC. SEG. E TR. / 2017)
³$WXDOPHQWHMiHVWiPXLWRFODURTXHQRVVDVH[SHULrQFLDVPHQWDLVHVWmR
sempre criando estruturas cerebrais que facilitam a resposta rápida a futuras
demandas semelhantes. O tema mais importante, no entanto, não é que as
estruturas se ampliem sempre, é a liberdade natural da mente, que opera
DOpPGDVHVWUXWXUDV´ ž† 
Sobre as ocorrências do vocábulo ³TXH´ presentes nesse segmento, a
afirmação correta é a de que
A) a segunda ocorrência pertence à mesma classe da primeira.
B) a última ocorrência pertence à classe diferente de todas as demais.
C) a segunda e a quarta ocorrências pertencem à mesma classe gramatical.
D) a primeira e a quarta ocorrências pertencem à mesma classe gramatical.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 74 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

38. (CESPE / TRE-PI / Taquigrafia / 2016)


É a primeira vez, desde a regulamentação da medida, em 2011, que o
mecanismo é adotado no país.
No último período do texto SiWXDomR GH HPHUJrQFLD R YRFiEXOR ³TXH´ IRL
empregado como
a) conjunção integrante.
b) conjunção comparativa.
c) advérbio.
d) pronome relativo.
e) partícula expletiva.
39. (CESPE / SEDF / 2017)
É claro que a gramática do inglês não é a mesma gramática do português.
$RUDomR³TXHDJUDPiWLFDGRLQJOrVQmRpDPHVPDJUDPiWLFDGRSRUWXJXrV´
H[HUFHDIXQomRGHFRPSOHPHQWRGRYRFiEXOR³FODUR´
40. (CONSULPLAN / PREF. CASCAVEL / TÉC. TOPOGR. / 2016)
³Se não for bom aluno, vai ficar desempregado ou ganhar muito pouFR´ ž† 
Os termos anteriormente sublinhados exprimem a ideia de:
A) Alternância e adição. D) Conformidade e causa.
B) Causa e consequência. E) Condição e consequência.
C) Condição e alternância.
41. (CONSULPLAN / Biblio. / Pref. Uberlândia-MG / 2012)
No trecho ³Hcaso sobreviva, abriga-VHQXPDLOKRWDFDULEHQKD´a conjunção
sublinhada expressa o sentido de
a) condição.
b) causa.
c) comparação.
d) consequência.
e) conformidade.
42. (FUNCAB / EMSERH / Auxiliar de Farmácia / 2016)
A conjunção destacada em: ³4XHPVDEHQRVPDWDUHPRVPHQRVSE as drogas
IRUHP FRQWURODGDV H D PLVpULD H[WLQWD´ introduz uma oração que expressa
ideia de:
a) causa. b) comparação. c) condição. d) conformidade. e) consequência..
43. (IBADE / SEDUC-RO / 2016)
No trecho: ³6(QmRHVWLYHUPXLWREHPRULHQWDGRHSUHSDUDGRSRGHHVFUHYHU
absurdos em seus e-mails - DOHUWD´ se a conjunção SE for substituída por
CASO, na nova redação, o verbo ESTAR deverá assumir a forma de:
a) futuro do presente do indicativo

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 75 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

b) pretérito imperfeito do subjuntivo.


c) presente do indicativo
d) presente do subjuntivo
e) pretérito mais que perfeito do indicativo.
44. (CESPE / Polícia Federal / 2009)
As iniciativas são louváveis. Caso a população, porém, se sinta apenas punida
ou obrigada a uma atitude, e não parte da comunidade, os benefícios não se
tornarão duradouros.
A respeito da organização das estruturas linguísticas do texto acima e da
redação de correspondências oficiais, julgue o item subsequente.
A substituição de "Caso" pela conjunção Se preservaria a correção gramatical
da oração em que se insere, não demandaria outras modificações no trecho e
respeitaria a função condicional dessa oração.
45. (CONSULPLAN / Técnico / TRF 2ª Região / 2017)
À frente das frases citadas a seguir, está indicado o tipo de circunstância que
elas expressam no texto. A indicação está correta em
D ³SDUDVHWRUQDUXPFLFOLVWD´± (finalidade)
E ³DOLEHUGDGHGRPRWRULVWDpWDOTXHQHPPHVPRPRWRULVWDHOHp´± (causa)
F ³«VHDVHVWUDGDVILFDUHPEORTXHDGDV´± (concessão)
G ³FRPRVHIRVVHPDV~QLFDVRSo}HV´± (conformidade).
46. (Cesgranrio / IBGE / 2016)
No trecho do Texto ³Para que pudesse enxergar seu caminho à noite, o
homem buscou o desenvolvimento de foQWHV GH LOXPLQDomR DUWLILFLDO´, a
expressão em destaque pode ser substituída, mantendo-se a mesma relação
lógica, por
a) À medida que b) Já que c) A fim de que d) Logo que e) Desde que
47. (CONSULPLAN / TRF 2ª REGIÃO / TÉC. SEG. E TR. / 2017)
À frente das frases citadas a seguir, está indicado o tipo de circunstância que
elas expressam no texto. A indicação está correta em
$ ³SDUDVHWRUQDUXPFLFOLVWD´ ž† ± (finalidade)
% ³«TXHQHPPHVPRPRWRULVWDHOHp´ ž† ± (causa)
& ³«VHDVHVWUDGDVILFDUHPEORTXHDGDV´ ž† ± (concessão)
' ³FRPRVHIRVVHPDV~QLFDVRSo}HV´ ž† ± (conformidade)
48. (CONSULPLAN/ PREF. SABARÁ / ADMINISTRADOR / 2017)
³$V RUDo}HV ILQDLV H[SUHVVDP XP HIHLWR YLVDGR XP SURSyVLWR´
Assinale, a seguir, o trecho que exemplifica a ocorrência da oração a que se
refere a assertiva anterior.
$  ³>@ R TXH VLJQLILFD TXH R LPSDFWR JOREDO GDV HVWUDGDV GHYH VHU DLQGD
PDLRU´ ž†

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 76 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

% ³1RWHDliás, que essa estimativa do número de fatias separadas pela ação


KXPDQDSURYDYHOPHQWHpFRQVHUYDGRUD>@´ ž†
& ³0HVPRDVVLPXPDIRUPDLQRYDGRUDGHHQ[HUJDURQRVVRSODQHWDERODGD
SRUXPDHTXLSHLQWHUQDFLRQDOGHFLHQWLVWDV>@´ ž†
' ³'RLVWRques na tela do celular são suficientes para que o sujeito consiga
examinar uma representação mais ou menos realista e atualizada da Terra
YLVWDGRHVSDoR´ ž†
49. (FUNRIO / Assistente Administrativo / 2016)
Se você tem o hábito de pegar no saleiro e polvilhar a comida com umas
pitadas de sal, é melhor pensar duas vezes. A Organização Mundial de Saúde
(OMS) recomendou esta quinta-feira que um adulto consuma por dia menos
de dois gramas de sódio ± ou seja, menos de cinco gramas de sal ± para
reduzir os níveis de pressão arterial e as doenças cardiovasculares.
Em para reduzir os níveis de pessão arterial e as doenças cardiovasculares, a
palavra para expressa o seguinte significado:
a) oposição b) finalidade c) causalidade d) comparação e) temporalidade.
50. (CESPE / DIPLOMATA / 2015) Adaptada
Quanto mais fábricas se abriam nos arredores, mais o subúrbio se erguia em
vida própria, sem que os habitantes pudessem dizer que transformação os
atingia.
A relação estabelecida entre as duas primeiras orações do segundo período do
texto expressa a proporcionalidade da mudança em curso no subúrbio de S.
Geraldo.
51. (CONSULPLAN / Analista / TRF 2ª Região / 2017)
³3UHFLViYDPRVDWDFDUDQWHVTXHHOHQRVGHVWUXtVVH´ ž† $H[SUHVVmR³DQWHV
TXH´HVWDEHOHFHHQtre as orações, uma relação de
a) tempo.
b) condição.
c) finalidade.
d) concessão..
52. (FIOCRUZ / Assistente Técnico / 2016)
A ciência trouxe avanços espetaculares nas lides de guerra, como os
bombardeios com precisão cirúrgica que não poupam civis, mas não trouxe a
democratização da prosperidade antevista. Mágicas novas como o cinema
prometiam ultrapassar os limites da imaginação. Ultrapassaram, mas para o
território da banalidade espetaculosa. A TV foi prevista, e a energia nuclear
intuída, mas a revolução da informática não foi nem sonhada. As revoluções
na medicina foram notáveis, certo, mas a prevenção do câncer ainda não foi
descoberta. Pensando bem, nem a do resfriado. A comida em pílulas não veio
- se bem que a nouvelle cuisine chegou perto. Até a colonização do espaço,
FRPRSUHYLDPRVURWHLULVWDVGR³)ODVK*RUGRQ´HVWiDWUDVDGD0DOFKHJDPRV
a Marte, só para descobrir que é um imenso terreno baldio.
³0DOFKHJDPRVD0DUWHVySDUDGHVFREULUTXHpXPLPHQVRWHUUHQREDOGLR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 77 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

Há palavras em português que, em razão de muitos valores semânticos que


expimem, podem ser classificadas nas frases em diferentes classes. No trecho
DFLPDDSDODYUD³PDO´IRLHPSUHJDGDQRVHQWLGRGH³DFXVWR´³GLILFLOPHQWH´
e é classificada como advérbio. A mesma palavra pode ser empregada como
substantivo e como conjunção. Das frases abaixo, aquela em que a palavra
³PDO´HVWiHPSUHJDGDFRPRconjunção é:
a) Os leigos costumam falar mal dos cientistas.
b) O mal com o mal se paga.
c) O cientista respondeu mal à pergunta que lhe fizeram.
d) Mal apareceram os primeiros sinais da doença, o paciente foi internado.
e) O misticismo faz mal à ciência.
53. (CONSULPLAN / Téc. Judiciário / TSE / 2012)
Enquanto o primeiro é regido por valores como amor e lealdade, o segundo
tem como marca indexadores monetários e contratos.
Assinale a alternativa que poderia substituir Enquanto no período anterior, sem
modificação de sentido.
a) Como b) Já que c) Ao passo que d) Quando
54. (FGV / DPE-MT / Assistente Administrativo / 2015)
³&RQWLQXHFRPDWHQomRUHGREUDGDDRVHFRPXQLFDU´
$VVLQDOHDRSomRTXHLQGLFDDIRUPDGHVHQYROYLGDHTXLYDOHQWHjRUDomR³DRVH
FRPXQLFDU´
a) Caso se comunique.
b) Embora se comunique.
c) Para sua comunicação.
d) Visto que se comunique.
e) Quando se comunique.
55. (CESPE / FUNPRESP / 2016) Adaptada
Mas ele nunca errava, e já nem havia mais o que errar, uma vez que não havia
mais dúvidas...
Julgue o item seguinte, referente aos aspectos linguísticos e às ideias do texto
2KRPHPTXHVyWLQKDFHUWH]DV$ORFXomR³XPDYH]TXHLQWURGX]QRSHUtRGR
em que ocorre, ideia de causa.
56. (CESPE / FUB / 2015) Adaptada
Sem prejuízo à correção gramatical e ao sentido original do texto, a expressão
³QDPHGLGDHPTXHpoderia ser substituída por ³jPHGLGDTXH´
57. (FGV / TJ-SC / 2015)
A manchete abaixo em que os termos ligados pela conjunção E mostram a
relação lógica de causa e consequência é:
a) Jornal belga recebe ameaça de bomba e funcionários são retirados.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 78 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

b) Franceses mostram coragem e vão à passeata.


c) Chargistas criam sindicato e se protegem do terror.
d) Terrorista dá entrevista e se mostra arrependido pela morte de outro
muçulmano.
e) Jornais árabes condenam atentado e defendem o autêntico Islã.
58. (CETREDE / Procurador / 2016)
Em qual das alternativas temos uma conjunção subordinativa causal?
a) Não fale alto que as crianças dormem.
b) Nós não saímos porque chovia muito.
c) Não brigue tanto, pois a vida vale pouco.
d) Ela não veio, pois a sua sala está fechada.
e) Ande depressa porque o trem não espera..
59. (Fepese / Professor / Florianópolis / 2016)
Assinale a alternativa em que o sentido expresso pela conjunção está colocado
corretamente entre parênteses.
a) Quanto mais gritares, mais perderás a razão. (adição)
b) O menino é tão malcriado que ninguém o tolera. (explicação)
c) Como chovesse, não pudemos sair de casa. (causa)
d) Não vi a novela nem o jogo de futebol. (contradição)
e) Ele é um mestre, portanto conhece a matéria. (condição).
60. (CONSULPLAN / CFESS / ASS. TÉCNICO / 2017)
³6HULDXPVREUHVVDOWRSURYLGHQFLDOHVREIRUPDWmRLQRFHQWHHDJUDGiYHOTXH
QLQJXpP VH DERUUHFHULD´ ž†  O vocábulo ³WmR´, associado ao conectivo
³TXH´ estabelece uma relação coesiva de
A) explicação. B) concessão. C) consequência. D) simultaneidade.
61. (Cesgranrio / IBGE / 2016)
No trecho ³4XHYLYHPGHQWURGHXPKRUL]RQWHtão retraído que nele não cabe
um futuro que não seja a repetição da vida ruim´os elementos destacados
estabelecem uma relação semântica de
a) alternância b) explicação c) adversidade d) causa e efeito e) proporção
62. (FCC / TRT 23ª REGIÃO / 2016)
De quati
Aparece um quati escoteiro. Decerto perseguido de cachorro. No chão é
ente insuficiente o quati. Imita ser baleado. O rabo desequilibra de tanto rente
na terra.
Agora, se alcança árvore, quati arma banzé1. Arreganha. Monta episódio.
E até xinga cachorro.
Igual é o tamanduá. Fora do mato, no limpo, tamanduá nega encrenca.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 79 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

Porém se encontra zamboada2, vira gente. E desafia cachorro, onça-pintada,


tenente.
1. confusão, tumulto
2. moita formada por galhos e ramagens de árvores, cipós, trepadeiras

Um segmento que expressa ideia de causa, com relação ao trecho que o


antecede imediatamente, está sublinhado em:
a) No chão é ente insuficiente o quati.
b) Agora, se alcança árvore, quati arma banzé.
c) Fora do mato, no limpo, tamanduá nega encrenca.
d) Monta episódio. E até xinga cachorro.
e) O rabo desequilibra de tanto rente na terra.
63. (FGV / TCE-SE / Desenvolvimento / 2015)
³$ YLGD KRMH HVWi WmR PRGHUQD WmR PRGHUQD TXH WRGRV QyV QDVFHPRV
DWUDVDGRVWHFQRORJLFDPHQWH´ 1RXDLOOHV
A segunda oração desse pensamento tem valor de:
a) consequência; b) modo; c) comparação; d) causa; e) concessão.
64. (FGV / CÂMARA MUN. DE CARUARU / 2015) Adaptada
³2µIXPDFr¶p~WLOSDUDPDWDURVPRVTXLWRVDGXOWRVPDVQmRDFDEDFRPRV
ovos. Por isso, deve ser empregado apenas em períodos de epidemias com o
REMHWLYRGHLQWHUURPSHUUDSLGDPHQWHDWUDQVPLVVmR´
Assinale a opção que indica o conector que tem seu sentido indicado de forma
inadequada.
a) para / finalidade
b) mas / adversidade
c) por isso / consequência
d) apenas / exclusão
e) em / tempo
65. (IBFC / HMDCC / Administração / 2015)
Considerando a estrutura das frases e a pontuação como ferramenta de
delimitação de sentidos, observe o trecho abaixo e responda à questão.
³0XLWRVWHOHVSHFWDGRUHVDVVXPHPHVVHFRPSRUWDPHQWR7DQWRTXHXPJUXSR
de estudiosos da Universidade de Rutgers, nos Estados Unidos, por meio de
experimentos e pesquisas, concluiu que a velha história do vício na TV não é
VyXPDPHWiIRUD´
2EVHUYDQGRTXHDH[SUHVVmR³WDQWRTXH´HVWDEHOHFHFRPDIUDVHDQWHULRUXPD
relação semântica, pode-se afirmar que tal expressão possui o valor de:
a) Causa b) Consequência c) Conclusão d) Comparação

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 80 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

66. (Funcab / EMSERH / Administrador / 2016)


A conjunção destacada em ³¬YROWDGRYHQGHGHLURHUDXPDQXYHPGHSLRV
WDQWRV48(ID]LDPPH[HUDVMDQHODV´inicia uma oração e, contextualmente,
atribui-lhe valor:
a) consecutivo. b) concessivo. c) proporcional. d) nominalizador. e) causal
67. (Funcab / Escrivão de Polícia Civil-PA / 2016)
Em: ³2TXHSRGHVHUWmRH[DWRHPPDWpULDGH3VLFRORJLD-Psiquiatria, QUE não
DGPLWHYDULiYHLV"´DRUDomRLQWURGX]LGDSHODFRQMXQomR³TXH´ HPGHVWDTXH 
pode ser reescrita, sem alteração de sentido, como:
a) visto não admitir variáveis.
b) até não admitir variáveis.
c) em virtude de não admitir variáveis.
d) ao não admitir variáveis.
e) de sorte a não admitir variáveis.
68. (FCC / TRE-SP / Analista / 2017)
Eles [os museus] são grandes porque o artista moderno quer nos envolver
com o seu trabalho...
Com as devidas alterações, caso se invertam as relações de subordinação da
frase acima, mantém-se o sentido original fazendo-se uso da conjunção:
a) a despeito de
b) conquanto
c) em conformidade com
d) de maneira que
e) uma vez que.
69. (CONSULPLAN/ PREF. SABARÁ / ADMINISTRADOR / 2017)
Mesmo assim, uma forma inovadora de enxergar o nosso planeta, bolada por
uma equipe internacional de cientistas, é capaz de deixar surpreso ± e cabreiro
± quem ainda tem um pouco de imaginação.
A locução empregada para introduzir o 2º§ estabelece, em relação ao
parágrafo anterior, um sentido que seria preservado havendo substituição da
mesma por:
A) Pois que. B) Visto que. C) Mas também. D) Não obstante.
70. (IDECAN / INCA / 2017)
(P³1R%UDVLOWXGRVHID]HPERUDWXGR VHMDSURLELGR´SDUDPDQWHURVHQWLGR
GRWUHFKRHPHYLGrQFLDHDFRUUHomRJUDPDWLFDOGRWH[WRRWHUPR³HPERUD´
pode ser substituído corretamente por:
a) Visto que. b) Conforme. c) Mesmo que. d) A menos que.
71. (FCC / TRT 9ª REGIÃO / Analista / 2015)
Embora as esculturas ficassem longe do público, elas foram vistas por artistas

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 81 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

que visitavam Picasso.


Sem prejuízo da correção e do sentido, o elemento sublinhado acima pode ser
substituído por:
a) Porquanto b) Apesar de c) Contudo d) Conquanto e) A despeito de.
72. (CONSULPLAN / Ag. Com. Saúde / Pref. Cascavel / 2016)
Em ³2XWUDV YH]HV RV MRYHQV QmR XVDP R SUHVHUYDWLYR TXDQGR HP
relacionamentos estáveis, justificando que seu uso pode gerar desconfiança
em relação à fidelidade do casal, apesar de que, no mundo, hoje, o uso de
preservativo nas relações poderia significar uma prova de amor e proteção
SDUDFRPRRXWUR´a expressão destacada pode ser substituída, sem alteração
de sentido, por
a) senão.
b) embora.
c) visto que.
d) enquanto.
e) com o propósito de.
73. (CESPE / TRE-PI / Taquigrafia / 2016)
No texto A mensagem virtual, a oração ³HPERUDWHQKDPRVREMHWLYRVFRPXQV´
expressa uma ideia de
a) comparação. b) consequência. c) causa. d) finalidade. e) concessão.
74. (IDECAN / UFPB / 2016)
³1mRH[LVWHPYDFLQDVFRQWUDR]LNDembora algumas plataformas possam ser
DGDSWDGDVHPSRXFRWHPSR´A palavra em destaque introduz uma ideia de:
a) Condição em relação ao fato exposto.
b) Causa ou consequência do que foi expresso anteriormente.
c) Conformidade em relação ao fato da não existência de vacina contra o
zika.
d) Oposição a uma outra ideia exposta sem, no entanto, impedir sua
realização.
75. (FCC / TRT 14ª REGIÃO / Técnico / 2016)
O acervo do José Veríssimo estava com o marechal [Inácio José Veríssimo,
filho do acadêmico], que era uma pessoa voltada para a literatura, apesar de
ser militar.
A passagem destacada permite concluir que, na opinião de Helena Araújo Lima
Veríssimo,
a) não é muito comum haver militares interessados em literatura.
b) não é raro encontrar militares que entendam profundamente de literatura.
c) é esperado que os militares de alta patente entendam de literatura.
d) é natural que um filho de acadêmico se torne um militar apaixonado por
literatura.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 82 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

e) é frequente encontrar militares com formação especializada em literatura.


76. (CESPE / TRE-PI / 2016) Adaptada
Não obstante tenha sido um dos primeiros países da América Latina a conceder
o sufrágio universal, o Brasil está entre as nações que apresentam a mais
baixa representação política feminina no Ocidente
No que diz respeito aos aspectos linguísticos do texto Educação prisional,
julgue o seguinte item. A correção e o sentido original do texto seriam
mantidos FDVRVHVXEVWLWXtVVHDH[SUHVVmR³1mRREVWDQWH´SRU³(PERUD´
77. (CESPE/UNB- MPE RR- Promotor/2017)
Para conviver em sociedade, é necessário, entretanto, conter tais impulsos.
Mantendo-se o sentido original e a correção gramatical do texto 1A16AAA, o
vocábuOR³HQWUHWDQWR´ O SRGHULDVHUVXEVWLWXtGRSRU
a) ainda.
b) mas.
c) sobretudo.
d) todavia.
78. (CESPE / TRE-PI / 2016) Adaptada
Na entrada do terceiro milênio, o ingresso das brasileiras na política
institucional ainda é tímido. Porém, esse é um quadro que já se mostrou
menos animador.
A correção e o sentido original do texto seriam mantidos caso se substituísse
DFRQMXQomR³3RUpP´SRUMas.
79. (CESPE / DEPEN / 2015) Adaptada
A substituição da locução ³QR HQWDQWR´ por conquanto manteria a relação
estabelecida entre a última oração do segundo parágrafo e a que a antecede.
80. (FGV / ICMS-RJ / 2011) Adaptada
Ao analisar o progresso da humanidade, percebe-se que o desenvolvimento
social e econômico foi possível porque o homem sistematizou formas de
organização entre os povos.
Assinale a alternativa em que a alteração da estrutura destacada no período
acima tenha provocado alteração sintática e semântica.
a) porquanto o homem tenha sistematizado formas de organização entre os
povos
b) pois o homem sistematizou formas de organização entre os povos
c) conquanto o homem tenha sistematizado formas de organização entre os
povos
d) já que o homem sistematizou formas de organização entre os povos
e) uma vez que o homem sistematizou formas de organização entre os povos

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 83 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

81. (IF-CE / Aux. Administração / 2016)


Em ³1RHQVLQRcomo HPRXWUDVFRLVDVDOLEHUGDGHGHYHVHUTXHVWmRGHJUDX´
o termo em destaque poderia ser substituído, sem alterar o sentido, por
a) de maneira que.
b) embora.
c) entretanto.
d) assim que.
e) tal qual.
82. (CESPE / FUB / 2015) Adaptada
Ao se substituir ³'H DFRUGR FRP´ por Conforme, mantêm-se a correção
gramatical e os sentidos do texto.
83. (ITAME / Biólogo / 2016)
Obseve o emprego da conjunção e nos períodos abaixo:
1. Cláudio gosta de Sofia e vai se casar com Alice.
2. Paula gosta de Pedro e vai se casar com ele no final do ano.
3. O time de basquete se preparou muito e tornou-se campeão.
Ela estabelece, pela ordem, as seguintes relações de sentido:
a) adição / adição / adição
b) oposição / oposição / explicação
c) oposição / adição / conclusão
d) adição / oposição / adição.
84. (FCC / ARTESP / 2017)
Cem anos depois, vivemos um momento semelhante diante da iminência de
uma "nova revolução industrial", como define o secretário de Transportes
paulistano, Sérgio Avelleda.
O vocábulo como, nessa passagem do texto, estabelece a mesma relação de
sentido que a verificada em:
(A) Como ainda há poucos carros autônomos nas ruas, seu impacto no
cotidiano é desconhecido.
(B) Ainda não se sabe como ficarão as leis de trânsito com a popularização dos
carros autônomos.
(C) Como dito no texto, os carros autônomos, com diferentes tecnologias, já
são uma realidade.
(D) O modo acelerado como os carros sem motorista têm sido produzidos é
realmente espantoso.
(E) Os carros autônomos são, para a sociedade atual, como eram os carros no
início do século 20..

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 84 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

85. (Funcab / Escrivão de Polícia Civil-PA / 2016)


No período: ³( FRPR R SVLTXLVPR p UHVSRQViYHO SHOR PRGR GH DJLU SRU
conseguinte, temos em todos os crimes, obrigatoriamente e sempre,
elementos objetivos da mente de quem os praticou", a conjunção ³FRPRestá
empregada com o mesmo valor relacional que em:
a) COMO estava ferido, pediu socorro.
b) Procedia sempre COMO manda a lei.
c) COMO' um cão. vivia farejando pistas.
d) Eis o modo COMO o delito foi praticado.
e) Era um psiquiatra tão bom COMO o pai
86. (FCC / MANAUSPREV / Administrativa / 2015)
João Barbosa Rodrigues faleceu em 1909. Em 1925, o famoso antropólogo
==c0834==

Kurt Nimuendaju tentou encontrar Miracanguera, mas a ilha já tinha sido


tragada pelas águas do rio Amazonas. Arqueólogos americanos também
vasculharam áreas arqueológicas da Amazônia, inclusive no Equador, Peru e
Guiana Francesa, no final dos anos de 1940. Como não conseguiram achar
0LUDFDQJXHUD³GHFLGLUDP´TXHDGHVFREHUWDGREUDVLOHLURWLQKDVLGR³DSHQDV
XPDVXEWUDGLomRGHDJULFXOWRUHVDQGLQRV´
Mantendo-se o sentido original, na frase ³Como não conseguiram achar
Miracanguera...´, o elemento sublinhado pode ser corretamente substituído
por:
a) Por mais que
b) Conforme
c) Ainda que
d) De modo que
e) Uma vez que
87. (VUNESP / TJ-SP / 2015)

A conjunção que inicia a fala da personagem tem o mesmo sentido que a


destacada em:
a) Como Machado de Assis, Guimarães Rosa engrandece a literatura nacional.
b) Como pode um peixe vivo viver fora da água fria? ± diz a conhecida canção.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 85 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

c) Como choveu, algumas escolas de samba se sentiram prejudicadas no


desfile.
d) Como praga, o capim cresceu e se espalhou rapidamente por todo o terreno.
e) Como disse Fernando Pessoa, tudo vale a pena se a alma não é pequena.
88. (VUNESP / MPE-SP / 2016)
Leia os quadrinhos para responder à questão.

Na oração ± Já que tenho XPSHL[LQKRGRXUDGRFRPRPDVFRWH«±, o sentido


expresso pela conjunção em destaque é de
D H[SOLFDomRHQHVVHFRQWH[WRSRGHVHUVXEVWLWXtGDSRU³3RLV´
E FDXVDHQHVVHFRQWH[WRSRGHVHUVXEVWLWXtGDSRU³&RPR´
c) oposição e, nesse contexto, pode ser VXEVWLWXtGDSRU³0DV´
G FRQIRUPLGDGHHQHVVHFRQWH[WRSRGHVHUVXEVWLWXtGDSRU³&RQIRUPH´
H FRQFOXVmRHQHVVHFRQWH[WRSRGHVHUVXEVWLWXtGDSRU³3RUWDQWR´
89. (COSEAC / Prefeitura de Niterói / Professor / 2016)
A substituição do conectivo em destaque altera o sentido fundamental do
enunciado em: ³DPmRGHREUDFDSD]GHVXEVWLWXLURLQGtJHQD32,6HVWHQmR
HVWDYDDIHLWRDRWUDEDOKR´SRUTXDQWR
90. (COSEAC / Prefeitura de Niterói / Professor / 2016)
Essa situação de escravo, portanto, marca como traço fundamental e
indispensável de ser assinalada a presença do negro africano no Brasil; a
influência não foi do negro em si, mas do escravo e da escravidão, já observou
Gilberto Freyre.
A substituição do conectivo em destaque altera o sentido fundamental do
HQXQFLDGRHP³(VVDVLWXDomRGHHVFUDYR3257$172PDUFDFRPRWUDoR  
DSUHVHQoDGRQHJURDIULFDQRQR%UDVLO´pois.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 86 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

91. (CESPE / TRE-PI / 2016)


Cada uma das opções a seguir apresenta um trecho do texto A participação
política das mulheres no Brasil:... ² indicado entre aspas ², seguido de uma
proposta de reescrita desse mesmo trecho.
Assinale a opção em que a reescrita, além de manter o sentido da informação
originalmente apresentada, também preserva a correção gramatical do texto.
$ ³&RQYpPUHJLVWUDU também, as interrupções na trajetória democrática do
país por rHJLPHVGLWDWRULDLV´: Convém registrarem as interrupções na trajetória
democrática do país por regimes ditatoriais
%  ³1D HQWUDGD GR WHUFHLUR PLOrQLR R LQJUHVVR GDV EUDVLOHLUDV QD SROtWLFD
institucional ainda é ttPLGR´: Na entrada do terceiro milênio, as mulheres no
Brasil ainda têm receio de ingressar na política institucional
&  ³3RUpP HVVH p XP TXDGUR TXH Mi VH PRVWURX PHQRV DQLPDGRU´: Esse
quadro no entanto, já foi menos animador
' ³6HMa em cargos eletivos, seja em postos de direção nos órgãos executivos
ou no VLVWHPDMXGLFLiULR´: Seja em cargos eletivos, em postos de direção, nos
órgãos executivos ou no sistema judiciário
( ³R%UDVLOHVWiHQWUHDVQDo}HVTXHDSUHVHQWDPDPDLVEDL[DUHSresentação
política fePLQLQDQR2FLGHQWH´: o Brasil é uma das nações cuja representação
política feminina é uma das mais baixas no Ocidente.
92. (COPEVE / UFAL / Assistente Administrativo / 2016)

Quantos conectivos conjuncionais existem no texto da gravura? .


a) 1 b) 2 c) 3 d) 4 e) 5
93. (AOCP / EBSERH / 2016)
Analise os itens em destaque e assinale a alternativa correta quanto ao que se
afirma entre parênteses acerca da função exercida por esses itens nos
contextos a seguir.
D ³Para o Mestre em Psicologia Social e fundador da organização Inteligência
Relacional, pode-se e deve-VHDSUHQGHUQDHVFROD´³eSUHFLVRFULDUFRQGLo}HV
para TXHQmRVHIRUPHPDSHQDVSHVVRDVTXHSDVVHPQRYHVWLEXODU´ $PERV

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 87 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

são conjunções que expressam finalidade).


E ³GHVHQYROYHUFRPSHWrQFLDVVRFLDLVHprincipalmente, a competência do
EHPYLYHU´ DGYpUELRTXHPRGLILFDRVLQWDJPD³FRPSHWrQFLDVVRFLDLV´ 
F  ³HP VHX SURFHVVR HYROXWLYR DFDERX SRU FKHJDU D WUDEDOKRV PDLV
profundos de desenvolvimento de Cultura de Paz e Não Violência, até culminar
HPXPDPHWRGRORJLDGHHGXFDomRHPRFLRQDOHVRFLDO´ SUHSRVLomRTXHLQGLFD
inclusão).
G  ³( p IiFLO HP XPD DQiOLVH PDLV FULWHULRVD YHULILFDU TXH D UHSUHVVmR p
necessária desde que OHJtWLPD´ ORFXomRconjuntiva com função de expressar
condição).
H ³$QWHVGHWXGRpXPDFLGDGHTXHHGXFDHa que educa em um sentido de
TXHRIHUHFHRSRUWXQLGDGHGH GHVHQYROYLPHQWR´ DUWLJRIHPLQLQRFRPIXQomR
de retomar o termo cidade).
94. (Cesgranrio / ANP / 2016)
A relação lógica expressa pela palavra em destaque está indicada
adequadamente entre colchetes em:
D  ³7RUQRX-se a cultura internacional dominante, principal, a chamada
mainstream, conforme o título do livro escrito pelo sociólogo francês Frédéric
0DUWHO´ O15-18) [concessão]
E ³9RFrSRGHRXYLU/DG\*DJDJRVWDUGH$YDWDUHOHU2&yGLJR'D9LQFL
mas, no final das contas, a maior parte da cultura que você consome e ama
JHUDOPHQWHpQDFLRQDO´ O-44) [condição]
F ³Para resumir as coisas, eu diria que todos temos duas culturas: a nossa
HDDPHULFDQD´ O-59) [causa]
G   ³Por quê? Porque a língua é muito importante, porque a identidade é
PXLWRLPSRUWDQWH´ O-50) [finalidade]
H  ³Portanto, nós estamos em um mundo cada vez mais global, mas, ao
PHVPRWHPSRDFXOWXUDDLQGDpHVHUiPXLWRQDFLRQDO´ O-58) [conclusão]
95. (IBFC / EBSERH / 2017)
Para relacionar as orações, em ³(XVDELDID]HUSLSDe KRMHQmRVHLPDLV´,
o autor faz uso de uma conjunção que deve ter seu sentido inferido pelo
contexto. Trata-se do valor semântico de:
a) adição.
b) conclusão.
c) explicação.
d) alternância.
e) oposição.
96. (IBFC / EBSERH / 2017)
A oração ³'HSRLVTXHDUUXPHLRFXSDomRjQRLWHKiVHQKRUDVPmHVGHIDPtlia
TXHMiPHFXPSULPHQWDUDP´ é introduzida por uma locução conjuntiva que
apresenta o mesmo valor semântico da seguinte conjunção:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 88 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

a) porquanto.
b) conforme.
c) embora.
d) quando.
e) pois.

Mais questões comentadas

97. (CONSULPLAN / Analista / TRF 2ª Região / 2017)


Considerando os aspectos semânticos das orações coordenadas, a conjunção
empregada em ³)DELDQRHVWDYDFRQWHQWHHDFUHGLWDYDQHVVDWHUUD´ (3º§)
possibilita a expressão, no contexto apresentado, de
a) ligação de orações que representam fatos coexistentes.
b) realce às alternativas do enunciado propiciando equivalência entre elas.
c) fatos sequenciados de forma cronológica numa relação de causa e efeito.
d) produção de efeito adicional diante da expressão de desejo da primeira
oração..
98. (CONSULPLAN / TJ-MG / JUIZ LEIGO / 2015)
³7UrVPHVHVGHSRLVGHLQLFLDGDDREUDRSHGUHLURFDLXGDVDFDGDXPSRXFR
por falta de sorte, outro pouco por falta de cuidado, porque ele não tinha e
não usava equipamento de proteção. Ele, Itamar, ficou com pena e acabou
SDJDQGRDWpRVHUYLoRTXHRRSHUiULRDLQGDQmRWLQKDWHUPLQDGR´ ž† 2XVR
do termo em destaque no trecho anterior tem por finalidade:
A) Preceder uma explicação relacionada ao acontecimento anteriormente
explicitado.
B) Introduzir uma informação causal tendo em vista o fato mencionado
anteriormente.
C) Anteceder a expressão de um fato que o locutor presume já conhecido do
interlocutor, constituindo evidência não sujeita à contestação.
D) Introduzir a continuidade lógica do raciocínio iniciado anteriormente,
iniciando um argumento para uma tese em relação à informação anterior.
99. (CONSULPLAN / Administrador / MAPA / 2014)
Os termos destacados em ³1mRFRPRDILUPDomRGDSUySULDVXEMHWLYLGDGHmas
como caminho para alcançar uma verdade objetiva através das múltiplas
VXEMHWLYLGDGHV´indicam, respectivamente, uma relação de
a) ressalva e explicação.
b) oposição e finalidade.
c) oposição e explicação.
d) explicação e finalidade.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 89 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

100. (CONSULPLAN / Ag. Adm. / HOB / 2015)


³ TXHUHUDSD]LJXDUWRGDVDVFULDQoDVH MRYHQV FRP PHGLFDPHQWRV
para que QmRHVWRUYHPRVSURIHVVRUHVMiGHVHVSHUDGRV´As palavras
sublinhadas na frase anterior estabelece entre as orações uma relação de
a) causa.
b) finalidade.
c) proporção.
d) comparação.
101. (CONSULPLAN / Aux. Adm. / Pref. Caratinga-MG / 2015)
No trecho ³No entanto, o primeiro desafio do SUS esbarra no suporte
dos postos e centros de saúde, além das unidades do Programa Saúde
da Família, já que, se estes serviços funcionassem plenamente, seriam
capazes de atender e resolver 80% dos problemas de saúde da
população, desafogando assim os hospitais e clínicas especializadas, que
poderiam dar mais atenção aos casos GH PDLRU  FRPSOH[LGDGH´   a
expressão destacada expressa ideia de
a) escolha.
b) condição.
c) contraste.
d) consequência.
102. (CONSULPLAN / Aux. Adm. / Coimbra / 2014)
Em ³GHWHURGHVYDULRGDPiTXLQD embora H[SRQGRDRULVFRDVXDYLGD´a
palavra destacada pode ser substituída, sem prejuízo semântico, por
a) assim.
b) salvo se.
c) ainda que.
d) portanto.
e) por conseguinte.
103. (CONSULPLAN / Guarda Mun. Amb. / Natividade / 2014)
Em ³2V VtQGLFRV QmR SRGHP SURLELU mas é importante que os animais não
iQFRPRGHPDYL]LQKDQoD´a palavra destacada expressa ideia de
a) objetivo.
b) oposição.
c) concessão.
d) consequência.
104. (CONSULPLAN / Assist. Securitário / Banestes / 2013)
$H[SUHVVmRVXEOLQKDGDQRH[FHUWR³HVHPHGLFDP a fim de minimizar os
efeitos GHVDVWURVRVTXHUHVSLQJDP´LQGLFD
a) causa.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 90 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

b) tempo.
c) oposição.
d) finalidade.
e) comparação.
105. (CONSULPLAN / Téc. Administrativo / CREA RJ / 2011)
(P ³0XLWR UHFRPHQGiYHO portanto QD DWXDOLGDGH´ D SDODYUD GHVWDFDGD
exprime circunstância de:
a) Conclusão.
b) Explicação.
c) Causa.
d) Finalidade.
e) Condição.
106. (CONSULPLAN / Téc. Labor. / Pref. Congonhas-MG / 2010)
³ - Pois é, não jogo futebol, mas WHQKR DOPD GH DUWLOKHLUR´ D SDODYUD
destacada anteriormente exprime ideia de:
a) Escolha.
b) Contraste, oposição.
c) Finalidade.
d) Explicação.
e) Soma, adição.
107. (CONSULPLAN / Prof. Edu. Inf. / 2010)
(P ³3RU TXH MRJDGRUHV JDQKDP WDQWR GLQKHLUR H SRGHU sem ter ficado nos
bancos escolares"´$RUDomRJULIDGDHVWDEHOHFHFRPDRUDomRDQWHULRUUHODomR
de:
a) Tempo.
b) Consequência.
c) Causa.
d) Condição
e) Concessão.
108. (CONSULPLAN / Prof. Port. / Pref. Congonhas-MG / 2010)
1RWUHFKR³quando investigadas, um sistema de comunicação complexo e
DOWDPHQWH GHVHQYROYLGR  ´ R WHUPR HP GHVWDTXHFRQIHUH D PHVPD LGHLD
indicada por:
a) Já que.
b) Mesmo.
c) O quanto.
d) Assim como.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 91 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

e) No momento em que.
109. (CONSULPLAN / Recep. / Pref. Poço Redondo-SE / 2010)
³2VWDPDQKRVYDULDPconforme RJUDXGHHQYROYLPHQWR´$SDODYUDGHVWDFDGD
exprime ideia de:
a) Concessão.
b) Proporção.
c) Conformidade.
d) Comparação.
e) Tempo.
110. (CONSULPLAN / Motorista / Cantagalo / 2013)
(P ³Mas a escola tem apenas parte da reVSRQVDELOLGDGH QLVVR´ D SDODYUD
destacada exprime circunstância de
a) soma.
b) tempo.
c) escolha.
d) oposição.
e) contradição.
111. (CONSULPLAN / Médico / Pref. Resende-RJ / 2010)
³,VVR QmR SURYD HQWUHWDQWR TXH SDUD YHQFHU QD YLGD EDVWD WHU XP DERP
vocabXOiULR´
A relação de significado estabelecida pela palavra entretanto no trecho acima
é de:
a) Concessão.
b) Oposição.
c) Causa.
d) Consequência.
e) Finalidade.
112. (CONSULPLAN / Ana. Judiciário / Tre-RS / 2008)
A Criada
Seu nome era Eremita. Tinha dezenove anos. Rosto confiante, algumas
espinhas. Onde estava a sua beleza? Havia beleza nesse corpo que não era
feio nem bonito, nesse rosto onde uma doçura ansiosa de doçuras maiores era
o sinal da vida.
Beleza, não sei. Possivelmente não havia, se bem que os traços indecisos
atraíssem como água atrai. Havia, sim, substância viva, unhas, carnes, dentes,
mistura de resistências e fraquezas, constituindo vaga presença que se
concretizava porém imediatamente numa cabeça interrogativa e já
prestimosa, mal se pronunciava um nome: Eremita. Os olhos castanhos eram
intraduzíveis, sem correspondência com o conjunto do rosto. Tão

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 92 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

independentes como se fossem plantados na carne de um braço, e de lá nos


olhassem ± abertos, úmidos. Ela toda era de uma doçura próxima a lágrimas.
³3RVVLYHOPHQWH QmR KDYLD VH EHP TXH RV WUDoRV LQGHFLVRV DWUDtVVHP´
Assinale a alternativa que NÃO mantém na segunda oração a idéia de
concessão:
a) ...embora os traços indecisos atraíssem...
b) ...ainda que os traços indecisos atraíssem...
c) ...desde que os traços indecisos atraíssem...
d) ...posto que os traços indecisos atraíssem...
e) ...conquanto que os traços indecisos atraíssem...
113. (CONSULPLAN / Auditor / Cantagalo / 2013)
$RUDomRVXEOLQKDGDHP³(VWão ficando velhas, mas não estão ficando sábias.´
estabelece, com o período anterior, uma relação de
a) causa.
b) adição.
c) oposição.
d) conclusão.
e) explicação.
114. (CONSULPLAN / Ana. Informática / SDS-SC / 2008)
(P³R%UDVLOWUD]XPJHQHGHIHLWXRVRTXH atinge a nação inteira, mesmo
que PXLWDVSHVVRDVVHH[FOXDPGHVVDDQiOLVH´DH[SUHVVmRGHVWDFDGDWHP
valor semântico de:
a) Comparação.
b) Modo.
c) Intensidade.
d) Concessão.
e) Condição.
115. (CONSULPLAN / Advogado / EMBRAPA / 2007)
³No entanto, a criaçmRGHDYHVFRPEDWHQWHVSRGHWHUILQDOLGDGHVQREUHV´$
SDODYUDRXH[SUHVVmRTXH1­2SRGHVXEVWLWXLU³QRHQWDQWR´p
a) Entretanto.
b) Não obstante.
c) Todavia.
d) Contudo.
e) Portanto.
116. (CONSULPLAN / Advogado / Pref. Sertaneja-PR / 2010)
³8QLYHUVLWiULRVportanto, incapazes de ter um pensamento independente e de
aprender qualquer matéria, sem sequer saber se conduzir. Profissionais

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 93 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

competindo por trabalho, inseguros e atordoados, logoIUXVWUDGRV´


De acordo com os termos destacados anteriormente, assinale a alternativa
correta:
a) Somente o primeiro tem valor explicativo.
b) Os dois têm valor conclusivo.
c) Os dois possuem valor explicativo.
d) Somente o segundo tem valor conclusivo.
e) Somente o segundo tem valor explicativo.
117. (CONSULPLAN / Ag. Adm. / Pref. Sertaneja-PR / 2010)
³Mas QDPRUDGRQmR´A palavra destacada anteriormente exprime ideia de:
a) Adição, soma.
b) Oposição, adversidade.
c) Justificação, confirmação.
d) Condição.
e) Finalidade.
118. (CONSULPLAN / Ass. Adm. / Pref. Uberlândia-MG / 2012)
No trecho ³Embora alguns linguistas usem esse termo com outros sentidos, a
UHWXPEDQWHPDLRULDGDVSHVVRDV´a expressão destacada estabelece relação
de
a) conformidade.
b) causa.
c) consequência.
d) condição.
e) concessão.
119. (CONSULPLAN / Aux. FOP. / Pref. Uberlândia-MG / 2012)
Em ³Embora esses resultados não possam ser considerados civilizados, é bom
DGYHUWLUTXHHOHVSRGHPSLRUDU´
A palavra destacada exprime circunstância de
a) causa.
b) proporção.
c) finalidade.
d) concessão.
e) tempo.
120. (CONSULPLAN / Ag. Pesq. Mapeamento / IBGE / 2011)
Em ³ embora R SDtV WHQKD HYROXtGR´ o termo destacado pode ser
substituído sem prejuízo de sentido por
a) ainda que.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 94 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

b) mas.
c) que.
d) para que.
e) quando.
121. (CONSULPLAN / Ana. Jud. / TRE-MG / 2013)
Em ³se eu aplicar o modelo da Ética à Política, entenderei que um lado é o
bem, e o outro, o mal; e portanto WHQWDUHL LPSHGLU µR PDO¶ DWp PHVPR GH
FRQFRUUHU´os termos destacados produzem efeitos de sentido que traduzem,
respectivamente,
a) ressalva e acréscimo.
b) ressalva e explicação.
c) condição e conclusão.
d) condição e explicação.
e) conformidade e conclusão.
122. (CONSULPLAN / Ag. Adm. / Cantagalo / 2013)
Em ³No entanto, torna-se um problema na medida em que cresce e adquire a
maturidade sexual, por volta dos dois anos e meio de idade´ D H[SUHVVmR
destacada na afirmativa anterior pode ser substituída, sem alteração de
sentido, por
a) porém.
b) por isso.
c) para que.
d) logo que.
e) uma vez que.
123. (CONSULPLAN / Aux. Saúde Bucal / CODESP / 2013)

ObservaǦse que o trecho ³e também irritante,...´ estabelece com o trecho


anterior ³Na verdade, fica difícil imaginar a vida profissional sem ele, seus
recursos de memória e arquivo, a capacidade de fazer correções, eliminar ou
acrescentar SDODYUDV H SDUiJUDIRV´ XPD UHODomR GH VHQWLGR TXH QmR IRL
explicitada por nenhum conectivo. O conectivo que poderia ser corretamente
empregado é

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 95 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

a) mas.
b) pois.
c) já que.
d) porque.
e) visto que.
124. (CONSULPLAN / Aux. Adm. / Caratinga / 2015)
1R WUHFKR ³No entanto, o primeiro desafio do SUS esbarra no suporte dos
postos e centros de saúde, além das unidades do Programa Saúde da Família,
já que, se estes serviços funcionassem plenamente, seriam capazes de
atender e resolver 80% dos problemas de saúde da população, desafogando
assim os hospitais e clínicas especializadas, que poderiam dar mais atenção
DRV FDVRV GH PDLRU FRPSOH[LGDGH´ ž†  D H[SUHVVmR GHVWDFDGD H[SUHVVD
ideia de
a) escolha.
b) condição.
c) contraste.
d) consequência.

Gabaritos

1. INCORRETA 24. LETRA A


2. CORRETA 25. CORRETA
3. INCORRETA 26. LETRA C
4. CORRETA 27. LETRA A
5. INCORRETA 28. LETRA B
6. LETRA C 29. CORRETA
7. LETRA C 30. INCORRETA
8. INCORRETA 31. CORRETA
9. LETRA D 32. LETRA A
10. LETRA C 33. LETRA C
11. LETRA D 34. LETRA C
12. LETRA A 35. INCORRETA
13. LETRA E 36. LETRA A
14. LETRA C 37. LETRA C
15. LETRA E 38. LETRA A
16. LETRA D 39. INCORRETA
17. INCORRETA 40. LETRA C
18. CORRETA 41. LETRA A
19. LETRA E 42. LETRA C
20. INCORRETA 43. LETRA D
21. LETRA E 44. INCORRETA
22. LETRA B 45. LETRA A
23. INCORRETA 46. LETRA C

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 96 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 02 ± Felipe Luccas Rosas

47. LETRA A 86. LETRA E


48. LETRA D 87. LETRA E
49. LETRA B 88. LETRA B
50. CORRETA 89. INCORRETA
51. LETRA A 90. INCORRETA
52. LETRA D 91. LETRA E
53. LETRA C 92. LETRA C
54. LETRA E 93. LETRA D
55. CORRETA 94. LETRA E
56. INCORRETA 95. LETRA E
57. LETRA A 96. LETRA D
58. LETRA B 97. LETRA A
59. LETRA C 98. LETRA B
60. LETRA C 99. LETRA B
61. LETRA D 100. LETRA B
62. LETRA E 101. LETRA C
63. LETRA A 102. LETRA C
64. LETRA C 103. LETRA B
65. LETRA B 104. LETRA D
66. LETRA A 105. LETRA A
67. LETRA E 106. LETRA B
68. LETRA D 107. LETRA E
69. LETRA D 108. LETRA E
70. LETRA C 109. LETRA C
71. LETRA D 110. LETRA D
72. LETRA B 111. LETRA B
73. LETRA E 112. LETRA C
74. LETRA D 113. LETRA C
75. LETRA A 114. LETRA D
76. CORRETA 115. LETRA E
77. LETRA D 116. LETRA B
78. INCORRETA 117. LETRA B
79. INCORRETA 118. LETRA E
80. LETRA C 119. LETRA D
81. LETRA E 120. LETRA A
82. CORRETA 121. LETRA C
83. LETRA C 122. LETRA A
84. LETRA C 123. LETRA A
85. LETRA A 124. LETRA C

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 97 de 97


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

Lista de questões comentadas na aula

1. (CESPE / Funpresp / 2016) Adaptada


...Creio que os artigos de psicologia não foram publicados, pois há tempo li
HVWHDQ~QFLRQXPVHPDQiULR³,QWHOHFWXDOGHVHPSUHJDGR$PDGHX$PDUDO
Júnior, em estado de desemprego, aceita esmolas, donativos, roupa velha,
SmR GRUPLGR 7DPEpP DFHLWD WUDEDOKR´ O anúncio não produziu nenhum
efeito.
Com relação às ideias e aos aspectos linguísticos do texto, julgue o item que
se segue.
O sujeito da oração 'também aceita trabalho' está elíptico e se refere a
'Amadeu Amaral Júnior', o que justifica o emprego da IRUPDYHUEDO³DFHLWD
na terceira pessoa do singular.
2. (CONSULPLAN / Ag. Adm. / HOB / 2015)
Em todas as frases a seguir as formas verbais estão flexionadas no mesmo
tempo, EXCETO:
D ³0XGDUGHYLGDpGLItFLO´
E ³HYLPXLWDVFULDQoDVPDLVDJLWDGDVRXGLVWUDtGDV´
F ³1mRSRGHPRVPDVTXHUHPRVWRUQDUWXGRKRPRJrQHR«´
G ³6HPSUHPHLPSUHVVLRQDRLPSXOVRJHUDOGHLJXDODUDWRGRV«´
3. (CONSULPLAN / Téc. Enf. Trabalho / CBTU / 2014)
Minha filha chega da escola dizendo que há revolução na rua. Em companhia
de Carlos Drummond de Andrade,
meu vizinho no Posto 6, fui ver o que estava se passando.
Vejo um general comandar alguns rapazes naquilo que mais tarde um
UHSyUWHU FKDPRX GH ³JORULRVD EDUULFDGD´ 2V UDSD]HV DUUDQFDP EDQFRV H
árvores impedem o cruzamento da av. Atlântica com a rua Joaquim Nabuco.
De modo geral, os verbos são flexionados no presente do indicativo para
exprimirem fatos que ocorrem no mesmo momento em que o falante os
observa. Porém, esse tempo verbal também pode ser empregado para fazer
referência a fatos passados,
a) indicando uma ocorrência habitual, costumeira.
b) que foram totalmente concluídos antes do momento da fala.
c) que não haviam chegado ao seu final no momento em que outro fato

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 102 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

aconteceu.
d) mostrando-os como se tivessem acontecendo no momento da fala, a fim
de aproximá-los do leitor.
4. (CESPE / STJ / 2015) Adaptada
Com a justiça privada, o tipo de pena ou sanção deixou de ser uma surpresa
para seu destinatário, e não mais correspondia a todo e qualquer ato que o
ofendido pretendesse; ao contrário, a punição do ofensor passou a sofrer os
limites da extensão e da intensidade do dano causado.
Acerca das estruturas linguísticas do texto, julgue o item a seguir.
$VXEVWLWXLomRGDV IRUPDVYHUEDLV³GHL[RX´ ³FRUUHVSRQGLD´H³SDVVRX´SRU
³GHL[D´³FRUUHVSRQGH´H³SDVVD´UHVSHFWLYDPHQWHPDQWHULDDFRUUHomRHD
coerência do texto.
5. (CONSULPLAN / Telefonista / Pref. Cascavel-PR / 2016)
Assinale, a seguir, a afirmativa transcrita do texto em que o tempo verbal
apresenta-se DIFERENTE dos demais.
D ³(ODUHSUHVHQWDXPSHUtRGRGHFULVH  ´
E ³$WHOHYLVmRLQIRUPD HIRUPDRSLQL}HV  ´
F ³  DJUDQGHSDUWHGDVLQIHFo}HVDFRQWHFHX no período da adolescência,
 ´
G  ³4XDVH PHWDGH GRV QRYRV FDVRV GH $,'6 RFRUUH HQWUH RV MRYHQV FRm
LGDGHHQWUHHDQRV´
H  ³(VWXGRV GH YiULRV SDtVHV WrP GHPRQVWUDGR D FUHVFHQWH RFRUUrQFLD GH
AIDS entUHRVDGROHVFHQWHV  ´
6. (MPE-SC / Promotor de Justiça / 2016)
(P³os navegadores europeus reconheceram´DIRUPDYHUEDOHQFRQWUD-se
no pretérito perfeito do indicativo, tempo que indica ação ocorrida e
concluída em determinado momento do passado.
7. (CESPE / TCE-PA / 2016)
Mas o tenente Souza pensava de modo contrário!
Apontava à lua com o dedo, deixava-se ficar deitado quando passava um
enterro, não se benzia ouvindo o canto da mortalha, dormia sem camisa,
ria-se do trovão! Alardeava o ardente desejo de encontrar um curupira, um
lobisomem ou uma feiticeira. Ficava impassível vendo cair uma estrela, e
achava graça ao canto agoueiro do acauã, que tantas desgraças ocasiona.
Enfim, ao encontrar um agouro, sorria e passava tranquilamente sem tirar
da boca o seu cachimbo de verdadeira espuma do mar.
Julgue o item que se segue, referente aos aspectos linguísticos do texto.
No último parágrafo do texto, o emprego das formas verbais no pretérito
imperfeito do indicativo indica que as ações do tenente Souza eram
habituais. Tais hábitos acabam por caracterizar o personagem.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 103 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

8. (CONSULPLAN / Aux. Adm. / Pref. Dq. Caxias-RJ/2015)


Analise: ³TXHHOHWUD]LDXPDPDOD´Nas frases a seguir, as formas verbais
destacadas estão flexionadas em tempos verbais diferentes da frase acima,
EXCETO:
a) ³&RPRera LQIHOL]HVWHPHXSHUVRQDJHP´
E ³4XDOseria RSUREOHPDGHFDGDXPGHOHV"´
F ³«TXDQGRHOHassoou RQDUL]YLROHQWDPHQWH«´
G ³TXHestou DGRUDQGRHVWDORXFXUDVHPDQDO´
9. (FCC / MANAUSPREV / 2015)
³QDpSRFDROiWH[representava GDH[SRUWDomRGR%UDVLO´
O verbo flexionado nos mesmos tempo e modo que o grifado acima
encontra-se em:
a) ... mas conheço um pouco o interior da Amazônia.
b) .. quando já era uma fortaleza avançada dos portugueses...
c) A temática amazônica se impõe...
d) ... escreveria sobre Paraty ou Pequim, certamente.
e) E teve uma importância econômica fundamental durante 40 anos...
10. (FCC / Auditor Fiscal / SEFAZ-RJ / 2014)
Portugal e os Países baixos tinham uma longa história de relações
comerciais, quando, em 1580, o Reino uniu-se à monarquia plural dos
Habsburgo madrilenos...
Está correto o que se afirma em:
Na frase inicial do segundo parágrafo, a correlação entre as formas verbais
empregadas evidencia que, em um cenário de ação prolongada, foi fixada
uma outra ação, enquadrada em um espaço de tempo determinado.
11. (FGV / TJ-SC / 2015)
³4XHEUDGRGHFDQVDoRSHORH[FHVVRGHWUDEDOKRRSROLFLDOtinha adormecido
QDSRUWDULDGDUHYLVWD´
O tempo simples correspondente à forma verbal sublinhada é:
a) havia adormecido; b) adormecendo; c) adormecia; d) adormeceria;
e) adormecera.
12. (ESAF / ANAC / Analista / 2016)
Assinale a opção que apresenta substituição correta para a forma verbal
contribuiu
No início da década de 60, trinta anos depois de sua fundação, a Panair
já era totalmente nacional. Era uma época de crise na aviação comercial
brasileira, pois todas as companhias apresentavam problemas operacionais
e crescentes dívidas para a modernização geral do serviço que prestavam.
Uma novidade contribuiu para apertar ainda mais a situação financeira

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 104 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

dessas empresas ² a inflação. Apesar disso, não foram esses problemas,


comuns às concorrentes, que causaram a extinção da Panair.
a) contribuísse b) contribua c) contribuíra d) contribuindo e)
contribuído
13. (IF-CE / Técnico TI / 2017)
Agi com boa intenção. Talvez ele gostasse. Veio um hambúrguer de quinoa
frita. Duas desvantagens de uma vez: engordava por causa da fritura e só
tinha gosto do óleo em que mergulhara! Quase perdi o amigo!
2 YHUER ³PHUJXOKDU´ está empregado no pretérito mais-que-perfeito do
indicativo e assinala
a) uma ação habitual.
b) uma ação anterior a outro fato do passado.
c) um fato passado, mas de incerta localização no tempo.
d) um acontecimento que ocorria com frequência no passado.
e) um fato já concluído em determinado momento do passado.
14. (Fepese / SJC-SC / 2016) Adaptada
LL  ³2 *RYHUQR YDL JDVWDU PDLV GLQKHLUR FRP FDGHLD )DODP TXH Oi GHQWUR
não é fácil, que DTXLVLPpXPDHVFROLQKD´
Em (ii), a perífrase verbal ³YDLJDVWDU´está no tempo presente, podendo ser
substituída pela forma simples ³JDVWD´ sem alterar o significado temporal
da frase..
15. (CESPE / TELEBRAS / 2015) Adaptada
Com a construção do primeiro satélite geoestacionário brasileiro, a
segurança do tráfego de dados importantes no país poderá aumentar, uma
vez que eles passarão a ser criptografados. Segundo o presidente da
TELEBRAS, um dos objetivos do desenvolvimento do satélite será a proteção
às redes que transmitem informações sensíveis do governo federal.
No que se refere às estruturas linguísticas do texto acima e às ideias nele
desenvolvidas, julgue o item a seguir.
Haveria prejuízo da correção e da coerência do texto caso, no primeiro
SDUiJUDIR DV IRUPDV YHUEDLV ³SRGHUi´ H ³VHUi´ IRVVHP VXEVWLWXtGDV
por ³SRGH´ e ³p´, respectivamente.
16. (CESPE / TRE-GO / 2015) Adaptada
Em 1880, o deputado Rui Barbosa, da Bahia, redigiu, a pedido do presidente
do Conselho de Ministros, José Antônio Saraiva, o projeto de lei de reforma
eleitoral. Em abril de 1880, o Ministério do Império enviaria o documento à
Câmara dos Deputados. Aprovado posteriormente pelo Senado, em janeiro
do ano seguinte seria transformado no Decreto n.º 3.029 e ficaria
popularmente conhecido como Lei Saraiva. Por intermédio dela, seriam
instituídas eleições diretas no país para todos os cargos, à exceção do de
regente, amparado pelo Ato Adicional.
2 WHPSR HPSUHJDGR QDV IRUPDV YHUEDLV ³HQYLDULD´ O3  ³VHULD

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 105 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

tUDQVIRUPDGR´³ILFDULD´H³VHULDPLQVWLWXtGDV´GiDHQWHQGHUTXHDVDo}HV
correspondentes a essas formas verbais não se concretizaram, de fato, no
ano de 1880.
17. (FGV / TJ-RO / Administrador / 2015) Adaptada
Segundo o seu criador Mark Zuckerberg, em seu segundo ano da
Universidade de Harvard (2004), ele e seus amigos tinham muito a
compartilhar: suas fotos, o que estudavam, de que gostavam, entre tantas
outras coisas que os amigos curtem. Pensando nisso, Mark elaborou ± em
duas semanas e com apenas 19 anos de idade ± a primeira versão do que
se tornaria essa famosa rede social.
$IRUPDYHUEDO³WRUQDULD´IRLHPSUHJDGDFRPRVHJXLQWHYDORU
a) marcar um fato futuro, mas próximo;
b) transportarmo-nos a uma época passada e descrevermos o que seria ação
futura;
c) designar fatos passados concebidos como contínuos ou permanentes;
d) indicar ações posteriores à época em que se fala;
e) exprimir a incerteza sobre fatos passados.
18. (Cesgranrio / UNIRIO / 2016)
O tempo do carnaval era obrigatório. A despeiro de todas as mudanças, ele
continua sendo a pausa que dá sentido e razão ao tempo como uma
majestade humana. Este imperador sem rivais que diz que passa quando,
de fato, quem passa somos nós.
No final do parágrafo, o autor compara o tempo a um imperador sem rivais,
SRLVpRWHPSR³TXHGL]TXHSDVVDTXDQGRGHIDWRTXHPSDVVDVRPRVQyV´
(l. 4-5).
O presente do indicativo, empregado três vezes nessa passagem, produz o
seguinte efeito de sentido:
a) atribui validade permanente a uma afirmação.
b) confere atualidade a uma ação ocorrida no passado.
c) retrata algo ocorrido no momento da fala do imperador.
d) indica um fato próximo, cuja realização é dada como certa.
e) infere à cena apresentada uma descrição do momento vivido.
19. (Fepese / SJC-SC / 2016) Adaptada
L ³$LQGDTXHRVHVIRUoRVLQVWLWXFLRQDLVVHMDPOHJtWLPRVHYDULDGRVSDUDGDU
a esses jovens a rotina de uma escola de bairro, eles estão encarcerados e,
DRFRQWUiULRGHTXHPHVWiIRUDQmRVHHVTXHFHPGLVVR´
(P L DVIRUPDVYHUEDLV³VHMDP´H³HVTXHFHP´HVWmRQRWHPSRSUHVHQWH
mas diferem quanto ao modo, pois a primeira está no modo subjuntivo e a
segunda, no indicativo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 106 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

20. (CESPE / Telebrás / 2015) Adaptada


Revoltados com a mecanização, que diminuiria empregos e pioraria as
condições de trabalho, movimentos organizados de trabalhadores ingleses
calcularam que o melhor a fazer era destruir as máquinas das indústrias.
Acerca das ideias e das estruturas linguísticas do texto Tecnologia gera
emprego, julgue o item subsequente. Seriam mantidas a correção gramatical
H DV UHODo}HV GH VHQWLGR GR WH[WR FDVR D IRUPD YHUEDO ³GLPLQXLULD´ IRVVH
VXEVWLWXtGDSRU³SRGHULDGLPLQXLU´
21. (CESPE / TCE / 2015) Adaptada
Embora a fiscalização de contas conste dos registros mais antigos...
2 HPSUHJR GR PRGR VXEMXQWLYR QD IRUPD YHUEDO ³FRQVWH GHSHQGH
sintaticamente da presença da conjunção ³(PERUD
22. (CESPE / TJ-DF 2015) Adaptada
Nesse sentido, a política de universalização do acesso à justiça deve
contemplar dois eixos de atuação: o de proteção dos direitos violados
(inclusive quando o órgão violador é o próprio Estado) e o de prevenção da
violência, por meio do envolvimento da sociedade na formulação de uma
política que assegure direitos e promova a paz.
No que se refere aos aspectos linguísticos do texto, julgue o próximo
item.
O uso do modo subjuntivo em ³TXHDVVHJXUHGLUHLWRVH promova a paz"
indica que a ideia expressa nessas orações é uma possibilidade.
23. (CESPE / MPU / 2015) Adaptada
Em outras palavras, o inquérito policial é um procedimento policial que tem
por finalidade construir um lastro probatório mínimo, ensejando justa causa
para que o titular da ação penal possa formar seu convencimento, a opinio
delicti, e, assim, instaurar a ação penal cabível.
Julgue o item que se segue, a respeito das estruturas linguísticas do texto.
A correção gramatical e a coerência do texto seriam preservadas, caso as
IRUPDV YHUEDLV ³SRVVD IRUPDU´ H ³LQVWDXUDU´ IRVVHP VXEVWLWXtGDV
respectivamente, por forme e instaure.
24. (FCC / Técnico / TRE-RR / 2015)
(nem creio que venha a ter)
O verbo flexionado nos mesmos tempo e modo em que se encontra o
sublinhado acima está em:
a) ... que existam pássaros ...
b) ... que ele entendia ...
c) ... o que lhes ensinam ...
d) ... que assim se chama.
e) ... que uns dizem com voz rouca ...

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 107 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

25. (CESPE / SEDF / 2017)


O transporte é público, o corpo da mulher não.
Asssédio sexual no ônibus é crime.
Se você for ou vir alguém sendo assediado, ligue 190 e denuncie.
1RWHUFHLURSHUtRGR³IRU´H³YLU´VmRIRUPDVIOH[LRQDGDVQRPRGRVXEMXQWLYR
dos verbos de movimento ir e vir, empregadas em um jogo de palavras que
aproxima o campo semântico do movimento com o campo semântico do
transporte.
26. (CONSULPLAN / PREF. SABARÁ / ADM. / 2017)
As sugestões de alterações para os trechos selecionados a seguir
apresentam mudança de pessoa verbal, dentre as sugestões pode-se afirmar
que ocorre INADEQUAÇÃO gramatical apenas em:
$ ³>@RDXWRUQDUUDDOJXQVDFRQWHFLPHQWRV>@´ ž† ± tu narras alguns
acontecimentos.
% ³1yVQRVDEUDoDPRVFRPRGXDVJLUDIDV>@´ ž† ± Vós vos abraçastes
como duas girafas.
& ³3RUTXHQmRWHQKRPHGRGHGLILFXOGDGHVHPHHVIRUoREDVWDQWH´ ž† ±
Porque não tendes medo de dificuldades e te esforçais bastante!
' ³$SHVDUGHVXDVOLPLWDo}HVDSUHQGHXDHVFUHYHUFRPDERFD>@´ ž† 
± Apesar de nossas limitações, aprendêramos a escrever com a boca.
27. (CONSULPLAN / Ana. Jud. / TRE-MG / 2013)

Com relação ao texto publicitário, julgue o item:


Os verbos são apresentados no modo imperativo ou no presente do
indicativo.
28. (IESES / Bioquímico / PREF. SJC / 2017) Adaptada.
Sobre alguns verbos, são apresentadas análises nas alternativas que
seguem. Marque a única INCORRETA.
D ³-RJDL´HVWiFRQMXJDGRQRPRGRLPSHUDWLYRDILUPDWLYR
E 'LVVHU´HVWiFRQMXJDGRQRSUHVHQWHGRPRGRVXEMXQWLYR
F ³6HULD´HVWiFRQMXJDGRQRIXWXURGRSUHWpULWRGRPRGRLQGLFDWLYR
d) ³3RVVD´HVWiFRQMXJDGRQRpresente do modo subjuntivo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 108 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

29. (UFSC / 2016)

Assinale a alternativa que completa CORRETAMENTE a frase.


$IRUPDYHUEDO³FRQILD´QRWHUFHLURTXDGULQKRGR7H[WRHVWiHPSUHJDGD
==c0834==

na:
a) terceira pessoa do imperativo afirmativo.
b) segunda pessoa do futuro do subjuntivo.
c) segunda pessoa do presente do indicativo.
d) segunda pessoa do imperativo afirmativo.
e) terceira pessoa do presente do indicativo..
30. (CESPE / MI / ATA / 2009) Adaptada
$ IRUPD YHUEDO ³(VFXWDL´ HVWi IOH[LRQDGD QR PRGR VXEMXQWLYR H LQGLFD D
incerteza do falante a respeito do que está dizendo.
31. (VUNESP / 2015)
Assinale a alternativa em que o verbo destacado está empregado no modo
imperativo.
a) Ninguém lhe roubava a paz.
b) O homem começou a insultá-OR«
F «HVSDOKDUiSD]SDUDWRGRV«
G «pXPDSHVVRDPXLWRPDLVIHOL]«
H «PDQWHQKD-se em silêncio por alguns segundos.
32. (CONSULPLAN / CFESS / ANALISTA / 2017)
$VVLQDOHDDOWHUDomRSDUDDIUDVH³Existe aí um motivo adicional, além do
desrespeito ao local coletivo.´ ž†  FXMD correção linguística pode ser
observada:
A) Existe aí motivos adicionais, além do desrespeito ao local coletivo.
B) Haveriam aí motivos adicionais, além do desrespeito ao local coletivo.
C) Deve haver aí motivos adicionais, além do desrespeito ao local coletivo.
D) Devem haver aí motivos adicionais, além do desrespeito ao local coletivo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 109 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

33. (CESPE / TRE-PE / Técnico / 2017)


A moralidade, que deve ser uma característica do conjunto de indivíduos da
sociedade, deve caracterizar de modo mais intenso ainda aqueles que
exercem funções administrativas e de gestão pública ou privada. Com
relação a essa ideia, vale destacar que o alcance da moralidade vincula-se a
princípios ou normas de conduta, aos padrões de comportamento
geralmente reconhecidos, pelos quais são julgados os atos dos membros de
determinada coletividade. Disso é possível deduzir que os membros de uma
corporação profissional ² no caso, funcionários e servidores da
administração pública ² também devem ser submetidos ao julgamento
ético-moral. A administração pública deve pautar-se nos princípios
constitucionais que a regem. É necessário, ainda, que tais princípios estejam
pública e legalmente disponíveis ao conhecimento de todos os cidadãos, para
que estes possam respeitá-los e vivenciá-los.
No texto, a forma verbal ³GHYHP´ no trecho ³RV PHPEURV GH XPD
corporação profissional (...) também devem ser submetidos ao
julgamento ético-PRUDO´, foi empregada no sentido de
A) probabilidade.
B) capacidade.
C) permissão.
D) obrigação.
e) necessidade.
34. (FUNCAB / Polícia Civil / Papiloscopista / 2016)
Ao substituir-VH ³XP IDWR´ SRU ³IDWRV´ HP ³H[LVWH XP IDWR QD 3VLFRORJLD-
3VLTXLDWULD IRUHQVH TXH p  GH FHUWH]D´ preserva-se a norma de
concordância verbal com a seguinte construção modalizadora:
a) devem haver fatos.
b) deve existir fatos.
c) deve haverem fatos.
d) devem existirem fatos.
e) deve haver fatos..
35. (UFC / Assistente em Administração / 2016) Adaptada
Após recomendar uma sequência de procedimentos, o autor afirma: A
instalação deve começar automaticamente. Com a forma verbal deve, o
autor prevê o início da instalação automática como algo:
a) provável. b) desejável. c) garantido. d) permitido. e) obrigatório.
36. (FCC / Auditor Fiscal / SEFAZ-RJ / 2014)
Em ³começaram a edificar´ o verbo auxiliar empresta um matiz semântico
ao verbo principal, indicando a iminência da ação de edificar.
37. (FGV / MPE-RJ / Analista Processual / 2016)
Os verbos de estado indicam: estado permanente, estado transitório,

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 110 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

mudança de estado, aparência de estado e continuidade de estado. A frase


que mostra um verbo de estado com valor de mudança de estado é:
D ³iUHDVTXHDQWHVHUDPEDUDWDVHGHIiFLODFHVVR´
E ³WRUQDP-VHPDLVFDUDV´
F ³KDELWDQWHVTXHVRIUHPFRPHVVHSURFHVVRVmRWUDEDOKDGRUHVFRPEDL[RV
VDOiULRV´
G ³$OpPGLVVRjPHGLGDTXHDVFLGDGHVFUHVFHP´
H ³DJUDQGHPDLRULDGDSRSXODomRSREUHEXVTXHSRUPRUDGLDVHPUHJL}HV
DLQGDPDLVGLVWDQWHV´-
38. (FGV / Fiscal de Tributos / Prefeitura de Niterói / 2015)
Os verbos de ligação mostram noções distintas de estados.
A noção do verbo sublinhado indicada corretamente é:
D ³20F'RQDOG
Vse tornou o maior distribuidor mundial de brinquedos" /
mudança de estado;
E  ³1D PLQKD YLGD GHYR DGPLWLU TXH andei fascinado pelo brilho do
consumo" / estado permanente;
F ³$VFDVDVHPTXHSDVVDPRVWmRSRXFRWHPSR são repletas de objetos" /
continuidade de estado;
G ³KiDSHQDVFLQFRDQRVeram de última geração" / estado transitório;
H ³São os nossos brinquedos" / aparência de estado.
39. (CESPE / SEDF / 2017)
A língua continua sendo forte elemento de discriminação social, seja no
próprio contexto escolar, seja em outros contextos sociais, como no acesso
ao emprego e aos serviços públicos em geral (serviços de saúde, por
exemplo).
2 HPSUHJR GR YHUER ³FRQWLQXD´ SHUPLWH TXH VH LQILUD TXH QmR KRXYH
mudança na caractHUL]DomRGDOtQJXDFRPR³IRUWHHOHPHQWRGHGLVFULPLQDomR
VRFLDO´
40. (IBFC / EBSERH / Advogado / 2017)
Há algum tempo venho afinando certa mania. Nos começos chutava tudo o
que achava.
$ORFXomRYHUEDO³YHQKRDILQDQGR´SUHVHQWHQRSULPHLURSHUtRGRGR texto,
constrói um sentido de ação:
a) passada e concluída.
b) que ainda será realizada.
c) pontual e ocorrida no presente.
d) com ideia de continuidade.
e) passada que não mais se realiza.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 111 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

41. (CESPE / Polícia Científica / 2016)


Seriam mantidos os sentidos e a correção gramatical caso a forma verbal
³HQWUDUD´ fosse substituída por
a) entrava. b) haveria entrado. c) tinha entrado. d) há de entrar. e)
entraria.
42. (FGV / TL / 2015) Adaptada
Na frase ³$ HSLGHPLD GH GHQJXH QHVWH DQR QR (VWDGR de São Paulo tem
SURYRFDGR HP PpGLD PDLV GH XPD PRUWH SRU GLD´ o emprego da forma
verbal ³WHPSURYRFDGR´mostra uma ação que
a) se iniciou há muito pouco tempo.
b) se encerrou em passado recente.
c) se iniciou no passado e continua no presente.
d) começou num momento anterior a outra ação passada.
e) mostrou curta duração em passado recente.
43. (CESPE / TCU / 2015) Adaptada
...A LRF, logo nos primeiros anos, atinge boa parte de seus objetivos,
notadamente em relação à observância dos limites da despesa com pessoal,
o que permitiu uma descompressão da receita líquida e propiciou maior
capacidade de investimento público. O regulamento marca avanços também
no controle de gastos em fins de gestão e em relação ano novo papel que as
leis de diretrizes orçamentárias passaram a desempenhar. Não obstante
todos os avanços, o momento exige cautela e reflexões.
No que se refere às ideias e aos aspectos linguísticos do texto acima, julgue
o item. O presente foi empregado nas formas verbais ³DWLQJH´ ³PDUFD´
³H[LJH´H³SDVVD´para indicar uma ação habitual, iniciada no passado e que
se estende ao momento em que o texto foi escrito.
44. (CESPE / TCE-RN / 2015) Adaptada
A garantia desse preceito advém da própria Constituição...
Julgue o item seguinte.
A forma verbal ³DGYpPHVWiQRVLQJXODUSRUTXH concorda com o núcleo do
sujeito da oração em que se insere: ³JDUDQWLD
45. (VUNESP / MPE-SP / Médico Psiquiatra / 2016)
Mesmo quando envelhece, e não tem como ser trocado, ele se mantém
atualizável e altamente customizado.
Assinale a alternativa em que o verbo está corretamente conjugado,
VHJXLQGRRSDGUmRGHFRQMXJDomRGH³PDQWHU´
a) Chegaria a conclusões mais acertadas, caso se detesse a examinar os
dados com o cuidado necessário.
b) Para que se abstessem de votar, seria necessário que os convencessem
com bons argumentos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 112 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

c) Acusam-nas de desonestas, porque reteram informações que teriam de


ter disponibilizado.
d) Pediu que nos contivéssemos diante das provocações, pois elas poderiam
nos desestabilizar.
e) Em vez de atender aos clientes, alguns dos rapazes se entretiam com o
celular, trocando mensagens.
46. (FCC / Auditor Fiscal / SEFAZ-SP / 2013)
Acerca de verbos encontrados no texto é correto afirmar, tomando como
parâmetro o padrão culto escrito:
"abater" - está adequadamente empregado na frase "Se eles abativessem
pelo menos 10% do valor total, eu pagaria à vista".
47. (CESPE / FUB / 2015)
O fator mais importante para prever a performance de um grupo é a
igualdade da participação na conversa. Grupos em que poucas pessoas
dominam o diálogo têm desempenho pior do que aqueles em que há mais
troca. O segundo fator mais importante é a inteligência social dos seus
membros, medida pela capacidade que eles têm de ler os sinais emitidos
pelos outros membros do grupo. As mulheres têm mais inteligência social
que os homens, por isso grupos mais diversificados têm desempenho
melhor.
Julgue o item seguinte, referente às ideias e às estruturas linguísticas do
WH[WRDFLPD(PWRGDVDVRFRUUrQFLDVGH³WrP´QRWH[WRpH[LJLGRRXVRGR
acento circunflexo para marcar o plural.
48. (FCC / TRE-AP / Administrativa / 2015)
Pesquisas que ...... a identificar sítios geoturísticos poderão favorecer o
turismo em bases sustentáveis. O geoturismo, assim, ...... assumir um grau
de importância estratégica para o futuro do desenvolvimento turístico do
Brasil, desde que não ...... danos aos sítios geológicos, como a remoção
ilegal de fósseis e minerais.
Preenchem corretamente as lacunas da frase acima, na ordem dada:
a) se proporem ± deverá ± ocorrem
b) se proporiam ± GHYLDíRFRUUHVVH
c) proporem-se ± deveria ± ocorram
G VHSURSXVHUHPíGHYHíRFRUUDP
e) propuserem-se ± deverá ± ocorrem
49. (CESPE / FUB 2015) Adaptada
No trecho ³$ VXVWHQWDELOLGDGH   DPELHQWDLV´ A sustentabilidade
corporativa requer negócios amparados em boas práticas de governança e
em benefícios sociais e ambientais...), para expressar um fato ocorrido em
momento anterior ao atual, que foi totalmente terminado, a forma verbal
³UHTXHU´deveria ser substituída por requereu. Nesse caso, mesmo após a
alteração do tempo verbal, a referência à pessoa do discurso seria mantida.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 113 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

50. (Cesgranrio / IBGE / 2016)


A frase em que a palavra destacada está flexionada de acordo com a norma-
padrão da língua portuguesa é:
a) Para comunicar a seus acionistas o resultado financeiro semestral, o
relatório abrangeu os aspectos principais relacionados à produção da
empresa.
b) Quando o Congresso propor que as lâmpadas incandescentes não sejam
mais vendidas no país, a população terá de se acostumar ao novo padrão.
c) O governo interviu na fabricação de lâmpadas quando decidiu que
novos modelos deveriam tornar-se obrigatórios no nosso país.
d) Se os moradores obterem lâmpadas modernas para iluminar suas
casas, farão economia de eletricidade.
e) Se você ver águas paradas, tome uma providência para evitar a
proliferação do mosquito.
51. (FCC / Eletrobrás / 2016) Adaptada
A frase está escrita corretamente, de acordo com a norma-padrão:
- O autor expressou o desejo que os livros mantessem margens estensas e
páginas em branco. -
52. (FCC / Auditor Fiscal / SEFAZ-RJ / 2014)
Está clara e correta a redação deste livre comentário sobre o texto:
Para quem se ater ao espírito das leis, segundo Voltaire, é preferível fazer
justiça com os leigos ponderados do que deixar-lhe nas mãos de juristas
empertigados e autoritários.
53. (CESPE / Diplomata / 2015)
...Houve quem passasse a escrever registo, em vez de registro, e preguntar,
em vez de perguntar, porque assim se escrevia em Portugal. Já ao tempo de
José de Alencar, um publicista ríspido, José Feliciano de Castilho, viera de
Lisboa para o Rio de Janeiro, com a missão de ensinar-nos a escrever como
se escrevia em Portugal. Daí a reação do romancista cearense no prefácio
GHVHXV6RQKRVG¶2XURHP³&HQVXUHPSLTXHPRXFDOHP-se, como
lhes aprouver. Não alcançarão jamais que eu escreva, neste meu Brasil,
coisa que pareça vinda em conserva lá da outra banda, como a fruta que nos
PDQGDPHPODWD´
Com relação a aspectos gramaticais do texto acima, julgue o próximo item.
Na oração µFRPR OKHV DSURXYHU¶ foi empregada uma forma flexionada do
verbo aprazer, cujo radical é o mesmo que o do adjetivo aprazível, de uso
corrente na atualidade.
54. (IF-CE / Técnico TI / 2017)
O verbo abolir, em ³$EROL D FDUQH GH SRUFR  ´ é defectivo, pois sua
conjugação não é completa. Não é verbo defectivo:
a) trovejar. b) falir. c) computar. d) suar. e) colorir.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 114 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

55. (CESPE / CÂM. DOS DEPUTADOS / ANALISTA / 2012)


Sem prejuízo para a ideia original do texto, o período ³&RPRDVUHDOLGDGHV
são diferentes, por nem sempre se adequarem aos padrões internacionais,
as interpretações falavam em cópias malfeitas, em empreendimentos mal
UHDOL]DGRVHPSURPHVVDVDVHFXPSULU´poderia ser corretamente reescrito
da seguinte forma: Como as realidades, às vezes, não se adéquam aos
padrões internacionais por serem diferentes, as interpretações referiam-se
a cópias que eram malfeitas, a empreendimentos que eram mal realizados
e a promessas que não foram cumpridas.
56. (VUNESP / Delegado / Polícia Civil-CE / 2015)
Assinale a alternativa em que o emprego das formas verbais está em
conformidade com a norma-padrão da língua portuguesa.
a) As entidades que propuserem medidas para valorizar os idosos deverão
beneficiar o convívio entre as gerações.
b) A geração atual certamente teria muito a ganhar se reavisse o
conhecimento acumulado pelos mais velhos.
c) Quanto mais se manterem atentos aos ensinamentos dos idosos, mais os
jovens perceberão o valor da experiência vivida.
d) Precisamos de governantes comprometidos com as reformas que se
fazerem necessárias para integrar o idoso à sociedade.
e) Se esta geração se dispor a ensinar os mais velhos, é possível que eles
atualizem suas informações rapidamente.
57. (FCC / Auditor Fiscal / ISS Teresina / 2016)
)D]HU SDUWH FRQVWLWXL XP HVSHFtILFR XVR GH ³ID]HU´ YHUER TXH HP RXWURV
contextos, pode assumir distintas funções e acepções. Empregado como
³YHUERYLFiULR´ID]DVYH]HVGHRXWURFRPRVHH[HPSOLILFD em:
a) Tentarei hoje mesmo fazê-lo ver a questão sob ponto de vista menos
rígido.
b) Foi ele quem fez uma bela mesa de madeira maciça.
c) O mediador poderia ter evitado a discussão, mas não o fez.
d) Fizeram frente à situação adversa com coragem e elegância, o que nos
comoveu.
e) O discurso foi bastante positivo, pois o orador o fez de modo acalorado
e consistente..
58. (Instituto Excelência / Almoxarife / 2017)
Considere o seguinte trecho: ³6mR JUDQGHV DV FKDQFHV GH YRFr estar
suando HPELFDV>@´
Os verbos destacados estão respectivamente nas formas nominais:
a) Gerúndio e Particípio.
b) Infinitivo e Particípio.
c) Infinitivo e Gerúndio.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 115 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

d) Nenhuma das alternativas.


59. (CS-UFG / 2016)
No título do texto³)HVWHMDQGRQRSUHFLStFLR´o uso do verbo no gerúndio
a) caracteriza uma forma nominal e neutra.
b) tem a função de indicar uma ação prolongada.
c) reforça a ideia de progressividade no futuro.
d) configura-se como um usual vício de linguagem.
60. (FCC / TRT 3ª REGIÃO / Oficial de Justiça / 2015)
Considere o trecho abaixo, extraído da Nova gramática do português
contemporâneo, de Celso Cunha e Luís F. Lindley Cintra.
...o gerúndio apresenta duas formas: uma simples [...], outra composta
[...].
A forma composta é de caráter perfeito e indica uma ação concluída
anteriormente à que exprime o verbo da oração principal [...].
O que está exposto acima justifica o emprego do gerúndio na frase:
a) Sendo considerada em plena posse de seu juízo no momento de depor,
pôde falar a favor da sobrinha.
b) Combinamos que, no horário das 13 às 15h, estarei atendendo aos
fornecedores de laticínios.
c) Os alunos estão indo para o laboratório porque já vai começar a aula de
Biologia.
d) Tendo já se consumido em lágrimas, despediu-se de todos e partiu.
e) A professora lia sorrindo a narrativa do aluno espirituoso.
61. (FGV / DPE-MT / 2015) Adaptada
A frase que identifica o primeiro erro ± ³8VDU iJXD GD FKXYD SDUD EHEHU
WRPDUEDQKRHFR]LQKDU´± emprega a forma verbal do infinitivo. Com isso,
o autor do texto consegue um resultado conveniente para esse tipo de texto,
que é não personalizar as ações.
62. (CONSULPLAN / TJ-MG / 2015) Adaptada
No trecho ³3DUDRVFDUJRVGR3RGHU([HFXWLYR 3UHVLGHQWH*RYHUQDGRUHVH
Prefeitos), pode haver segundo turno, a ser realizado no último domingo de
RXWXEUR´ a forma verbal ³SRGH KDYHU´ exerce o valor semântico de
hipótese.
63. (FGV / TJ-SC / Administrativo / 2015)
Dos verbos assinalados, só está corretamente empregado o que aparece na
frase:
a) O atual síndico quer crescer a arrecadação de condomínios em cerca de
40%.
b) Os candidatos participaram das provas sem que a chegada com atraso

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 116 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

prejudicou a organização.
c) Se fazer cálculos sobre os resultados do concurso já era difícil, agora
tornou-se mais problemático.
d) O treinador ficará contente quando vencer metade dos jogos e transpor
os adversários mais difíceis.
e) Por mais que os jogadores se esforçam nos treinos, a colocação na tabela
está cada vez pior.
64. ( FGV / SEE / PROFESSOR / 2016)
³2V WH[WRV HVSHFialmente os literários, são capazes de recriar as
informações sobre a humanidade, vinculando o leitor aos indivíduos de
outros tempos. Nas palavras de Larrosa (2000), ler consiste em ver as coisas
diferentes, coisas dantes nunca vistas, entregar-se ao texto, abandonar-se
nele e não apenas apropriar-VHGHOHSDUDQRVVRVILQV´
Nesse segmento do texto, a forma de gerúndio sublinhada possui o valor de
a) tempo: quando vinculam o leitor.
b) condição: caso vinculem o leitor.
c) concessão: mesmo que vinculem o leitor.
d) causa: já que vinculam o leitor.
e) lugar: onde vinculam o leitor.
65. (CONSULPLAN / Ana. Jud. / TRF 2ª Região / 2017)
O verbo ³LQVHULU´utilizado no trecho ³± e da própria realidade em que estão
inseridos ±´DSDUHFHQDOLVWDGHYHUERVFODVVLILFDGRVFRPR³DEXQGDQWHV´RX
seja, que apresentam duas ou três formas de igual valor e função. As orações
a seguir apresentam duas possibilidades admitidas pela norma padrão da
língua para o particípio do verbo, com EXCEÇÃO de:
a) O trabalho foi desenvolvido/desenvolto pelo melhor profissional da região
nesta área.
b) Disse que já havia limpado/limpo todo o pátio exterior, conforme havia
sido orientado.
c) Tendo ganhado/ganho a competição, estabeleceu-se como o novo nome
do atletismo regional.
d) O processo foi trazido/trago a tempo para a devida apreciação sem que
houvesse qualquer prejuízo.
66. (FCC / Auditor Fiscal / SEFAZ-SP / 2013)
Acerca de verbos encontrados no texto é correto afirmar, tomando como
parâmetro o padrão culto escrito:
"afligir" - a única forma de particípio aceitável é "aflito", pois "afligido" é
forma incorreta.
67. (FCC / Auditor Fiscal / SEFAZ-SP / 2013)
Acerca de verbos encontrados no texto é correto afirmar, tomando como

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 117 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

parâmetro o padrão culto escrito: "submeter" - tem duplo particípio.


68. (CESPE / TRE-BA / TÉC. JUDICIÁRIO / 2010) Adaptada
Os vocábulos ³LPSUHVVD´H³HQWUHJXH´são particípios irregulares dos verbos
imprimir e entregar, respectivamente; tais verbos admitem, também, as
formas participiais regulares: imprimido e entregado.
69. ( FCC / Eletrobrás / Eletrosul / 2016)
Há adequada correlação entre os tempos e os modos verbais presentes na
seguinte frase:
a) A responsabilidade pelos defeitos do mundo só seria nossa caso já não
estivessem prontos os elementos que constituem essa imensa
infraestrutura, à qual todos estamos submetidos.
b) Nenhum de nós terá qualquer responsabilidade na injusta distribuição
dos males e benefícios do mundo, a menos que a algum de nós caberia a
tomada de todas as decisões.
c) Provavelmente o mundo natural apresentaria ainda mais falhas, se
viermos a tomar as decisões que implicassem uma profunda alteração na
ordem dos fenômenos.
d) Quem ousará remanejar os ventos e suprimir correntes marítimas, se
tais poderes estivessem à disposição dos nossos interesses e caprichos?
e) Na opinião do autor do texto, o síndico ideal seria aquele cujos serviços
sequer se notem, pois ele manterá com discrição sua eficiência e sua
dedicação ao trabalho.
70. (SERTCAM / Advogado / 2016)
Assinale a alternativa, cuja correlação entre os tempos verbais esteja
correta.
a) Se a gente for, certamente, avisamos à turma.
b) Se Carlinhos escrevesse mais rápido, não se atrasava tanto.
c) Entra, Flávia, mas não fechas a porta.
d) Quando você vim, por favor, avisa-nos.
e) Tudo dará certo, se todos se impuserem quanto ao horário.
71. (FCC / Eletrobrás / Eletrosul / 2016) Adaptada
A frase está escrita corretamente, de acordo com a norma-padrão:
- As crianças terão a liberdade de expor os desenhos que julgarem mais
apropriados ao livro.. -
72. (FCC / TRT 15ª REGIÃO / Enfermagem / 2015)
Ninguém ignora a enorme influência que simples palavras ________ na
história do pensamento e do sentimento dos povos.
Preenche corretamente a lacuna da frase acima:
a) exercem b) a transmitam c) possuíssem d) sejam desempenhadas e)
apresentem-se

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 118 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

73. (VUNESP / SAP-SP / 2015)


Considere o trecho ± ³7HPJHQWHTXHQmRDFUHGLWDHPXPHQVLQRTXHQmR
LPS}HDXWRULGDGH1yVDFUHGLWDPRV«´±, para responder à questão.
Assinale a alternativa em que o trecho está corretamente reescrito, com
todos os verbos no tempo passado.
a) Tem gente que não acreditava em um ensino que não impunha
autoridade. Nós acreditamos.
b) Terá gente que não acreditasse em um ensino que não impusera
autoridade. Nós acreditáramos.
c) Tinha gente que não acreditava em um ensino que não impusesse
autoridade. Nós acreditávamos.
d) Teve gente que não acreditou em um ensino que não impõe autoridade.
Nós acreditamos.
e) Teria gente que não acreditaria em um ensino que não imporá autoridade.
Nós acreditaremos.
74. (FCC / TCE-CE / Controle Externo / 2015)
A articulação entre os tempos e os modos verbais está adequada na frase:
a) Uma vez que o preconceito se revelasse inevitável será oportuna a criação
de leis com o intuito de que foram coibidas atitudes preconceituosas.
b) É natural que há preconceito nas relações interpessoais: mesmo que
tenhamos externado uma avaliação preconceituosa.
c) Qualquer sociedade tem preconceitos, mas era importante que existissem
leis para que pessoas preconceituosas forem exemplarmente julgadas e
punidas.
d) É preciso que se tenha cautela com nosso comportamento em sociedade,
pois seria possível que reações preconceituosas surjam mesmo sem que nós
possamos perceber.
e) O preconceito teria raízes sociais fundas: ele se disseminaria pelas
pessoas e, quando déssemos por nós, estaríamos repetindo algo que sequer
teríamos investigado.
75. (FGV / TJ-SC / 2015) Adaptada
³$LQGDTXHFHUFDGRGHDGYHUVLGDGHVVHpreservares tua ecobiologia interior,
serás IHOL]SRUTXHWUDUiVHPWHXFRUDomRWHVRXURVLQGHYDVViYHLV´
A correspondência entre as formas verbais sublinhadas se manteria correta
na seguinte opção: tivesses preservado / terias sido.
76. (CESPE / TCE-RS / 2013) Adaptada
O Tribunal enviou ofício aos gestores municipais, alertando que o envio de
dados e documentos relacionados às inativações na esfera municipal passará
a ser realizado pela Internet, o que exigirá que as administrações adquiram
certificados digitais...
Em relação às estruturas linguísticas do texto acima, julgue os itens a seguir.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 119 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

$VXEVWLWXLomRGH³H[LJLUi´SRUexigiriam manteria a correta correlação entre


os tempos e modos verbais empregados no período.
77. (FCC / TRT 24ª Região / Técnico / 2017)
Está na voz passiva o verbo do seguinte fragmento do texto:
a) É produzido com matérias primas da própria região...
b) Essa cultura estadual retrata, também, uma mistura de várias outras
contribuições das muitas migrações...
c) A cultura de Mato Grosso do Sul é o conjunto de manifestações artístico-
culturais...
d) O artesanato, uma das mais ricas expressões culturais de um povo, no
Mato Grosso do Sul, evidencia crenças, hábitos, tradições e demais
referências culturais do Estado.
e) As peças em geral trazem à tona temas referentes ao Pantanal e às
populações indígenas...
78. (CONSULPLAN / Ass. Manu. Elétrica / CBTU / 2014)
No trecho ³e VDELGR TXH FHQWHQDV GH EUDVLOHLURV YtWLPDV GH SULV}HV
DUELWUiULDV DFDEDUDP PRUWRV VRE WRUWXUD´ nota-se a presença de voz
passiva analítica que, se transformada em voz passiva sintética, deveria ser
estruturada da seguinte forma:
a) As pessoas sabem que as vítimas de prisões arbitrárias acabariam mortas
sob tortura.
b) É sabido que centenas de brasileiros, vítimas de prisões arbitrárias,
morreram sob tortura.
c) É sabido que centenas de brasileiros, vítimas de prisões arbitrárias, foram
mortos sob tortura.
d) Sabe-se que centenas de brasileiros, vítimas de prisões arbitrárias,
acabariam mortos sob tortura.
79. (FCC / ELETROBRAS / TÉC. SEG. DO TRABALHO / 2016)
Os revestimentos das paredes isolam o calor.
Essa oração está corretamente reescrita na voz passiva em:
a) Isola o calor os revestimentos das paredes.
b) O calor é isolado pelos revestimentos das paredes.
c) Isolam-se o calor ao ser revestido as paredes.
d) O calor é que isola os revestimentos das paredes.
e) Os revestimentos das paredes são isolado do calor.
80. (IFBC / Advogado / 2016)
Em ³2WRFRGHYHODDSDJD-se às primeiras gotas da FKXYDTXHYROWDDFDLU´,
considerando as vozes do verbo, pode-se reescrever, corretamente, o trecho
em destaque da seguinte forma:
a) O toco de vela é apagado

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 120 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

b) O toco de vela apaga a si mesmo


c) Apagam o toco de vela
d) O toco de vela pode ser apagado.
81. (CS-UFG / 2016)
1RVHJPHQWR³vivem perguntando em redor´RXVRGDORFXomRYHUEDO
a) refere-se ao enunciador do texto.
b) indica a eventualidade da ação.
c) apresenta o resultado do processo verbal.
d) indica a indeterminação do sujeito da ação.
82. (VUNESP / PREF. SÃO PAULO / ANALISTA / 2015)
Na voz ativa, a passagem ± Charges, montagens e até samba [...] foram
criados para chamar a atenção sobre o tema. ± assume a seguinte redação:
a) Para chamar a atenção sobre o tema, criaram charges, montagens e até
samba.
b) Criaram-se charges, montagens e até samba para chamar a atenção
sobre o tema.
c) A atenção sobre o tema foi chamada com a criação de charges,
montagens e até samba.
d) Criou-se charges, montagens e até samba para chamar-se a atenção
sobre o tema.
e) A chamada de atenção sobre o tema fez-se com criação de charges,
montagens e até samba.
83. (FCC / TRF 3ª REGIÃO / Analista / 2016)
A frase que NÃO admite transposição para a voz passiva encontra-se em:
a) ... o acesso das obras a um status estético que as exalta.
b) ... elas protestam contra os fatos da realidade, os poderes...
c) Muitas obras antigas celebram vitórias militares e conquistas...
d) O museu, por retirar as obras de sua origem...
e) ... a crítica mais comum contra o museu apresenta-o...
84. (FCC / Copergás / Analista Administrador / 2016)
Transpondo-se para a voz passiva a frase Um dos guardas seguia a velhinha
para que a flagrasse como contrabandista, as formas verbais resultantes
deverão ser
D HUDVHJXLGDíIRVVHIODJUDGD
E WLQKDVHJXLGRíYLUDIODJUi-la
F WLQKDVLGRVHJXLGDíVHIODJUDVVH
G HVWDYDVHJXLQGRíVHWLYHVVHIODJUDGR
H WHULDVHJXLGRíWLYHVVHVLGRIODJUDGD

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 121 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

85. (FCC / Auditor do Tesouro Estadual / SEFAZ-PI / 2015)


Se numa transformação da frase O borracheiro coçou a desmatada
cabeça e proferiu a sentença tranquilizadora atribuirmos aos termos
sublinhados a função de sujeito, as formas verbais que lhes correspondem
deverão ser, na ordem dada:
D KDYLDFRoDGRíWLQKDSURIHULGR
E FRoDUDíSURIHULUD
F WLQKDFRoDGRíWHULDSURIHULGR
G HVWDYDVHQGRFRoDGDíWLQKDVLGRSURIHULGD
H IRLFRoDGDíIRLSURIHULGD
86. (FUNCAB / Polícia Civil / Escrivão / 2016)
Considere-se o seguinte período:
Mas, por outro lado, é na maneira como o delito FOI PRATICADO que SE
ENCONTRAM características 100% seguras da mente de quem o praticou, A
EVIDENCIAR fatos, tal qual a imagem fotográfica REVELA-nos exatamente algo,
seja muito ou pouco, do momento em que FOI REGISTRADA.
Feitos eventuais ajustes indispensáveis, a substituição da forma verbal (em
destaque) que altera fundamentalmente o sentido do enunciado está
registrada em:
a) foi registrada / se registrou.
b) se encontram / são encontradas.
c) a evidenciar / evidenciando.
d) foi praticado / praticou-se.
e) revela / tem revelado.
87. (CESPE / DPU / 2016)
No Brasil, pode-se considerar marco da história da assistência jurídica, ou
justiça gratuita, a própria colonização do país, ainda no século XVI.
No que se refere às ideias e informações do texto, julgue o item a seguir.
Sem prejuízo do sentido e da correção gramatical do texto, o primeiro
período poderia ser reescrito da seguinte forma: A própria colonização do
Brasil, ainda no século XVI, pode ser considerada marco da história da
assistência jurídica, ou justiça gratuita, no país.
88. (CESPE / Funpresp / 2016) Adaptada
A supressão da partícula ³VH´ em ³D QRWtFLD HVSDOKRX-VH UDSLGDPHQWH´
prejudicaria a correção gramatical do texto e seu sentido original.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 122 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

89. (CESPE / Analista / INSS / 2016)

Julgue o item subsequente, que versam sobre os sentidos e os aspectos


linguísticos do texto acima.
$ VXEVWLWXLomR GH ³GHVWDFRX-VH´ O  SRU foi destacado prejudicaria o
sentido original do período.
90. (CESPE / MPOG / 2015) Adaptada
A correção gramatical do período seria preservada ao se substituir
³LPSOHPHQWRX-se" (Assim, implementou-se a administração gerencial...) por
foi ³implementada´.
91. (CESPE / DEPEN / 2015) Adaptada
³O que se constata é que, na prática, o cidadão preso perde muito mais que
VXDOLEHUGDGH´
Em relação às ideias e às estruturas linguísticas do texto, julgue o item
que se segue. A substituição de ³VH FRQVWDWD´ por é
constatado manteria a correção gramatical e o sentido original do texto.
92. (CESPE / MPU / 2015) Adaptada
Só no Império, em 1832, iniciou-se a sistematização das ações do Ministério
Público.
Caso se substituísse ³LQLFLRX-VH´por foi iniciada, a correção gramatical do
período seria prejudicada.
93. (CESPE / TRE-GO / 2015) Adaptada
³/RJRDVHJXLURVHTXLSDPHQWRVVmRUHWLUDGRVGRVVHXVORFDLVGHRULJHPH
levados, ainda no sábado, para as sedes dos TREs, onde permanecem sob
YLJLOkQFLD´
O item a seguir apresenta uma proposta de reescrita de trecho do texto II
² indicado entre aspas ², que deve ser julgada certa se estiver
gramaticalmente correta e mantiver o sentido do texto, ou errada, em caso
contrário.
³(P VHJXLGD UHWLUDP-se os equipamentos dos seus locais de origem e
levam-se, ainda no sábado, para as sedes dos TREs, onde as quais
SHUPDQHFHPVREYLJLOkQFLD´
94. (CESPE / TRE-GO / 2015) Adaptada
O item a seguir apresenta uma proposta de reescrita ² indicado entre aspas
², que deve ser julgada certa se estiver gramaticalmente correta e mantiver
o sentido do texto, ou errada, em caso contrário.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 123 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

³1DYRWDomRSDUDOHODRFRQWH~GRGDVFpOXODVpGLJLWDGRQDVXUQDVHOHWU{QLFDV
VRUWHDGDV´1DYRWDomRSDUDOHODRFRQWH~GRGDVFpGXODVVmRGLJLWDGRs nas
urnas eletrônicas sorteadas.
95. (ESAF / ANAC / Técnico / 2016)
Assinale a opção cujas palavras completam com correção gramatical as
lacunas do texto a seguir.
A versão oficial e clássica da Independência tem sido infelizmente por demais
simplista e esquemática. Resolve-se sumariamente em torno de dois termos
de uma oposição: Brasil colônia e Portugal metrópole. No contraste desses
dois polos divergentes ______(1)______ situar todo o movimento da nossa
emancipação política, sem levar em conta o sem-número de ações e reações
______(2)______ no seio e interior de cada qual.
a) (1) costumam-se (2) a se desenrolarem
b) (1) costuma-se (2) que se processam
c) (1) é hábito (2) de que ocorrem
d) (1) habituamos a (2) que desenvolvem
e) (1) habituamos-nos (2) a que instauram
96. (ESAF / ANAC / Analista / 2016)

-
Em "Pode-se" o pronome "se" indica a noção de condição.
97. (ESAF / ANAC / Analista / 2016)

Em "se sustentavam" e "se elevassem" o pronome "se" indica voz reflexiva.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 124 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

98. (FCC / Agente de Segurança / METRO-SP / 2015)


A frase que pode ser transposta para a voz passiva encontra-se em:
a) Podemos fazer opções mais ousadas.
b) Por que a vida seria como um cardápio, Alfredo?
c) Nesse momento, dois chopes desceram sobre a mesa.
d) Concordo com o restaurante a quilo.
e) Não me venha com essa conversa de cardápio existencial.
99. (CESPE / FUB / 2014) Adaptada
Em ³D GLVSRQLELOLGDGH GH PmR GH REUD HVWUHLWRX-VH´ o pronome ³VH´ em
³HVWUHLWRX-VH´ indica que o sujeito da forma verbal ³HVWUHLWRX´ é
indeterminado.
100. (FCC / ELETROBRAS / ELETROSUL / 2016)
Transpondo-se para a voz ativa a frase Eficazes sistemas de irrigação teriam
sido utilizados pelos antigos em suas culturas de cereais, a forma verbal
resultante deverá ser
a) seriam utilizados.
b) teriam utilizado.
c) foram utilizados.
d) utilizaram-se.
e) haveriam de utilizar..
101. (FGV / Prefeitura de Paulínia / 2016)
³7HULDVLGRRPXQGRFULDGRMDPDLVVHRVHXFULDGRUWLYHVVHPHGRGHVXVFLWDU
confusão? Criar vida quer dizer criar FRQIXVmR´
Sobre a estruturação gramatical da frase acima, está correta a afirmativa:
$IRUPDDWLYDFRUUHVSRQGHQWHD³7HULDVLGRFULDGR´p³WHULDFULDGR´
102. (FGV / DPE-MT / Advogado / 2015)
Assinale a opção que indica o segmento que não exemplifica a voz passiva.
D ³$VVLPTXHSLVDHPVRORHVWUDQJHLURWRGRWXULVWDORJRpGHVFREHUWR´
E  ³6y SRXFRV PLQXWRV GH FRQYLYrQFLD FRP RV QDWLYRV H R HVWUDQJHLUR p
DERUGDGRHTXHVWLRQDGR´
F ³2EUDVLOHLURTXHYLDMDDRH[WHULRUHVWiDFRVWXPDGRDRXYLU´
G ³DLGHQWLGDGHGREUDVLOHLURpLQHYLWDYHOPHQWHOLJDGDDHVWDWULQFD´
H ³1RVVDLGHQWLGDGHpLQYHMDGDHGHVHMDGDSRUTXDOTXHUHVWUDQJHLUR´
103. (CESPE / Análise Sistemas / 2015) Adaptada
A vida do direito é a luta: a luta de povos, de governos, de classes, de
indivíduos. Todo o direito do mundo foi assim conquistado. Todo
ordenamento jurídico que se lhe contrapôs teve de ser eliminado e todo
direito, o direito de um povo ou o de um indivíduo, teve de ser conquistado

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 125 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

com luta.
A correção gramatical e o sentido original do texto seriam preservados caso
a oração ³TXHVHOKHFRQWUDS{V´fosse reescrita como que foi contraposto
a ele.
104. (CESPE / TCE-RO / 2013)

Julgue os itens que se seguem, relativos às informações e estruturas


linguísticas do texto acima.
Em ³DVVHPHOKDQGR-VH´o emprego da partícula ³-VH´deve-se ao emprego
pronominal do verbo assemelhar.

LISTA MAIS QUESTÕES COMENTADAS

105. (CONSULPLAN / Aux. Adm. / Pref. Caratinga-MG / 2015)


Em todas as frases a seguir as formas verbais estão flexionadas no mesmo
tempo, EXCETO:
D ³$PHOKRULDGDVD~GHS~EOLFDpXPGHVVHVJUDQGHVGHVDILRV´
E ³,QIHOL]PHQWHR%UDVLODLQGDWHPPXLWRTXHDSUHQGHUHPHOKRUDU´
F ³(QTXDQWRELOK}HVGHUHDLVIRUDPDSOLFDGRVHPDUHQDVHVSRUWLYDV´
G ³1RHQWDQWRRSULPHLURGHVDILRGRSUS esbarra no suporte dos postos e
FHQWURVGHVD~GH´
106. (CONSULPLAN / Ass. Manu. Elétrica / CBTU / 2014)
Sobre a estruturação sintática do período, ³5HJLPHVGHH[FHomRSHUSHWXDP
privilégios, disseminam a injustiça, atrasam o desenvolvimento,
comprometem DVSHUVSHFWLYDVGHHPDQFLSDomR>@´é correto afirmar que
a) é composto por quatro formas verbais, logo, quatro orações.
b) o sujeito dos verbos não foi explicitado em nenhuma das orações.
c) os verbos são intransitivos, por isso não exigem complemento verbal.
d) os verbos não exigem complemento verbal, já que são transitivos diretos.
107. (CONSULPLAN / Ass. Securitário / BANESTES / 2013)
Em todas as frases, transcritas do texto, as formas verbais estão flexionadas
no mesmo tempo, EXCETO:
D ³(UDDOJXpPGLItFLOFRLWDGR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 126 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

E ³«QmRSRVVXHPGLDJQyVWLFR´
F ³«TXHDIHWDPSDUWHGDSRSXODomR´
G ³7HPXPDP~VLFDERQLWDGR6NDQN´
H ³-iTXHILFDPORXFRVDWRUWRHDGLUHLWR´
108. (CONSULPLAN / Téc. Adm. / CRE-RJ / 2011)
Em todas as frases a seguir as formas verbais estão flexionadas o mesmo
tempo, EXCETO:
D ³%DUmRvem DQWHVGHFRQGH´
E ³(Xlevaria RGLFLRQiULRSDUDDLOKDGHVHUWD´
F ³2VVHQKRUHVWRGRVconhecem DSHUJXQWDIDPRVD´
G ³$OLRTXHJRYHUQDé DGLVFLSOLQDGDVOHWUDV´
H ³2GLFLRQiULRresponde a todas as curiosidades,..."
109. (CONSULPLAN / Engenheiro Civil / 2010)
Em todas as frases citadas as formas verbais estão flexionadas no mesmo
tempo, EXCETO, em:
D ³6yHVWDYDPRVWUrVHPFDVD´
E ³1XQFDQDYLGDRXYLUDXPVRPPDLVOLQGRPDLVFDOPDQWH´
F ³6HXILOKRQDVFHX´
G ³$P~VLFDGHTXHYRFrPDLVJRVWDWRFDQGRQRUiGLRGRFDUUR$XPHQWHR
YROXPH´
H ³2DSODXVRGHSRLVTXHYRFrQHUYRVRIDORXHPS~EOLFRSDUDGH]HQDVGH
GHVFRQKHFLGRV´
110. (CONSULPLAN / Ana. Jud. / TRE-RS / 2008)
Em todas as frases abaixo as formas verbais estão flexionadas no mesmo
tempo, EXCETO em:
D ³2QGHHVWDYDDVXDEHOH]D"´
E ³%HOH]DQmRVHL´
F ³2URVWRVHSHUGLDQXPDWULVWH]DLPSHVVRDOHVHPUXJDV´
G ³(XWLYHPHGR´
H ³HODGHVFREULUDXPDWDOKRSDUDDIORUHVWD´
111. (CONSULPLAN / Ana. Jud. / TRE-RS / 2008)
Transpondo para a voz passiva a frase: ³HOD GHVFREULUD XP DWDOKR SDUD D
IORUHVWD´obtém-se a forma verbal:
a) era descoberto
b) fora descoberto
c) foram descobertos
d) estava descoberto

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 127 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

e) tinha descoberto
112. (CONSULPLAN / Fiscal / Cantagalo / 2013)
Quanto à classificação verbal do termo sublinhado, marque a alternativa
correta.
D ³conseguiu FDSLODULGDGHQRVPXQLFtSLRV´± futuro do presente
E ³DDYDOLDomRé XPGRVDOLFHUFHVGR3DLF´± pretérito imperfeito
F ³DIRUPDomRseria PDLVXPWUHLQDPHQWR´± presente do indicativo
G  ³ VH houvesse XP OHJDGR GHL[DGR SHODV H[SHULrQFLDV´ ± pretérito
perfeito
H  ³ H VRPHQWH  conseguiram SURGX]LU XP SHTXHQR WH[WR´ ±
pretérito perfeito
113. (CONSULPLAN / Ass. Adm. / Natividade / 2014)
³8PD WHVWHPXQKD UHDOLVWD PHUDPHQWH LQWHUHVVDGD QDGHVFULomR GRV IDWRV
DSDUHQWHV FRQWDULD TXH XPD GHVWDV WDUGHV XP SREUH Wi[L´ Os tempos
verbais assumem vários valores semânticos. Na passagem anterior, a forma
YHUEDO³FRQWDULD´H[SULPHXPDDomR
a) incerta.
b) passada.
c) rotineira.
d) concluída.
114. (CONSULPLAN / Téc. Jud. / TSE / 2012)
Experimente, porém, sacar a carteira... Assinale a alternativa em que a
alteração da estrutura anterior tenha sido feita observando correta relação
entre pessoas do discurso e formas verbais.
a) Experimentes, porém, sacar tua carteira...
b) Experimenta, porém, sacar tua carteira...
c) Experimentais, porém, sacar vossa carteira...
d) Experimenteis, porém, sacar vossa carteira...
115. (CONSULPLAN / Téc. Seg. Trab. / CODEG / 2013)
Em ³1RVVR OL[R IDULD D IDUWXUD GH XP +DLWL´ o emprego da forma verbal
³IDULD´LQGLFDTXHDDomR
a) é anterior a uma outra ação realizada no passado.
b) é uma possibilidade remota, uma ideia hipotética.
c) teve início no passado e ainda continua no presente.
d) ocorrerá num futuro próximo ao momento presente.
e) ocorreu num passado recente com reflexos no futuro.
116. (CONSULPLAN / Aux. Adm. / Juatuba / 2015)
Assinale a afirmativa cuja forma verbal apresentaǦse DIFERENTE das

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 128 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

demais.
D ³DPDLRULDLQGLFDDSUHFDULHGDGHGDHGXFDomR´
E ³&HUWDYH]SDUWLFLSDYDGHXPDUHXQLmRGHSDLVHSURIHVVRUHV´
F ³0XLWRVUHFRQKHFHPTXHR%UDVLOpXPGRVSDtVHVHPHUJHQWHVTXHHVWmR
PHOKRUDQGR´
G ³1RHQWDQWo, não se pode pensar que a sua deficiência depende somente
GDVDXWRULGDGHV´
117. (CONSULPLAN / Aux. Adm. / Juatuba / 2015)
A forma verbal destacada no trecho ³4XDQGR VH SHUJXQWD j SRSXODomR
brasileira, em uma pesquisa de opinião, qual seria o problema fundamental
GR%UDVLODPDLRULDLQGLFDDSUHFDULHGDGHGDHGXFDomR´enuncia um fato
a) passado, mas posterior a outro já ocorrido.
b) que pode ocorrer posteriormente a um determinado fato passado.
c) que teve início no passado e que pode se prolongar até o momento atual.
d) que deve ocorrer posteriormente a um momento atual, mas já terminado
antes de outro fato futuro.
118. (CONSULPLAN / Agente / Ibiraçu / 2015)
Assinale a afirmativa transcrita do texto que apresenta a forma verbal
DIFERENTE das demais.
D ³$LURQLD pTXHPDOQRVGDPRVFRQWDGLVVR´
E ³2VJUHJRVDQWLJRVWLQKDPXPDQRomRFtFOLFDGRWHPSR´
F  ³2 DSDUDWR GLJLWDO HQWUDYD HP FHQD HP WRGD D VXD PXOWLSOLFLGDGH GH
UHFXUVRV´
G  ³3DUD HOHV R WHPSR VH LQLFLDYD FRP DV SURGLJLRVDV HUDV GH RXUR H GRV
deuses,.´
119. (CONSULPLAN / Agente / Ibiraçu / 2015)
Leia a oração a seguir: ³6HULDVDOXWDUVHWRGRVDSUHQGHVVHPDXVDUEHPRV
FHOXODUHV´
Acerca da oração anterior, analise as afirmativas a seguir.
,$H[SUHVVmR³VHULDVDOXWDU´pDOJRLQFHUWRTXHGHSHQGHGHXPDFRndição
para ser concluído.
,,$RHPSUHJDUDIRUPDYHUEDO³DSUHQGHVVHP´RHQXQFLDGRUGHL[DH[SOtFLWR
que há a possibilidade de uma mudança ocorrer no presente ou no futuro.
,,, $ IRUPD YHUEDO ³DSUHQGHVVHP´ HVWi QR SUHWpULWR LPSHUIHLWR GR
subjuntivo.
Estão corretas as afirmativas
a) I, II e III.
b) I e II, apenas.
c) I e III, apenas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 129 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

d) II e III, apenas.
120. (CONSULPLAN / Agente / Ibiraçu / 2015)

Os verbos são utilizados conforme a intenção discursiva do enunciador,


podendo indicar atitudes de certeza, de dúvida, de ordem etc.
Assinale a alternativa que indica a ação enunciativa expressa pela perífrase
YHUEDO³(VWRXWHQWDQGR´
a) Ação verbal finalizada no presente do indicativo.
b) Ação verbal em processo marcada pelo gerúndio.
c) Ação verbal a ser realizada no futuro do subjuntivo.
d) Ação verbal concluída no pretérito perfeito do indicativo.
121. (CONSULPLAN / Ana. Sist. / Natividade / 2014)
O trecho ³(OHVDEHTXHYDLPRUUHUHTXDVHVHPSUHpDEDWLGRSRUSROLFLDLV´
está reescrito corretamente na voz ativa, de acordo com a norma padrão,
em:
a) Ele sabe que vai morrer e, quase sempre, policiais abatem.
b) Ele sabe que vai morrer e, quase sempre, policiais o abatem.
c) Ele sabe que vai morrer e, quase sempre, policiais abatemǦo.
d) Ele sabe que vai morrer e, quase sempre, policiais abatemǦno.
122. (CONSULPLAN / Ass. Social / Juatuba / 2015)
Um amigo meu estava ofendido porque um jornal o chamou de boaǦvida.
Vejam que país, que tempo, que situação! A vida deveria ser boa para toda
gente, o que é insultuoso é que o seja apenas para alguns.
A frase que admite transposição para a voz passiva é
D ³«UHDOPHQWHHOHJRVWRXGRTXDGUR«´
E ³(OHYLYHXDYLGDLQWHLUDGHVHXWUDEDOKR´
F ³8PDPLJRPHXHVWDYDRIHQGLGR«´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 130 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

G ³XPMRUQDORFKDPRXGHERDǦYLGD´
123. (CONSULPLAN / Analista / COFEN / 2011)
Em todas as frases a seguir, transcritas do texto, as formas verbais estão
flexionadas no mesmo tempo, EXCETO:
D ³1mRWHQKRRSLQLmRVDFUDPHQWDGDVREUHRDVVXQWR´
E  ³2XWUR GLD DVVLVWL D XPD UHSRUWDJHP HP TXH VH IDODYD GD invenção de
XPDWRXFD´
F ³2SHQVDPHQWRpR~QLFRUHGXWRGHOLEHUGDGH´
G ³1LQJXpPID]PDLVQDGDHVFRQGLGR´
H ³$OJXpPVDEHH[DWDPHQWHRQGHYRFrHVWi´
124. (CONSULPLAN / Ass. Adm. / Natividade / 2014)
Em todas as frases a seguir, transcritas do texto, as formas verbais estão
flexionadas no mesmo tempo, EXCETO:
D ³/HPEUHLǦme de tudo isso...´
E ³SRLVDSDQFDGDTXHDDWLQJLXDIHWRXǦa...´
F ³«HVVDiUYRUHGHYHUiPRUUHUGHQWURHPEUHYH«´
G ³HRFDUURHPPRYLPHQWRGLULJLXǦse, desgovernado,...´
125. (CONSULPLAN / Aux. Lab. / MAPA / 2014)

No 8º objetivo, ³7RGRPXQGRWUDEDOKDQGRSHORGHVHQYROYLPHQWR´ a forma


verbal apresentada indica ação
a) futura.
b) imposta.
c) contínua.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 131 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

d) finalizada.
126. (CONSULPLAN / Ana. Sistemas / INB / 2006)
A forma de voz ativa da frase ³$VLQG~VWULDVVmRPRYLGDVSULQFLSDOPHQWHSHOD
HOHWULFLGDGH´é:
a) A eletricidade tem movido, principalmente, as indústrias.
b) Principalmente, a eletricidade vem movendo as indústrias.
c) A eletricidade move, principalmente, as indústrias.
d) Às indústrias, principalmente, movem a eletricidade.
e) A eletricidade, principalmente, ainda move as indústrias.
127. (CONSULPLAN / Ana. Sistemas / INB / 2006)
Observe: ³RFRQVXPRHQHUJpWLFRWHYHXPFUHVFLPHQWRPHQRVLQWHQVR´
Nas frases abaixo, as formas verbais destacadas estão flexionadas em
tempos verbais diferentes da frase anterior, EXCETO:
a) O governo interrompera a privatização das indústrias.
b) O setor de transporte gerou mais gastos de energia.
c) O objetivo será aumentar a oferta interna de petróleo.
d) As características industriais do Brasil ajudam no desenvolvimento do
país.
e) O Brasil urbano e industrial tem características marcantes.
128. (CONSULPLAN / Ana. Jud. / TRE-SC / 2008)
Assinale a alternativa em que há ERRO de flexão verbal:
a) Todos diziam que ele era louco por música.
b) Não queiram destruir as gravações das óperas.
c) Se as gravadoras proporem um bom negócio, ele concordará.
d) Peça a ele que leve seu brinquedinho de volta para casa.
e) Quando o vir, fale com ele.
129. (CONSULPLAN / Aux. FOP. / Uberlândia-MG / 2012)
As frases transcritas do texto apresentam o mesmo tempo verbal, EXCETO:
D ³RVQ~PHURVRILFLDLVFRPSURYDPTXHD/HL6HFDajuda DUHGX]LU´
E ³morria XPDSHVVRDSDUDFDGDYHtFXORV´
F ³... é bom advertir que eles podem SLRUDU´
G ³QLQJXpPé REULJDGRDSURGX]LUSURYDVFRQWUDVLPHVPR´
H  ³ XP OHYDQWDPHQWR GR 'HSDUWDPHQWR 1DFLRQDO GH 7UkQVLWR mostra
TXH´
130. (CONSULPLAN / Ag. PM / IBGE / 2011)
³1DiUHDUXUDODVPpGLDVGHFRQVXPRLQGLYLGXDOGLiULRforam maiores para
arroz, feijão, peixe fresco, batata-doce, farinha de mandioca e manga, entre

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 132 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

outros´$VVLQDOHDIUDVHHPTXHRYHUERHVWiIOH[LRQDGRQRVPHVPRVWHPSR
e modo do verbo em destaque.
a) Jamais esteve naquele lugar.
b) Não participarei deste evento.
c) Compareça à secretaria agora.
d) Sempre tomava aquelas atitudes.
e) Não acredito nesta possibilidade.
131. (CONSULPLAN / Aux. Adm. / Monte Belo / 2011)
Assinale a afirmativa que apresenta verbo no presente do indicativo.
D ³&HUWDPHQWHserá XPDPRUGHPRUDGR´
E ³Ficou-me a certeza de que o bem supremo não é a vida mas uma vida
GLJQD´
F ³(OHQRVfaz PHOKRUHVVHWLYHUVLGRERP´
G ³Foi FRORFDGRHPQyVFRPRXPDURPDQXPIUDVFR´
H ³1mRVHLse fui FDSD]GHOHRXVHRPHUHFL´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 133 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 03 ± Felipe Luccas Rosas

Gabaritos

1. CORRETA 34. LETRA E 67. CORRETA 100. LETRA B


2. LETRA B 35. LETRA A 68. CORRETA 101. CORRETA
3. LETRA D 36. INCORRETA 69. LETRA A 102. LETRA C
4. CORRETA 37. LETRA B 70. LETRA E 103. INCORRETA
5. LETRA C 38. LETRA A 71. CORRETA 104. CORRETA
6. CORRETA 39. CORRETA 72. LETRA A 105. LETRA C
7. CORRETA 40. LETRA D 73. LETRA C 106. LETRA A
8. LETRA D 41. LETRA C 74. LETRA E 107. LETRA A
9. LETRA B 42. LETRA C 75. CORRETA 108. LETRA B
10. CORRETA 43. INCORRETA 76. INCORRETA 109. LETRA D
11. LETRA E 44. CORRETA 77. LETRA A 110. LETRA B
12. LETRA C 45. LETRA D 78. LETRA D 111. LETRA B
13. LETRA B 46. INCORRETA 79. LETRA B 112. LETRA E
14. INCORRETA 47. CORRETA 80. LETRA A 113. LETRA A
15. INCORRETA 48. LETRA D 81. LETRA D 114. LETRA B
16. INCORRETA 49. CORRETA 82. LETRA A 115. LETRA B
17. LETRA B 50. LETRA A 83. LETRA B 116. LETRA B
18. LETRA A 51. INCORRETA 84. LETRA A 117. LETRA B
19. CORRETA 52. INCORRETA 85. LETRA E 118. LETRA A
20. INCORRETA 53. CORRETA 86. LETRA E 119. LETRA C
21. CORRETA 54. LETRA D 87. CORRETA 120. LETRA B
22. CORRETA 55. INCORRETA 88. CORRETA 121. LETRA D
23. CORRETA 56. LETRA A 89. CORRETA 122. LETRA D
24. LETRA A 57. LETRA C 90. CORRETA 123. LETRA B
25. INCORRETA 58. LETRA C 91. CORRETA 124. LETRA C
26. LETRA C 59. LETRA B 92. INCORRETA 125. LETRA C
27. CORRETA 60. LETRA D 93. INCORRETA 126. LETRA C
28. LETRA B 61. CORRETA 94. INCORRETA 127. LETRA B
29. LETRA D 62. CORRETA 95. LETRA B 128. LETRA C
30. INCORRETA 63. LETRA C 96. INCORRETA 129. LETRA B
31. LETRA E 64. LETRA D 97. CORRETA 130. LETRA A
32. LETRA C 65. LETRA D 98. LETRA A 131. LETRA C
33. LETRA D 66. INCORRETA 99. INCORRETA

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 134 de 134


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

A genética, que já vinha sendo usada contra o câncer em diagnóstico e em avaliações


de risco, conseguiu, pela primeira vez, UHDOL]DURVRQKRGDVGURJDVµLQWHOLJHQWHV¶:
impedir a formação de tumores
Oração subordinada Adjetiva Explicativa,
LQWURGX]LGDSHORSURQRPHUHODWLYR³TXH´

2UDomRVXERUGLQDGDDSRVLWLYD DSRVWRH[SOLFDWLYRGH³VRQKR´ 
introduzida por sinal de dois pontos (:)
3RUQmRWHUFRQHFWRUpFKDPDGD³DVVLQGpWLFD´
Está reduzida de infinitivo.

Lista das questões comentadas

1. (FGV / Auditor Fiscal de Cuiabá / 2016)


Assinale a opção que indica a frase que se encontra na ordem direta.
D  ³'DV FRLVDV PDLV PDUFDQWHV GD DGROHVFrQFLD minha memória traz os
WHPSRVGHHVWXGRHG~YLGDVVREUHRIXWXUR´
E ³'HIRUPDFRQWUiULDjVSULQFLSDLVFUtWLFDVTXHVHRXYHKRMHPHXVDQRVGH
Ensino Médio foram, sim, muito significativos para uma formação dita
FLGDGmHQmRVyYROWDGDDRVYHVWLEXODUHV´
F  ³+RMH WUDEDOKDQGR FRP HGXFDomR WHQKR SOHQD FRQVFLrQFLD GH TXH XP
HQVLQRLQRYDGRUSRGHVXUJLUDSDUWLUGHSUiWLFDVFRQVLGHUDGDVWUDGLFLRQDLV´
G  ³XPD URGD GH FRQYHUVD QD HVFROD SRGH VHU WmR RX PDLV UHYROXFLRQiULD
TXDQWRTXDOTXHUDSOLFDWLYRHGXFDFLRQDO´.
H ³eGLVVRTXHWUDWDDHGXFDomR´
2. (CONSULPLAN / Téc. Enf. Trab. / CBTU / 2014)
Nessa altura, há confusão na av. N. S. de Copacabana, pois ninguém sabe o
TXHVLJQLILFD³DGHULUDRVUHEHOGHV´$FRQIXVmRpUiSLGD1mRKiUHEHOGHVH
todos, rebeldes ou não, aderem, que a natural tendência da humana espécie
é aderir. Erguem o general em triunfo. Vejo o bravo general passar em glória
sobre minha cabeça.
No trecho ³(UJXHPRJHQHUDOHPWULXQIR´o sujeito da ação expressa pelo
YHUER³HUJXHU´
a) é indeterminado.
b) está implícito na oração.
c) está explícito na oração.
d) deve ser classificado como inexistente.
3. (CONSULPLAN / Ass. Manutenção / CBTU / 2014)
No trecho ³9LYHX-se nesse tempo sob a imposição de atos institucionais,
>@´percebe-se que o sujeito do verbo ³YLYHU´está

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 108 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

a) oculto.
b) explícito.
c) implícito.
d) indeterminado.
4. (CESPE/SEDF/2017)
São duas maneiras de chegar ao mesmo lugar. São duas gramáticas
distintas, uma em que a pluralidade é marcada em todos os termos da
oração, outra em que o plural aparece marcado apenas no artigo.
Seriam mantidos a correção gramatical e o sentido original do texto se o
WUHFKR ³6mR GXDV JUDPiWLFDV GLVWLQWDV´ fosse reescrito da seguinte forma:
Tratam-se de duas gramáticas diferentes.
5. (IBFC / EMBASA / 2017)
O crescimento assustador de casos de febre amarela trata-se de um sério
problema e fzeram com que muitas pessoas procurassem os postos de
saúde.
Julgue o item.
2 YHUER ³WUDWD-VH´ HVWi HPSUHJDGR LQFRUUHWDPHQWH SRLV R XVR GR ³VH´ p
incompatível com a presença do sujeito simples.
6. (CESPE/ SEDF/2017)
Quando indaguei a alguns escritores de sucesso que manuais de estilo
tinham consultado durante seu aprendizado, a resposta mais comum foi
³QHQKXP´'LVVHUDPTXHHVFUHYHUSDUDHOHVDFRQWHFHXQDWXUDOPHQWH
No que se refere ao texto precedente, julgue o item a seguir.
2 VXMHLWR GD RUDomR LQLFLDGD SHOD IRUPD YHUEDO ³'LVVHUDP´ O  p
indeterminado.
7. (CESPE/ SEDF/2017)
Um estudo da FGV aponta que 80% dos professores de educação infantil
têm nível superior completo. Os dados correspondem ao ano de 2014 e
mostram que a formação dos professores das instituições públicas continua
melhor.
Acerca dos sentidos e de aspectos linguísticos do texto anteriormente
apresentado, julgue o item que se segue:
Na linha 6, o sujeito da IRUPDYHUEDO³PRVWUDP´TXHHVWiHOtSWLFRWHPFRPR
UHIHUHQWH³2VGDGRV´
8. (CONSULPLAN / CFESS / ANALISTA / 2017)
$VVLQDOHDDOWHUDomRSDUDDIUDVH³Existe aí um motivo adicional, além do
desrespeito ao local coletivo.´ ž†  FXMD correção linguística pode ser
observada:
A) Existe aí motivos adicionais, além do desrespeito ao local coletivo.
B) Haveriam aí motivos adicionais, além do desrespeito ao local coletivo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 109 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

C) Deve haver aí motivos adicionais, além do desrespeito ao local coletivo.


D) Devem haver aí motivos adicionais, além do desrespeito ao local coletivo.
9. (Prefeitura Martinópolis / Professor/2017)
Em: ³$LQGDpFHGR´WHPRV
a) Sujeito simples.
b) Sujeito composto.
c) Sujeito desinencial.
d) Sujeito indeterminado.
e) Oração sem sujeito
10. (CESPE/ TRE-PE/2016) - Adaptada
A importância atribuída às bases, no caso do Poder Executivo estadual,
decorre do fato de que a sua manutenção significa maiores possibilidades de
conquistar uma reeleição.
O termo ³$LPSRUWkQFLDDWUibuída às bases" funciona como sujeito da forma
YHUEDO³GHFRUUH
11. (ESAF / Ministério do Turismo / Contador / 2014)
O torcedor sabe quais seleções vão se enfrentar, e onde serão as partidas
da primeira fase da Copa no Brasil.
Em ³YmRVHHQIUHQWDU´ o ³VH´indica que o sujeito é indeterminado.
12. (VUNESP/ TJ-SP / Assistente Social Judiciário/ 2017)
A decisão de Nicolás Maduro de elevar a meio milhão os milicianos
armados com fuzil na Venezuela é a pior de suas ideias ruins.
Sugere que Maduro prevê a decisão da discórdia venezuelana por meio
das armas. Caso não o seja, nem por isso se extinguirá o mal do
armamentismo: vai prolongar-se na criminalidade típica de uma população
armada e, em grande parte, indesarmável. Ainda por motivos mais
econômicos, os venezuelanos fogem em massa. Seu número cresce. O Brasil
está atrasado, como se indiferente, nas providências para essa emergência
social.
Assinale a alternativa em que o verbo destacado tem sujeito elíptico.
a) A decisão de Nicolás Maduro [...] é a pior de suas ideias ruins.
b) ... os venezuelanos fogem em massa
c) ... nem por isso se extinguirá o mal do armamentismo...
d) Seu número cresce.
e) Sugere que Maduro prevê a decisão da discórdia venezuelana por meio
das armas
13. (CESPE / TRT-PI / 2016) - Adaptada
Sendo um modelo global, a nova racionalidade científica é também um
modelo totalitário, na medida em que nega o caráter racional a todas as

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 110 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

formas de conhecimento que não se pautarem pelos seus princípios


epistemológicos e pelas suas regras metodológicas.
O sujeito da forma verbal ³SDXWDUHP´está elíptico e seu referente é ³WRGDV
DVIRUPDVGHFRQKHFLPHQWR´
14. (CESPE / TRT-MT / 2016)
Nesse cenário, portanto, surge a legítima expectativa de que o eleitor
cidadão efetivamente adote uma postura corretiva em relação às
irregularidades verificadas no curso do pleito...
... não seria razoável aguardar até o dia da votação para tomar alguma
providência contra aqueles que macularam o pleito.
O termo ³DOHJtWLPDH[SHFWDWLYD´e a oração ³DJXDUGDUDWpRGLDGDYRWDomR´
desempenham a mesma função sintática.
15. (CESPE / TRT-MT / 2016)
³1mRKiG~YLGDGHTXHRYRWRpDPHOKRUDUPDGHTXHGLVS}HRHOHLWRU´
2WHUPR³G~YLGD´H[HUFHDIXnção de sujeito na oração em que ocorre.
16. (FUNDATEC / IGP-RS / Perito Criminal / 2017)
Agora, pensa-se que essa mesma proporção seja inferior a 10%, e a
TXHGDFRQWLQXD³(VVDpDPHOKRUQRWtFLDGRPXQGRDWXDO´GLVVH-LP<RQJ
Kim, presidente do Banco Mundial.
Julgue o item a seguir.
A frase sublinhada representa o sujeito da forma verbal pensa, a qual se
encontra na voz passiva sintética.
17. (CESPE / TRT-MT/2016)
Sabe-se que esse processo de accountability vertical, o controle dos eleitores
sobre os eleitos, depende de uma série de fatores...
O sujeito da oração iniciada por ³6DEH-se´pLQGHWHUPLQDGR.
18. (CESPE / TRT-MT / 2016)
...verifica-se a existência de matas e de estradas rurais em condições ruins
ou onde é necessário o uso de barcos para chegar à seção eleitoral. É
importante lembrar, ainda, que, quando não havia a urna eletrônica ²
facilitadora do voto ², o analfabetismo e os problemas de saúde dos idosos
poderiam comprometer a obtenção de um voto corretamente lançado
(escrito a caneta) na cédula de papel.
Quando, na CF, estabeleceu-se o voto obrigatório para maiores de dezoito
anos e facultativo para analfabetos...
2VWHUPRV³RXVRGHEDUFRV´H³RYRWRREULJDWyULR´GHVHPSHQKDPDPHVPD
função sintática nas orações em que ocorrem.
19. (CONSULPLAN / Administrador / MAPA / 2014)
Considerando as funções estabelecidas sintaticamente pelas palavras em
determinada oração, identifique o termo ou expressão destacado(a) cuja

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 111 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

função sintática DIFERE dos demais.


D ³>@RXYLQGRDVGHOHVHFRQstruindo a verdade >@´
E ³>@VRFLHGDGHHPTXHH[LVWHPcastas sociais inamovíveis´
F ³3RULVVRo hábito filosófico de raciocinar QDVFHQD*UpFLD>@´
G ³µConversar¶QmRpRPHVPRTXHRXYLUVHUP}HVRXDWHQGHUDYR]HVGH
FRPDQGR´
20. (CONSULPLAN / Téc. Info. / Pref. Cascavel-PR / 2016)
Assinale a alternativa em que o termo, ou trecho sublinhado, apresenta uma
função sintática DIFERENTE das demais.
D ³HODVWrPvalores fortes´
E ³HTXHJDUDQWDPos seus direitos´
F ³$HVFRODSHUGHXsua importância QDVRFLDOL]DomRGHFULDQoDVHMRYHQV"´
G ³(PHVPRDVVLPWrPVLGRas famílias a instituição protetora dos mais
QRYRV´
H  ³ DV LGHRORJLDV VRFLRFXOWXUDLV GD MXYHQWXGH GR VXFHVVR H GD
instantaneidade ganharam grande relevância´
21. (ESAF / Analista de Planejamento e Orçamento / 2015)
A escala dos ataques a cristãos no Oriente Médio, na África Subsaariana, na
Ásia e na América Latina alarmou as organizações que monitoram a
perseguição religiosa. A maioria relata uma deterioração significativa nos
últimos anos.
No que diz respeito às estruturas linguísticas do texto, julgue o item:
1DH[SUHVVmR³XPDGHWHULRUDomRVLJQLILFDWLYD³GHWHULRUDomRpRQ~FOHRGR
objeto direto.
22. (CESPE / Instituto Rio Branco / 2012)
No período ³Que Demócrito não risse, eu o provo´ o verbo provar
complementa-se com uma estrutura em forma de objeto direto pleonástico,
com uma oração servindo de referente para um pronome.
23. (FCC / TRF 3ª REGIÃO / Analista / 2016)
As orações "de atacar os outros" (Não tive tempo de me defender ou de
atacar os outros) e "de defender a tradição" (Não se trata de defender
a tradição, família ou propriedade de ninguém) servem de
complemento ao sentido do verbo a que se referem.
24. (CESPE/ TCE-PA/2016)
Julgue correto ou incorreto o item que se segue, referente aos aspectos
linguísticos do texto.
Sem prejuízo da correção gramatical e dos sentidos do texto, no trecho ³Vy
os tolos temem a ORELVRPHP H IHLWLFHLUDV´  D SUHSRVLomR ³a´ SRGHULD VHU
suprimida.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 112 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

25. (CESPE / TRE-GO/2015)


...desde que atendessem aos requisitos de notável saber jurídico e
idoneidade moral...
Com referência às estruturas linguísticas do texto, julgue o item a seguir.
Se a preposição ³a´ SUHVHQWHQDFRQWUDomR³aRV´, fosse suprimida, a função
sintática da expressão ³UHTXLVitos de notável saber jurídico e idoneidade
PRUDO´ seria alterada, mas a correção gramatical do texto seria mantida.
26. (CESPE /TRT-MT / 2016)
Ademais, em segundo plano, tal atribuição fiscalizatória advém dos preceitos
morais que impõem a necessidade de contenção dos vícios eleitorais...
Não há dúvida de que o voto é a melhor arma de que dispõe o eleitor...
Os verbos impor e dispor, empregados, respectivamente, nas linhas,
recebem a mesma classificação no que se refere à transitividade.
27. (Instituto Excelência / Procurador Jurídico/2017)
Considere o seguinte período e julgue o item em certo ou errado:
³'L]TXHVHXVILOKRVpequenos se assustaram, mas depois foram brincar nos
galhos tombados´
1HVVDFRQVWUXomRRVDGMHWLYRV³SHTXHQRV´H³WRPEDGRV´H[HUcem a função
de Adjunto adnominal.
28. (FGV /Auditor Fiscal de Cuiabá / 2016)
Assinale a opção que indica a frase em que a preposição de tem sua presença
na frase por uma exigência de um termo anterior.
D ³PLQKDPHPyULDWUD]RVWHPSRVde HVWXGR´
E ³PHXVanos de (QVLQR0pGLRIRUDPVLPPXLWRVLJQLILFDWLYRV´
F ³WHQKRSOHQDFRQVFLrQFLDde TXHXPHQVLQRLQRYDGRUSRGHVXUJLU´
G ³XPDURGDde FRQYHUVDQDHVFROD´
H ³QRVSHUPLWHHQWUDUHPFRQWDWRde IRUPDVLVWHPiWLFD´
29. (FGV /DPE-MT/Assistente Administrativo/2015)
Horóscopo do signo de Virgem, do dia 01 de fevereiro de 2015.
³3URFXUHDJUHJDUDOLDGRVFRPLQWHUHVVHVVHPHOKDQWHVaos seus, invista em
parcerias corretas. Mercúrio segue retrógrado em Aquário: você ganha
maisse unir forças e trabalhar em equipe. Continue com atenção redobrada
ao se comunicar. Bom período para ouvir opiniões diferentes, repensar
assuntos e se abrir para novos pontos de vista. Bom, também, para revisar
HTXLSDPHQWRVHOHWU{QLFRV´
Assinale a opção que indica o termo sublinhado que exerce a função de
complemento e não de adjunto.
D ³DRVVHXV´
E ³HP$TXiULR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 113 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

F ³PDLV´
G ³HPHTXLSH´
H ³GLIHUHQWHV´
30. (FCC /TÉC. CNMP / 2015)
...Na América Latina, o regime democrático sabidamente convive com níveis
infamantes de desigualdade social...
O elemento sublinhado acima possui, no contexto, a mesma função sintática
que o sublinhado em:
a) Mesmo democracias que no início pareciam débeis...
b) ... sendo muito mais causa que consequência da redução das
desigualdades sociais.
c) ... certa tensão entre os conceitos institucional e substantivo da
democracia existe por toda parte...
d) ... foram se robustecendo à medida que ascendiam a níveis mais altos de
renda per capita...
e) ... que a configuração de fatores relevantes para a estabilidade
permanecerá a mesma...
31. (FADESP / COSANPA / ADM / 2017)
1RHQXQFLDGR³HHXYROWHLmaravilhado j5HGDomR´RWHUPRVXEOLQKDGRWHP
a função sintática de
a) aposto.
b) adjunto adnominal.
c) predicativo do sujeito.
d) complemento nominal.
32. (CESPE /TRE-PI / 2016) - Adaptada
A identidade cultural é, ao mesmo tempo, estável e movediça.
Julgue o item a seguir:
1RSULPHLURSHUtRGRGRWH[WRRVWHUPRV³FXOWXUDO´³HVWiYHO´H³PRYHGLoD´
exercem a mesma função sintática, uma vez que atribuem característica ao
WHUPR³LGHQWLGDGH´
33. (ESAF / Analista de Planejamento e Orçamento/2015)
A distopia é uma distorção ou uma mutação utopia, um sonho que se
transforma em pesadelo.
$H[SUHVVmR³XPDGLVWRUomR´IXQFLRQDVLQWDWLFDPHQWH como objeto direto
GH³$GLVWRSLD´
34. (CCV / UFC / Aux. Administração /2016)
A função sintática do termo destacado na frase: O Ubuntu é a melhor
versão para iniciantes é:
a) objeto direto.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 114 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

b) adjunto adverbial.
c) adjunto adnominal.
d) predicativo do objeto.
e) predicativo do sujeito.
35. (CESPE / Instituto Rio Branco / 2016)
1R WUHFKR ³É certo que a evidência da beleza não pode ser em arte um
FULWpULR D[LRPiWLFR´ WDQWR R WHUPR ³FHUWR´ TXDQWR R WHUPR ³D[LRPiWLFR´
caracterizam, respectivamente, referentes que constituem sujeitos
oracionais.
36. (Quadrix / CRB 6ª Região/2017)
Em "Tornar Visíveis os Invisíveis", pode-se afirmar que o termo "visível"
sintaticamente exerce a função de:
a) sujeito simples.
b) predicativo do objeto.
c) objeto direto.
d) predicativo do sujeito.
e) adjunto adnominal.
37. (CESPE/ TCE-PA/2016)
De que adiantaria tornar a lei mais rigorosa...
Com relação aos aspectos linguísticos do texto, julgue o seguinte item.
2WHUPR³PDLVULJRURVD´IXQFLRQDFRPRXPSUHGLFDWLYRGRWHUPR³DOHL´
38. (CONSULPLAN / Téc. Info. / Pref. Cascavel-PR / 2016)
³1mROKHSDUHFHcaro leitor, que tais expressões apontam na direção de que
D IDPtOLD GHFLGLX HQWRUQDU R FDOGR GD VRFLHGDGH"´ O trecho sublinhado
apresenta-se entre vírgulas porque trata-se de
a) um vocativo.
b) uma enumeração.
c) uma expressão explicativa.
d) um adjunto adverbial deslocado.
e) elementos coordenados assindéticos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 115 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

39. (CESPE/ ANTAQ / 2014) - Adaptada

Considerando as ideias e estruturas linguísticas do texto acima, julgue o


item.
1R SULPHLUR TXDGULQKR R HPSUHJR GH YtUJXOD DSyV R YRFiEXOR ³*HQWH´ p
obrigatório, visto que separa expressão de chamamento.
40. (FCC / TRT 24ª Região / 2017)
O artesanato, uma das mais ricas expressões culturais de um povo, no
Mato Grosso do Sul, evidencia crenças, hábitos, tradições e demais
referências culturais do Estado. (2o parágrafo)
No contexto, o trecho destacado veicula a ideia de
a) explicação.
b) proporção.
c) concessão.
d) finalidade.
e) conclusão.
41. (CESPE / Anvisa / 2016)
Caso se alterasse a ordem dos termos em ³RLFRQRFODVWD2VFDU:LOGH´SDUD
³o Oscar Wilde iconoclasta´, haveria mudança do significado original do
texto, mas as funções sintáticas de ³2VFDU :LOGH´ e de ³LFRQRFODVWD´
permaneceriam inalteradas.
42. (ESAF / Despachante Aduaneiro / 2016)
...DE REPENTE, Honório olhou para o chão e viu uma carteira. Abaixar-se,
apanhá-la e guardá-la foi obra de alguns instantes. Ninguém o viu, salvo um
homem que estava à porta de uma loja, e que, sem o conhecer, lhe disse
rindo:
² Olhe, se não dá por ela; perdia-a de vez.
² É verdade, concordou Honório envergonhado.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 116 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

Para avaliar a oportunidade desta carteira, é preciso saber que Honório tem
de pagar amanhã uma dívida, quatrocentos e tantos mil-réis, e a carteira
trazia o bojo recheado.
$ SDODYUD ³HQYHUJRQKDGR´ H D H[SUHVVmR ³TXDWURFHQWRV H WDQWRV PLO-UpLV´
exercem, respectivamente, as funções de
a) adjunto adnominal e aposto.
b) predicativo de objeto e vocativo.
c) predicativo de sujeito e aposto.
d) adjunto adnominal e objeto direto.
e) adjunto adnominal e adjunto adverbial
43. (CONSULPLAN / Arquiteto / Pref. Cascavel-PR / 2016)
Considerando-se as relações sintáticas estabelecidas nas orações que
compõem o período ³$ROLGDUFRPFOLHQWHVFXMDVYLGDVIRUDPWHUULYHOPHQWH
desvirtuadas, ao trabalhar com homens e mulheres nas salas de fundo dos
KRVSLWDLV GR (VWDGR VHPSUH SHQVR QHVVHV EURWRV GH EDWDWDV´ é correto
afirmar que
D  R WHUPR ³YLGDV´ FODVVLILFD-se como sujeito de uma das orações que
compõem o período.
E ³GHVYLUWXDGDV´DSUHVHQWD-se como predicativo do objeto já que indica uma
característica específica.
F  D H[SUHVVmR ³VDOD GH IXQGR GRV KRVSLWDLV GR (VWDGR´ LQGLFD XP
complemento diretamente ligado ao verbo.
d) é possível identificar a presença de sujeito indeterminado considerando-
se uma das formas verbais apresentadas.
e) o período é formado por orações constituídas de sujeito composto, sujeito
simples e sujeito indeterminado, respectivamente.
44. (CONSULPLAN / Eng. Seg. Trab. / Pref. Patos-MG /2015)
Dentre os termos destacados a seguir, assinale o que possui classificação
diferente dos demais em relação à função sintática exercida.
D ³'RJUXSRque arriscou cruzar o Atlântico [...]"
E ³>@a maioria desembarcou no Aeroporto Internacional de Guarulhos,
[...]"
F ³No Brasil, o primeiro destino foi bater à porta da mesquita de Guarulhos,
[...]"
G ³>@o Alto Comissário das Nações Unidas para Refugiados, o português
Antônio Guterres, classificou a guerra civil da Síria [...]"
45. (CESPE/ TRE-PI / 2016) - Adaptada
Esse compartilhamento de referências pode advir tanto da interação social
entre os indivíduos quanto do pertencimento a determinado contexto
geográfico
O trecho ³WDQWR GD LQWHUDomR VRFLDO HQWUH RV LQGLYtGXRV TXDQWR GR

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 117 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

pertencimento a determinado contexto geográfico" exerce função de


adjunto adverbial na oração em que ocorre.
46. (ESAF / Analista de Planejamento e Orçamento / 2015)
A escala dos ataques a cristãos no Oriente Médio, na África Subsaariana, na
Ásia e na América Latina alarmou as organizações que monitoram a
perseguição religiosa. A maioria relata uma deterioração significativa nos
últimos anos.
$H[SUHVVmR³QRV~OWLPRVDQRVWHPDIXQomRVLQWiWLFDGHDGMunto adverbial
de lugar.
47. (CESPE /TRT-MT /2016)
³$SDUGLVVRTXDQGRVHSHQVDQRSURFHVVRHOHLWRUDO² embora logo venha à
cabeça a figura dos candidatos, partidos e coligações como sujeitos de uma
trama que é ordinariamente vigiada por eles próprios e por órgãos
estatais´
³$GHPDLV HP VHJXQGR SODQR WDO DWULEXLomR  ILVFDOL]DWyULD DGYpP dos
preceitos morais que impõem a necessidade de contenção dos vícios
HOHLWRUDLV´
Os termos ³SRUyUJmRVHVWDWDLV´ e ³GRVSUHFHLWRVPRUDLV´exercem a função
de complemento verbal nos períodos em que ocorrem
48. (CESPE/ DIPLOMATA / 2013)
³4XDQGRIDODPRVIDODPRVSDUDVHURXYLGRVLPHGLDWDPHQWHFRPTXHPHVWi
ali ao pé de nós, e de modo a que sejamos facilmente entendidos dele, que
sabemos quem é, ou calculamos que sabemos, e que pode ser toda a
genteGHYHQGRQyVSRLVIDODUFRPRVHIRVVHTXDOTXHU´
1R WUHFKR ³a que sejamos facilmente entendidos dele´ R HOHPHQWR
³dele´H[SUHVVDRDJHQWHGDDomRH[SUHVVDSHODIRUPDYHUEDO³entendidos´
e equivale a por ele.
49. (CONSULPLAN / Dentista / Pref. Cantagalo-RJ / 2013)
Assinale a alternativa que é frase, mas não é oração.
D ³(VWmRDPDUJRV´
E ³6HULDXPDVXDYHVROXomR´
F ³&RPXPDLQIHOLFLGDGHFUXDQDDOPD´
G ³2VYLQKRVHQYHOKHFHPPHOKRUDLQGD´
H ³2SUREOHPDGDYHOKLFHWDPEpPVHGiFRPFHUWRVLQVWUXPHQWRV´
50. (FGV / Especialista Legislativo / ALERJ / 2017)
Observe o seguinte período, retirado do livro O Crime do Padre Amaro, do
escritor português Eça de Queiroz:
³$ WDUGH FDtD TXDQGR G 0DULD H $PpOLD YROWDUDP SDUD D FLGDGH $PpOLD
adiante, calada, chibatava a sua burrinha, enquanto d. Maria vinha palrando
FRPRPRoRGDTXLQWDTXHVHJXUDYDDDUUHDWD´
Sobre a estrutura sintática desse segmento, a única afirmação correta é:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 118 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

a) o primeiro período é composto por uma só oração;


b) o segundo período é constituído por coordenação e subordinação;
c) o segundo período é formado por quatro orações;
d) no segundo período, o sujeito é o mesmo em todas as orações;
e) nos dois períodos há orações subordinadas de valor temporal.
51. (FAUEL / ADVOGADO/2017)
³)LFDUDPSDVPDGRVDRHQWHQGHUHPDJUDYLGDGHGDVLWXDomR´
Analisando o período acima, pode-se concluir que:
D 1DRUDomR³)LFDUDPSDVPDGRV´KiSUHGLFDGRQRPLQDO SRLV DSDODYUD
³ILFDUDP´ QHVWH FDVR p DSHQDV XP YHUER GH OLJDomR HQWUH R 6XMHLWo
'HVLQHQFLDO³HOHV´HR3UHGLFDWLYRGR6XMHLWR³SDVPDGRV´
b) Trata-se de um Período Simples, pois contém dois verbos.
F 1DRUDomR³)LFDUDPSDVPDGRV´KiSUHGLFDGRYHUER-nominal, visto que
DSDODYUD³ILFRX´QHVWHFDVRpXPDGMHWLYRSRLVGHVFUHYHDVLWXDomRYLYLGD
pelo Sujeito.
G  2 YHUER ³ILFDUDP´ UHIHUH-se a uma ação praticada pelo Sujeito no
Pretérito, o que classifica o Predicado como Verbal.
52. (IBFC / Embasa / 2017)
Considere o período e as afirmativas a seguir e assinale a alternativa correta.
³/RXYH-se a insistência dos comerciantes, que jamais morrerão de fome,
SHGLQGRSURYLGrQFLDVjVDXWRULGDGHV´
I. Trata-se de um período composto por coordenação.
,,2VXMHLWRGH³ORXYH-VH´pLQGHWHUPLQDGR
Estão corretas as afirmativas:
a) I e II. b) I, apenas. c) II, apenas. d) Nenhuma.
53. (CESPE/ CPRM / 2016) - Adaptada
A conjunção ³HQWUHWDQWR´ SDUHFH HYLGHQWH, entretanto, que isso não
precisa ser o resultado de milhões de anos. Basta um século.) do texto
introduz, no período em que se insere, ideia de oposição.
54. (CESPE/ TRE-PI / 2016) - Adaptada
No sistema proporcional, isso (legendas ficarem sem nenhum deputado) não
acontece, pois todo sufrágio ajuda os demais postulantes da sigla ou aliança.
$RUDomR³SRLVWRGRVXIUiJLRDMXGDRVGHPDLVSRVWXODQWHVGDVLJODRXDOLDQoD´
traz a consequência lógica GR TXH VH HQXQFLD QD RUDomR ³1R VLVWHPD
SURSRUFLRQDOLVVRQmRDFRQWHFH´
55. (IFBC / SES-PR / Técnico/2016)
A cabeça pensa a partir de onde os pés pisam. Para compreender, é essencial
conhecer o lugar social de quem olha. Vale dizer: como alguém vive, com
quem convive, que experiências tem, em que trabalha, que desejos

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 119 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

alimenta, como assume os dramas da vida e da morte e que esperanças o


animam. Isso faz da compreensão sempre uma interpretação.
Sendo assim, fica evidente que cada leitor é um coautor. Porque cada um lê
e relê com os olhos que tem. Porque compreende e interpreta a partir do
mundo que habita.
A expressão ³6HQGRDVVLP´ que introduz o último parágrafo cumpre papel
coesivo apresentando o valor semântico de:
a) explicação b) retificação c) conclusão d) oposição.
56. (CESPE/SEDF/2017)
Mas é claro que a gramática do inglês não é a mesma gramática do
português
Em relação às ideias e aos aspectos linguísticos do texto precedente, julgue
o item que se segue.
$RUDomR³TXHDJUDPiWLFDGRLQJOrVQmRpDPHVPDJUDPiWLFDGRSRUWXJXrV´
H[HUFHDIXQomRGHFRPSOHPHQWRGRYRFiEXOR³FODUR´.
57. (ESAF / Despachante Aduaneiro / 2016)
³4XHPROKDUFRPDOJXPDDWHQomRDFDUWDJHRJUiILFDGD$PpULFDGR6XOH
mais precisamente, da região amazônica, verificará que a larga faixa que se
estende ao longo das fronteiras do Brasil com seus vizinhos a norte e a oeste
UHSUHVHQWDXPDYDVWDUHJLmRSUDWLFDPHQWHGHVFRQKHFLGD´
Julgue o item a seguir.
$RUDomRLQWURGX]LGDSRU³TXH´DSyV³YHULILFDUi´pXPDRUDomRVXERUGLQDGD
substantiva subjetiva.
58. (IFBC / SES-PR / Administrador / 2016)
O período ³(XTXHULDcompreender o coração dos homens´ é composto e,
sobre a sua segunda oração, é correto afirmar que:
a) estabelece relação de coordenação
b) apresenta um verbo flexionado
c) exerce a função sintática de sujeito
d) encontra-se na forma reduzida.
59. (CONSULPLAN / Analista / CFESS / 2017)
As orações substantivas exercem as mesmas funções, no período, dos
termos vistos na análise sintática das orações. Analisando sintaticamente o
período: ³(XPGLDGHVFREUHPTXHDVEULOKDQWHVFRQWDVGHYLGURVmRVyLVWR
FRQWDV GH YLGUR´ pode-se identificar o mesmo tipo de oração substantiva
vista em:
a) Nunca duvidei de suas palavras.
b) Ainda não verifiquei os relatórios que foram entregues ontem.
c) O professor permitiu que vários alunos fizessem nova avaliação.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 120 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

d) Minha sensação era de que os alunos haviam compreendido todo o


exposto.
60. (FCC / TRT 24ª / Oficial de Justiça/2017)
Na frase Parece ser um fato assentado que um jornal expresse a
³UHDOLGDGH´os termos sublinhados
(A) prendem-se ao mesmo verbo, do qual constituem adjuntos.
(B) são sujeitos de uma mesma forma verbal.
(C) integram duas orações distintas.
(D) exercem, respectivamente, a função de complemento nominal e a de
complemento verbal.
(E) estão empregados como predicativos do sujeito.
61. (CONSULPLAN / Téc. Jud. / TRE-MG / 2015)
Em ³¬H[FHomRGRFDUJRGHVHQDGRUTXHWHPPDQGDWRVFRPGXUDomRGH
oito anos, os demais cargos eletivos têm mandatos de quatro anos´ p
correto afirmar que, sintaticamente, o referido período é composto por
oração subordinada
a) adjetiva restritiva.
b) adjetiva explicativa.
c) substantiva predicativa.
d) substantiva completiva nominal.
62. (CONSULPLAN / Professor / Pref. Natal-RN / 2013)
Em ³ D SUy[LPD FRPSUD GH OLYURV GLGiWLFRV SDUD R HQVLQR PpGLR GDUi
prioridade a obras que estejam organizadas nesse formato.", o termo
destacado apresenta a função de introduzir
a) a causa de tais obras serem priorizadas
b) uma explicação para as obras cuja compra será priorizada.
c) uma condição para tais obras terem sua compra priorizada.
d) uma restrição para o conjunto de obras cuja compra será priorizada.
63. (CESPE/ TRE-PI / 2016) - Adaptada
Trata-se do item da reforma que reúne mais apoiadores entre os
congressistas.
$RUDomR³TXHUH~QHPDLVDSRLDGRUHVHQWUHRVFRQJUHVVLVWDV´LQWURGX]XPD
informação acessória, mas importante para a construção da referência do
WHUPR³GRLWHPGDUHIRUPDSROtWLFD´
64. (CESPE /Ass. Adm./ FUB/2015)
A autonomia da universidade, requisito para a realização da ideia de
universalidade, não significa que a instituição se afasta do contexto social no
qual está inserida. A independência, como distanciamento crítico, possibilita,
ao contrário, que esse contexto possa ser pensado como um polo de relações

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 121 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

que não se confunde com qualquer conjunto de interesses particulares,


sejam eles mercadológicos, empresariais ou políticos. O afastamento
ocorreria precisamente se a universidade servisse imediatamente a
determinados interesses, com exclusão de todos os outros que integram
uma sociedade complexa e contraditória.
Em relação ao fragmento de texto acima, julgue o item subsequente.
2VHJPHQWR³TXHLQWHJUDPXPDVRFLHGDGHFRPSOH[DHFRQWUDGLWyULD´ O8-
9) constitui oração de natureza restritiva.
65. (ESAF/ANAC/Analista Administrativo/2016) adaptada
A Secretaria de Aviação Civil da Presidência da República divulgou
recentemente a pesquisa O Brasil que voa ± Perfil dos Passageiros,
Aeroportos e Rotas do Brasil, o mais completo levantamento sobre
transporte aéreo de passageiros do País. Mais de 150 mil passageiros,
ouvidos durante 2014 nos 65 aeroportos responsáveis por 98% da
movimentação aérea do País, revelaram um perfil inédito do setor.
A inserção de "que é" antes do segmento grifado no texto transforma o
aposto em oração subordinada adjetiva explicativa.
66. (CESPE / TRE-PI / 2016) - Adaptada
No trecho ³HOH PH OHYD D XP UHVWDXUDQWH TXH DSHVDU GH VLPSiWLFR PH
pareceu um pouco estranho´RHOHPHQWR³TXH´ introduz oração de natureza
restritiva, intercalada por estrutura de valor adverbial.
67. (CESPE / TJ / STJ / Administrativa / 2015)
Consta do preâmbulo da Constituição Federal que a justiça é um dos valores
supremos da sociedade, tal qual a harmonia social e a liberdade. Nos demais
artigos da Carta Magna, esse termo costuma vir associado à ideia de justiça
social. Assim, o primeiro inciso do artigo terceiro da Constituição estabelece
que a construção de uma sociedade que seja justa é um objetivo
fundamental da República Federativa do Brasil. Ao circunscrever a justiça no
espaço da sociedade, o texto constitucional estabelece, em síntese, que a
promoção da justiça na sociedade é um fim do Estado brasileiro.
Em relação às ideias e às estruturas linguísticas do texto A justiça social
como norma constitucional, julgue o seguinte item.
¬VHPHOKDQoDGRTXHRFRUUHFRPDH[SUHVVmR³HPVtQWHVH´RWUHFKR³TXH
VHMD MXVWD´ FRQVWLWXL XPD H[SUHVVmR H[SOLFDWLYD UD]mR SRU TXH WDPEpP
poderia ser isolado por um par de vírgulas, sem que isso acarretasse prejuízo
para a correção gramatical e para os sentidos do texto.
68. (INAZ / Engenheiro Segurança / Pref. Itaúna/2016)
(P³A genética, que já vinha sendo usada contra o câncer em diagnóstico
e em avaliações de risco, conseguiu, pela primeira vez, realizar o sonho das
GURJDVµLQWHOLJHQWHV¶LPSHGLUDIRUPDomRGHWXPRUHV´DVSDUWHVVXEOLQKDGDV
constituem-se como uma Oração:
a) Absoluta; b) Coordenada; c) Subordinada; d) Principal; e) Reduzida.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 122 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

69. (IBFC / EBSERH/2017)


No último parágrafo, o período ³- Olhe: sou um cara que trabalha muito
mal.´É composto e sua última oração pode ser classificada como:
a) subordinada adjetiva.
b) subordinada adverbial.
c) coordenada sindética.
d) subordinada substantiva.
e) coordenada assindética.
70. (CESPE / Funpresp / 2016) - Adaptada
Julgue o item seguinte.
$ORFXomR³XPDYH]TXH HMiQHPKDYLDPDLVRTXHHUUDUXPDYH]TXHQmR
havia mais dúvidas.) introduz, no período em que ocorre, ideia de causa.
71. (FGV / Recenseador / IBGE / 2017)
ANIMAIS, NOSSOS IRMÃOS
Desde o início da vida no planeta Terra, muitas são as espécies animais que
foram extintas por vários motivos.
Atualmente, quDQGRVHPHQFLRQDPµHVSpFLHVHPH[WLQomR¶DIORUDPDVYiULDV
atividades humanas que as provocaram, ou estão provocando.
Dentre essas ações, as principais talvez sejam:
³DFDoDSUHGDWyULDGHDQLPDLVGHJUDQGHSRUWHHGHDOJXQVDQLPDLVPHQRUHV
todos esses animais, de uma forma ou de outra, rendem expressivos lucros´
O segmento sublinhado, em relação ao trecho anterior, funciona como sua:
a) finalidade; b) causa; c) consequência; d) conclusão; e) proporção.
72. (FCC / TRE-SP/2017)
Isso é ainda mais verdadeiro em relação aos grandes museus de arte
contemporânea. Eles são grandes porque o artista moderno quer nos
envolver com o seu trabalho e deseja que entremos em sua obra.
Eles são grandes porque o artista moderno quer nos envolver com o seu
trabalho...
Com as devidas alterações, caso se invertam as relações de subordinação
da frase acima, mantém-se o sentido original fazendo-se uso da conjunção:
a) a despeito de
b) conquanto
c) em conformidade com
d) de maneira que
e) uma vez que
73. (CESPE / Ana. Legislativo Câmara Deputados / 2012)
A alternativa beleza/verdade é falsa, pois a obra pode ser bela e verdadeira

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 123 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

ao mesmo tempo.
Mantendo-se a correção gramatical e as relações semânticas do texto, seu
último período poderia ser assim reescrito: Haja vista que a obra literária
pode ser, a um só tempo, bela e verdadeira, a dicotomia beleza/verdade não
procede.
74. (CESPE / TRE-PI / 2016) - Adaptada
O formato (sistema eleitoral majoritário) enfraquece os partidos e fortalece
o personalismo, já que os votos são do candidato e de ninguém mais. Não
chega a ser improvável que personagens folclóricos dominem a câmara.
$RUDomR³MiTXHRVYRWRVVmRGRFDQGLGDWRHGHQLQJXpPPDLV´HQXQFLDD
FDXVDGRVIDWRVDSUHVHQWDGRVQDVRUDo}HV³RIRUmato enfraquece os partidos
HIRUWDOHFHRSHUVRQDOLVPR´
75. (ESAF / ANAC / 2016) - Adaptada
A expressão sublinhada em ³Já que HVWRXHVFUHYHQGRHVVHDUWLJRVREUHYLYL´
tem sentido de
a) conformidade. b) conclusão. c) causa. d) dedução. e) condição.
76. (AOCP / Prefeitura de Juiz de Fora / Contador/2016)
No trecho ³$ UHXQLmR QmR IRL GDV PDLV IUXWtIHUDV já que os dois eram
incapazes de conversar >@´DH[SUHVVmRHPGHVWDTXHLQWURGX]XPDRUDomR
que denota
a) finalidade. b) condição. c) causa. d) tempo. e) consequência.
77. (CONSULPLAN / Aux. Adm. / Pref. Dq. Caxias / 2015)
³0LQKD PmH UH]DULD XPD 6DOYHǦRainha por ela, se a conhecesse.´. A
articulação das orações do período expressa uma ideia de:
a) causa.
b) condição.
c) comparação.
d) consequência.
78. (VUNESP / TJ SP / 2017)
Julgue o item a seguir.
A relação de sentido que há entre as partes sinalizadas no período ± (I) Se
você não me ajudar com a lição de casa, (II) eu vou processar você ± é:
(I) expressa uma condição; (II) expressa uma possível ação consequente.
79. (CESPE/ TRE-PI / 2016) - Adaptada
A oração ³PHVPR TXH SDVVHP GH XP PLOKmR GH YRWRV´ exprime uma
condição hipotética para o fato descrito na oração ³/HJHQGDV TXH WHQKDP
agenda autêntica (uma bandeira ambiental, ou liberal, ou socialista, por
H[HPSOR SRGHPWHUPLQDUVHPQHQKXPGHSXWDGR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 124 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

80. (IFBC / SES-PR / Administrador/2016)


Eis o que tem sido a minha vida. Tenho-a considerado digna de ser vivida e,
de bom grado, tornaria a vivê-la, se me fosse dada tal oportunidade.
O último parágrafo do texto revela a conclusão do autor sobre o tema
DERUGDGR 3RU PHLR GD SDVVDJHP ³VH PH IRVVH GDGD WDO RSRUWXQLGDGH´
evidencia-se, em relação à ideia precedente, um sentido de:
a) condição b) concessão c) causa d) conformidade
81. (CCV/ UFC / Aux. Administração /2016)
A oração em destaque em: Se você não quer aprender Linux, a opção é o
Remix OS classifica-se como adverbial:
a) final. b) causal. c) concessiva. d) condicional. e) consecutiva.
82. (FAUEL / ADVOGADO/2017)
Assinale a única alternativa abaixo que apresenta uma oração subordinada
adverbial, que estabelece relação temporal no Período:
a) Receberão na próxima semana, a merecida premiação.
b) Quando chegou, não havia mais ninguém à sua espera.
c) O equipamento foi revisado semana passada.
d) O tempo é o melhor remédio para a maioria dos problemas.
83. (FGV /DPE-MT/Advogado/2015)
No caso da frase ³$VVLP TXHpisa em solo estrangeiro, todo turista logo é
GHVFREHUWR´ as duas orações que compõem o período apresentam a
seguinte relação:
a) localização espacial / causa da oração anterior.
b) localização temporal / consequência.
c) afirmação / explicação.
d) situação temporal / ação posterior.
e) situação espacial / ação anterior.
84. (CCV / UFC / Auxiliar Administrativo/2016)
Em: A opção para recuperar os padrões de fábrica geralmente aparece
quando você reinicia o computador e deixa apertada a tecla F8 enquanto ele
começa a carregar. O vocábulo enquanto explicita uma relação de:
a) causalidade. b) comparação. c) consequência. d) simultaneidade.
e) condicionalidade.
85. (CESPE/ Secretaria de Educação-DF/2017)
Embora não possamos desconsiderar o avanço científico a que os últimos
séculos assistiram ² as revoluções consideráveis no campo da medicina, da
física, da química e das próprias ciências sociais e humanas ², essa ciência
capitalista, androcêntrica e colonial não tem conseguido dar conta de
resolver o problema que ela própria ajudou a construir.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 125 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

Considerando as ideias e estruturas linguísticas do texto, julgue o item a


seguir.
2 FRQHFWLYR ³(PERUD´ LQWURGX] QR SHUtRGR HP TXH RFRUUH XPD LGHLD GH
concessão.
86. (CESPE/ TRE-PI / 2016) - Adaptada
Falamos com elas em línguas diferentes, em horários improváveis, embora
tenhamos objetivos comuns e comemoremos juntos os resultados
alcançados.
No texto A mensagem virtual, a oração ³HPERUD WHQKDPRV REMHWLYRV
FRPXQV´em expressa uma ideia de
a) comparação. b) consequência. c) causa. d) finalidade. e) concessão.
87. (Fiocruz / Assistente/2016)
³$FRPLGDHPStOXODVQmRYHLR- se bem que a nouvelle cuisine chegou perto.´
Das alterações feitas na redação do período acima, aquela em que se
modificou o sentido concessivo da oração subordinada é
a) A comida em pílulas não veio - ainda que a nouvelle cuisine tenha
chegado perto.
b) A comida em pílulas não veio - embora a nouvelle cuisine tenha chegado
perto.
c) A comida em pílulas não veio - contanto que a nouvelle cuisine tenha
chegado perto.
d) A comida em pílulas não veio - conquanto a nouvelle cuisine tenha
chegado perto.
e) A comida em pílulas não veio - posto que a nouvelle cuisine chegou
perto.
88. (CESPE/ TRE-PI / 2016) - Adaptada

A oração ³SDUDTXHWHQKDPHILFiFLD OH) indica a causa da aceitação


e da assimilação das leis e das políticas públicas pela população.
89. (FCC / TRT-23ª / Analista Judiciário/2016)
Logrador

Você habita o próprio centro


de um coração que já foi meu.
Por dentro torço porque dentro
em pouco lá só more eu.

Livre de todos os negócios

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 126 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

e vícios que advêm de amar


lá seja o centro de alguns ócios
que escolherei por cultivar.

Para que os sócios vis do amor,


rancor, dor, ódio, solidão,
não mais consumam meu vigor,

amado e amor banir-se-ão


do centro rumo a um logrador
subúrbio desse coração.

Mantendo-se o sentido original, no verso Por dentro torço porque dentro em


pouco lá só more eu (1ª estrofe), o termo sublinhado pode ser substituído
por:
a) para que b) visto que c) pelo que d) com que e) de modo que
90. (Fiocruz / Assistente/2016)
³(TXDQWRPDLVDFLrQFLDDYDQoDSRUFDPLQKRVQXQFDDQWHVVRQKDGRVPDLV
OHLJRILFDROHLJR´
No período transcrito acima, as duas orações estruturam-se numa correlação
VLQWiWLFD³TXDQWRPDLVPDLV´GHVHQWLGR
a) causal. b) proporcional. c) consecutivo. d) temporal. e) modal.
91. (NUCEPE / SEJUS-PI / Agente Penitenciário /2016)
Do ponto de vista sintático, a relação que se estabelece entre os termos
destacados está corretamente identificada em:
a) A maneira como o estupro e a violência contra as mulheres são tratados
em nossa sociedade é reveladora da ideologia subjacente: (O primeiro
termo especifica e determina o segundo).
b) Não é pensado como assunto que nos implica a todos! (A oração não
mantém, com aquela que a antecede, qualquer relação de dependência ou
subordinação).
c) Entenda-se aqui a falta de um real interesse em pensar, de forma
consistente e permanente, políticas públicas eficazes para promover a
equidade entre os gêneros. (A oração estabelece com a sua principal uma
relação de causalidade).
d) ... o que se vê são promessas de acirramento das leis, ... (o termo
das leis completa o sentido do nome que o antecede, por isso trata-se de
um complemento nominal).
e) eventualmente punem-se os culpados, até que apareçam novas
vítimas... (O conectivo introduz uma oração que, com sua principal,
estabelece relação de finalidade).

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 127 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

92. (AOCP / EBSERH/2016)


Assinale a alternativa correta.
a) (P³>@%DXPDQGL] que, nesses tempos líquidos modernos, os homens
precisam e desejam que VHXVYtQFXORVVHMDPPDLVVyOLGRVHUHDLV>@´RV
dois termos em destaque introduzem orações subordinadas substantivas
objetivas diretas.
b) (P ³>@Quando as manifestações vão para as ruas, elas chamam a
DWHQomR>@´DRUDomRHPGHVWDTXHFODVVLILFD-se como oração subordinada
adverbial causal..
c) (P ³>@ 6HULDP DV QRYDV UHGHV GH UHODFLRQDPHQWR que são formadas
HPHVSDoRVGLJLWDLVTXHWUD]HPDQRomRGHDSUR[LPDomR>@´RWermo em
destaque introduz uma oração subordinada substantiva completiva nominal.
d) (P³>@(VWDPRVHPUHGH mas isolados dentro de uma estrutura >@´
a oração em destaque classifica-se como oração coordenada sindética
alternativa.
e) (P ³>@ esperando que em uma rede sempre haja celulares
disponíveis para HQYLDUHUHFHEHUPHQVDJHQVGHOHDOGDGH>@´RWHUPRHP
destaque introduz uma oração subordinada adverbial consecutiva.
93. (FCC / TRT 11ª Região/2017)
Freud uma vez recebeu carta de um conhecido pedindo conselhos...
Sem prejuízo da correção e do sentido, o elemento sublinhado acima pode
ser substituído por:
a) através de que se pedia
b) que lhe pedia
c) da qual pedia-lhe
d) onde pedia-se
e) em que se pedia
94. (FGV / Agente Administrativo / IBGE / 2017)
³&RP DV QRYDV PHGLGDV SDUD HYLWDU D DEVWHQomR R JRYHUQR HVSHUD XPD
HFRQRPLDYXOWRVDQR(QHP´
$ RUDomR UHGX]LGD ³SDUD HYLWDU D DEVWHQomR´ SRGH VHU DGHTXDGDPHQWH
substituída pela seguinte oração desenvolvida:
a) para que se evitasse a abstenção;
b) a fim de que a abstenção fosse evitada;
c) para que se evite a abstenção;
d) a fim de evitar-se a abstenção;
e) evitando-se a abstenção.
95. (FGV /Prefeitura de Paulínia / Procurador /2016)
³eSUySULRGDVIDPtOLDVQXPHURVDVbrigarem, fazerem as pazes e tornarem a
brigar´ 0DFKDGRGH$VVLV

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 128 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

Se transformarmos as orações reduzidas, sublinhadas na frase acima, em


orações desenvolvidas de modo adequado, a nova forma será:
a) as brigas, a realização das pazes e a volta às brigas
b) que brigassem, que fizessem as pazes e tornassem a brigar.
c) que tenham brigado, que tenham feito as pazes e que tenham tornado
a brigar.
d) que briguem, que façam as pazes e tornem a brigar.
e) que brigam, que fazem as pazes e tornam a brigar.
96. (FGV / Pref.Florianópolis / Fiscal de Serviços/2014)
³FDGDXPGHQyVFRRSHUDSDUDDmanutenção GHXPDPtQLPDKDUPRQLD´
se modificarmos o substantivo sublinhado para uma forma desenvolvida de
oração, a forma adequada será:
a) para manter-se uma mínima harmonia;
b) para que se mantenha uma mínima harmonia;
c) para que se mantivesse uma mínima harmonia;
d) para que se mantesse uma mínima harmonia;
e) para que se mantinha uma mínima harmonia.
97. (ESAF / Analista MPOG / 2015) adaptada
Os cristãos enfrentam uma perseguição cada vez maior em todo o mundo,
alimentada principalmente pelo extremismo islâmico e por governos
repressivos.
Julgue o item a seguir.
2 WUHFKR ³DOLPHQWDGD SULQFLSDOPHQWH SHOR H[WUHPLVPR LVOkPLFR e por
governos repressivos" é uma oração reduzida de gerúndio.
98. (FGV /IBGE /2016)
³6HPSHGLU OLFHQoDSHJRX R FDUWD]HFRPRJL]HVFUHYHX RXWURFRQFHLWR´
aoração ³6HP SHGLU OLFHQoD´ pode ser adequadamente substituída pela
seguinte oração desenvolvida:
a) Sem que pedisse licença;
b) Sem o pedido de licença;
c) Sem que peça licença;
d) Sem a petição de licença;
e) Sem que havia pedido licença.
99. (CONSULPLAN / Ana. Jud. / TRF 2ª Região / 2017)
(P³DSRHLUDGRVSpVGDTXHOHV que PDQGRXHQIRUFDU´RWHUPRGHVWacado
indica, sintaticamente, a mesma função exercida pelo termo grifado em:
D ³DREUD$V%UX[DVGH6DOpPGH$UWKXU0LOOHUque também foi tema de
ILOPHODQoDGRHP´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 129 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

E ³R'LUHLWRGD/LWHUDWXUDque trata dos direitos do autor ou de uma obra


[..@´
F ³$/LWHUDWXUDVXUJHFRPRXPDPHWiIRUDque o Direito usa para tentar
G ³GHFLVmRMXGLFLDODIDYRUGDDXWRUDque UHFODPDYDGHDWHQWDGRjKRQUD´
100. (FCC / TRT 24ª/2017)
No trecho Os bancos e as empresas que efetuam pagamentos, no início do
SULPHLURSDUiJUDIRR³TXH´H[HUFHIXQomRSURQRPLQDO2XWURWUHFKRGRWH[WR
em que essa palavra exerce a mesma função é:
a) De acordo com os resultados, cerca de metade das organizações que
atuam no campo de pagamentos eletrônicos... (3o parágrafo)
b) Mais de um terço (38%) das organizações reconhece que é cada vez
mais difícil detectar se uma transação é fraudulenta ou verdadeira... (1o
parágrafo)
c) O estudo revela que o índice de fraudes on-line acompanha o aumento
do número de transações on-line... (2o parágrafo)
d) Também vale notar que o desvio de pagamentos pode causar perda de
clientes... (3o parágrafo)
e) Conclui-se que a fraude não é o único obstáculo a ser superado... (4o
parágrafo)
101. (FCC ± TRT 11ª / Técnico /2017)
Julgue o item a seguir.
Ambos os elementos sublinhados em ³)UHXGVDELDque as razões que mais
SHVDP´ são pronomes.
102. (CESPE/ TRE-PI / 2016)
³e D SULPHLUD YH] GHVGH D UHJXODPHQWDomR GD PHGLGD HP  TXH R
PHFDQLVPRpDGRWDGRQR%UDVLO´
1R ~OWLPR SHUtRGR GR WH[WR 6LWXDomR GH HPHUJrQFLD R YRFiEXOR ³TXH´ IRL
empregado como
a) conjunção integrante. b) conjunção comparativa. c) advérbio.
d) pronome relativo. e) partícula expletiva.
103. (IADES / HEMOCENTRO/2017)
Considerando o segundo parágrafo, nas orações ³2V JOyEXORV YHUPHOKRV
(eritrócitos ou hemácias) têm uma identidade que SHUPLWHDFODVVLILFDomR´e
³e SRVVtYHO que ILOKRV WHQKDP WLSR VDQJXtQHR GLIHUHQWH´ os termos
sublinhados classificam-se, respectivamente, em
a) pronome relativo e conjunção coordenativa explicativa.
b) conjunção subordinativa consecutiva e conjunção subordinativa causal.
c) partícula expletiva e pronome relativo.
d) preposição e conjunção coordenativa adversativa.
e) pronome relativo e conjunção subordinativa integrante.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 130 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

104. (CESPE/ TRE-PI/Taquigrafia/ 2016) - Adaptada


No texto Argumentação, a partícula se é classificada como conjunção
integrante no trecho
D ³TXHpRTXHVHID]QDHVWHLUDGHVVHVGRLVDXWRUHVIUDQFHVHV´
E ³$OJXQV>GLVFXUVRV@VHDSUHVHQWDPFRPRH[SOLFLWDPHQWHDUJXPHQWDWLYRV´
F ³6HFRPRHQVLQDYD%DNKWLQRGLDORJLVPRSUHVLGHjFRQVWUXomRGHWRGR
GLVFXUVR´, então o discurso será uma voz nesse diálogo .
G ³6HDDUJXPHQWDomRpXPDFDUDFWHUtVWLFDEiVLFDGRGLVFXUVRSRGHUtDPRV
perguntar-QRV´
H  ³SRGHUtDPRV SHUJXQWDU-nos se os trabalhos sobre argumentação são
DEXQGDQWHV´
105. (FGV / CODEBA / Administrador/2016)
³$XWRUHV GH UHODWyULRV que têm leitores definidos podem pressupor que
compartilham com seus leitores um conhecimento geral sobre a questão
DERUGDGD´
A frase em que os vocábulos sublinhados possuem, respectivamente, as
mesmas classes gramaticais ± pronome relativo e conjunção integrante ±
que as sublinhadas nesse segmento do texto é:
a) Ouvi, com humilde admiração, uma senhora declarar que a sensação de
estar bem-vestida dava-lhe um sentimento de tranquilidade interior que a
religião não lhe podia conferir.
b) É o uniforme que faz esquecer aquele que o veste.
c) O que é a felicidade além da simples harmonia entre o homem e a vida
que ele leva?
d) Sucesso é conseguir o que você quer e felicidade é gostar do que você
conseguiu.
e) O otimista é um cara que acredita que o que está para acontecer será
adiado.
106. (INAZ / Engenheiro Segurança / Pref. Itaúna/2016)
No fragmento: ³2SUy[LPRSDVVRpDVVHJXUDUTXHDVFpOXODVFDQFHURVDVQmR
VHWRUQHPUHVLVWHQWHVjPHGLFDomR´o vocábulo que é:
a) partícula de realce;b) pronome relativo;c) sujeito;d) objeto direto;e)
conjunção integrante.
107. (AOCP /EBSERH-Técnico em Enfermagem/2016)
Em ³OHPEUD-se de algo bizarro que DFRQWHFHXTXDQGRYRFrWLQKDDQRV´
o termo em destaque
a) é um pronome relativo que exerce a função de objeto direto.
b) é um pronome relativo que exerce a função de sujeito.
F pXPDFRQMXQomRLQWHJUDQWHTXHUHWRPD³DOJREL]DUUR´
d) é uma conjunção integrante que introduz uma oração subordinada

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 131 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

adjetiva.
e) é um pronome relativo que exerce a função de objeto indireto.
108. (CONSULPLAN / Analista Gestão / CBTU / 2014)
³e QRFLYR se escreve coisas inúteis, se deforma ou falsifica (mesmo
inconscientemente) para obter um efeito ou um escândalo; se se conforma
sem FRQYLFomR D RSLQL}HV QDV TXDLV QmR DFUHGLWD´ A respeito das várias
RFRUUrQFLDVGRWHUPRGHVWDFDGR³VH´pFRUUHWRDILUPDUTXH
D HPWRGDVDVRFRUUrQFLDVDIXQomRGRWHUPR³VH´pDPHVPD
b) entre as quatro ocorrências podem ser identificadas apenas duas funções
GLVWLQWDVGR³VH´
F  D SULPHLUD RFRUUrQFLD SRGH VHU VXEVWLWXtGD SRU ³Mi TXH´ VHP TXH KDMD
alteração quanto ao sentido.
d) as duas últimas ocorrências representam ênfase quanto à condição para
que haja nocividade no trabalho do escritor.
109. (CESPE/ TRE-PI / 2016) - Adaptada
A partícula ³VH´ em ³GHYH-VH DWHQWDU SDUD R IDWR´ classifica-se como
pronome apassivador.
110. (CESPE/TRE-PI / 2016) - Adaptada
Nossas mensagens e documentos agora são digitais: encaminhadas em
segundos, ao clicar de uma tecla, ao toque dos dedos ou em resposta a um
comando de voz, materializam-se diante dos nossos olhos em telas, telinhas
e telonas...
A partícula ³VH´ em ³PDWHULDOL]DP-VH´ classifica-se como pronome
apassivador.
111. (CESPE/ TRT-PI / 2016) - Adaptada

Na linha 2, a fRUPDSURQRPLQDO³QRV´FODVVLILFD-se como pronome reflexivo,


H[HUFHQGRDIXQomRGHFRPSOHPHQWRGDIRUPDYHUEDO³UHODFLRQDPRV´
112. (CESPE/ DPU / 2016) - Adaptada
Ainda a respeito das ideias e dos aspectos linguísticos do texto, julgue o item
subsecutivo.
Em ³DV SDUWHV VH YLDP LPSRVVLELOLWDGDV GH DUFDU FRP RV SRVVtYHLV FXVWRV
MXGLFLDLVGDVGHPDQGDV´a partícula ³VH´foi empregada no sentido de umas
às outras.
113. (ESAF/ANAC / 2016) - Adaptada
Em "Pode-se" (Pode-se localizar o início da aviação nas experiências de
alguns...) o pronome "se" indica a noção de condição.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 132 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

114. (ESAF/ANAC / 2016) - Adaptada


Em "se sustentavam" (Ao contrário dos balões, que se sustentavam na
atmosfera...) e "se elevassem" (os aviões precisavam de um meio para que
se elevassem por seus próprios recursos) o pronome "se" indica voz
reflexiva.
115. (FGV/ IBGE / 2016) - Adaptada
O pronome SE no primeiro período do texto (O aumento dos índices de
desemprego se refletiu nos resultados da PNAD já em 2014.) indica que esse
período está na voz passiva.
116. (AOCP / EBSERH/2016)
Em³6HJXQGR:LOGse você não se VHQWHjYRQWDGHSDUDVDLUGHFDVD>@´
os termos em destaque funcionam, respectivamente, como
a) conjunção subordinativa condicional e parte integrante do verbo.
b) conjunção subordinativa condicional e pronome apassivador.
c) índice de indeterminação do sujeito e parte integrante do verbo.
d) parte integrante do verbo e conjunção subordinativa condicional.
e) conjunção subordinativa condicional e índice de indeterminação do
sujeito.
117. (FGV / TRT SC / Analista / 2017)
Remédios mais localizados, como injeções de esteroides, perdem efeito com
o tempo.
O valor semântico do termo sublinhado se repete no seguinte pensamento:
(A) O objeto em si não conta; importa a maneira como é apresentado. (Raoul
Dufy)
(B) Eu sou firme; você, obstinado; ele, teimoso como uma mula. (Bertrand
Russell)
(C) Para o biólogo, o homem é um animal como os demais. (Jean Rostand)
(D) As ciências modernas, como a informática, muito dificultam o dia a dia.
(M. Fernandes)
(E) Pense como um homem de ação e aja como um pensador. (Henri-Louis
Bergson)
118. (FCC / ARTESP / 2017)
Cem anos depois, vivemos um momento semelhante diante da iminência de
uma "nova revolução industrial", como define o secretário de Transportes
paulistano, Sérgio Avelleda.
O vocábulo como, nessa passagem do texto, estabelece a mesma relação
de sentido que a verificada em:
(A) Como ainda há poucos carros autônomos nas ruas, seu impacto no
cotidiano é desconhecido.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 133 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

(B) Ainda não se sabe como ficarão as leis de trânsito com a popularização
dos carros autônomos.
(C) Como dito no texto, os carros autônomos, com diferentes tecnologias, já
são uma realidade.
(D) O modo acelerado como os carros sem motorista têm sido produzidos é
realmente espantoso.
(E) Os carros autônomos são, para a sociedade atual, como eram os carros
no início do século 20.

Mais questões comentadas

119. (CONSULPLAN / Analista / CFESS / 2017)


Tendo em vista as relações de sintaxe estabelecidas nas orações a seguir,
relacione adequadamente as colunas, considerando os termos destacados.
1. Objeto indireto.
2. Sujeito simples.
3. Adjunto adverbial.
4. Predicativo do sujeito.
 ³>@TXHRVSRUWXJXHVHVlhes GDYDP´
 ³A noção de espaço público lá eVWiPXLWRSUHVHQWH´
 ³&DUWDVHH-mails ficam pacientemente jQRVVDHVSHUD´
 ³(PSULPHLUROXJDUHUDPnovidadeFRLVDGHVFRQKHFLGDSRUDOL´
A sequência está correta em
a) 1, 2, 3, 4.
b) 2, 4, 3, 1.
c) 3, 1, 2, 4.
d) 4, 3, 1, 2.
120. (CONSULPLAN / Ass. Social / 2016)
De acordo com as relações sintáticas estabelecidas, leia e analise as
considerações a seguir.
I. Para relatar a forma como o compadre arrumava a encomenda dos ovos
empregou-VHRSUHGLFDGRQRPLQDOHP³HFDGDRYRHUDHQURODGRHPVXD
pDOKDGHPLOKRFRPWRGRFDULQKR´
II. O sujeito indeterminado foi empregado para demonstrar a ação da mulher
GRFRURQHOHP³FRPRTXHPGL]TXDO´
III. Para indicar as ações da mulher e dos filhos do coronel foram
empregados verbo transitivo direto e indireto, respectivamente, vistos em:
³DEDQDYDDFDEHoD´³DFDEDYDPRVHUYLoR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 134 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

Está(ão) correta(s) apenas


a) I.
b) III.
c) I e II.
d) II e III.
121. (CONSULPLAN / Advogado / TERRACAP / 2014)
Acerca das relações sintáticas estabelecidas no interior das orações, assinale
a afirmativa correta.
D  (P ³(VWDPRV QD GLUHomR HUUDGD´ R VXMHLWR HVWi H[SOLFLWDGR DWUDYpV GD
desinência verbal.
E (P³>@RPXQGRODQoRXPDLVSROXHQWHV>@´pFRUUHWRDILUPDUTXHR
WHUPR³PDLV´LQWHQVLILFDDDomRYHUEDO
F  (P ³$ DWividade humana em todo o mundo foi responsável por lançar
poluentes >@´ R VXMHLWR SDFLHQWH p LQGLFDGR DWUDYpV GD IRUPD YHUEDO
apresentada.
G (P³>@DQXQFLDUDPFLHQWLVWDVjVYpVSHUDVGD&~SXODGR&OLPD>@´j
forma verbal é acrescentada uma circunstância referencial
H (P³>@HVWHMDPFUHVFHQGRDXPDPpGLDGHDRDQR´DORFXomR
YHUEDO HVWi GLUHWDPHQWH OLJDGD DR VXMHLWR ³DV HPLVV}HV GH GLy[LGR GH
FDUERQR´
122. (CONSULPLAN / Ass. Manutenção / CBTU / 2014)
Sobre a estruturação sintática do período, ³5HJLPHVGHH[FHomRSHUSHWXDP
privilégios, disseminam a injustiça, atrasam o desenvolvimento,
comprometem as perspectivas de emancipação >@´pFRUUHWRDILUPDUTXH
a) é composto por quatro formas verbais, logo, quatro orações.
b) o sujeito dos verbos não foi explicitado em nenhuma das orações.
c) os verbos são intransitivos, por isso não exigem complemento verbal.
d) os verbos não exigem complemento verbal, já que são transitivos diretos.
123. (CONSULPLAN / Aux. Adm. / Pref. Dq. de Caxias / 2015)
Acerca da classificação dos termos grifados a seguir, marque V para as
alternativas verdadeiras e F para as falsas.
 ³([LVWHPdois tipos de loucos." (1º§) ± objeto direto
 ³2VLOrQFLRpuma loucura." ± predicativo
 ³$IDVWHLǦme um pouco dele no sofá." ± adjunto adverbial
 ³$FKRTXHtodo escritor gosta deste brinquedo,..." ± sujeito
A sequência está correta em:
a) F, V, V, V.
b) F, V, F, V.
c) V, F, F, V.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 135 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

d) V, V, F, F.
124. (CONSULPLAN / Analista Gestão / CBTU / 2014)
‡WUDQVLomRGHXPSDtVSUHGRPLQDQWHPHQWHUXUDOSDUDRSDWDPDUDWXDORQGH
aproximadamente 80% da população passa a residir em áreas urbanas;
‡WULSOLFDomRGDSRSXODomRDRORQJRGHVWHPHVPRSHUtRGR
‡ FUHVFLPHQWR GD IURWD GH YHtFXORV D SDUWLU GR GHVHQYROYimento industrial
com foco na indústria automobilística.
A consideração da inter-relação existente entre cidades sustentáveis, redes
de transporte de qualidade, eficiência energética, respeito ao meio ambiente
e renda da população, impõe-se como questão indiscutível, exigindo
atuação e colaboração entre os diferentes setores de governo e ação
integrada nos três níveis de poder, sob pena de não alcançar a desejada
inclusão social com qualidade de vida nas cidades.
A experiência mundial aponta para a importância dos sistemas sobre trilhos
como uma solução eficiente para estruturação das redes de transporte
urbano nas médias e grandes cidades. O setor metroferroviário é capaz de
proporcionar impactos muito relevantes e positivos sobre os aspectos
anteriormente mencionados. Ao mesmo tempo, exige vultosos
investimentos para sua implantação e expansão, tornando imprescindível o
apoio da União, em conjunto com os poderes locais, num planejamento
mais amplo e consistente de priorização de investimentos no setor.
Dentre os termos destacados a seguir, indique o que, no texto, desempenha
DPHVPDIXQomRVLQWiWLFDGH³FRQVLGHUDomR´ ž† 
D ³TXHVWmR´ ž† 
E ³LQFOXVmR´ ž† 
F ³H[SHULrQFLD´ ž† 
G ³SODQHMDPHQWR´ ž† 
125. (CONSULPLAN / Téc. Contabilidade / MAPA / 2014)
A oração destacada em ³'XUDQWHDVPDQLIHVWDo}HVGHMXQKR'/XL] QHWR
de Luis Maria) recomendou a seus seguidores que não fossem às ruas >@´
classifica-se como
a) oração subordinada adjetiva restritiva.
b) oração subordinada substantiva objetiva direta.
c) oração subordinada substantiva objetiva indireta.
d) oração subordinada substantiva completiva nominal.
126. (CONSULPLAN / Ag. Ativ. Agropecuárias / MAPA / 2014)
Gerador de frases machistas
Campanha da ONU tenta mudar estereótipos femininos que se propagam
em sistemas de buscas na internet.
Dessa os internautas de língua portuguesa escaparam por pouco. O órgão
das Nações Unidas para a igualdade de gênero lançou campanha mundial

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 136 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

em novembro deste 2013 contra o machismo entranhado nos sistemas de


busca da internet. O preenchimento automático do Google sugere ao usuário
uma lista dos termos mais procurados ligados aos termos digitados.
$R GLJLWDU ³ZRPHQ VKRXOGQ¶W´ PXOKHUHV QmR GHYHP  QR FDPSR GH
pesquisa, o publicitário Christopher Hunt (diretor de arte da agência Ogilvy
& Mather, em Dubai, nos Emirados Árabes) percebeu que a ferramenta
DXWRFRPSOHWDU IUDVHV VXJHULD FRQVWUXo}HV FRPR ³PXOKHUHV QmR GHYHP
WUDEDOKDU´ ³WHU GLUHLWRV´ ³YRWDU´ ³IDODU QD LJUHMD´ ³VHUHP GLJQDV GH
FRQILDQoD´ RX FRPR ³PXOKHUHV SUHFLVDP VHU GLVFLSOLQDGDV´ $ EXVFD SHOD
PHVPD H[SUHVVmR FRP D SDODYUD ³KRPHP´ FRPR VXMHLWR WUD] UHVXOWDGRV
EHPGLIHUHQWHV³KRPHPQmRGHYHFKRUDU´³VHUERQ]LQKR´HWF
(P SRUWXJXrV D H[SUHVVmR ³PXOKHUHV QmR GHYHP´ QmR HQXPHUD
sugestões sexistas ao Google, ao menos nas buscas mais populares no
Brasil. Os estereótipos emergem, na verdade, quando o termo pesquisado é
³PXOKHUDGD´
(Língua Portuguesa, Dez/2013.)
De acordo com o texto, a expressão ³PXOKHUHV QmR GHYHP´ era
autocompletada com expressões prontas. A respeito dos complementos, é
correto afirmar que ³WUDEDOKDU´H ³YRWDU´constituem
a) complementos nominais exigidos pelo verbo dever.
b) junto à expressão que os antecede, uma locução verbal.
F XPHVWDGRGRVXMHLWRLQGLFDGRHP³PXOKHUHVQmRGHYHP´
d) complementos desnecessários para o entendimento da expressão
anterior.
127. (CONSULPLAN / Ag. Administrativo / MAPA / 2014)
Os elementos destacados em ³7RGRVRIULPHQWRDOKHLRa preocupa e acende
nela o facho da ação, que a WRUQDIHOL]´
Julgue o item a seguir:
2 XVR GR SURQRPH SHVVRDO UHWR ³HOD´ QHOD  QHVVH FDVR Vy p SHUPLWLGR
porque está antecedido de preposição.
128. (CONSULPLAN / Dentista / Pref. Cantagalo-RJ / 2013)
A oração sublinhada em ³(VWmR ILFDQGR YHOKDV mas não estão ficando
sábias´estabelece, com o período anterior, uma relação de
a) causa.
b) adição.
c) oposição.
d) conclusão.
e) explicação.
129. (CONSULPLAN / Estágio / TRT 13ª Região / 2012)
Em ³0DVRYHQWREDWHQGRQDVFRUWLQDVTXHHODPHVPDFRUWDUDOHPEUDYD-lhe
que se quisesse podia parar e enxugar a testa, olhando o calmo horizonte.",

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 137 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

o termo destacado estabelece coesão textual e desempenha a mesma função


sintática que o destacado em
D ³XPDcoisa verdadeira e sumarenta."
E ³&UHVFLDPWRPDYDPbanho«
F ³... podia parar e enxugar a testa,..."
G ³RFDQWRLPSRUWXQRdas empregadas do edifício."
H ³$QDGDYDDtudoWUDQTXLODPHQWHVXDPmRSHTXHQDHIRUWH«
130. (CONSULPLAN / Analista Judiciário / TSE / 2012)
Aquele que age na direção da lei como que age contra a moral caracterizada
SHOR ³ID]HU FRPR D JUDQGH PDLRULD´ OHYDQGR HP FRQWD TXH QR kPELWR GD
FRUUXSomRVHHQWHQGHTXHRTXHDPDLRULDTXHUp³GLQKHLUR´A respeito do
período anterior, analise as afirmativas a seguir.
I. O período apresenta orações coordenadas e subordinadas.
II. Há ocorrência de exemplo de oração reduzida.
III. Há ocorrência de exemplo de oração subordinada substantiva objetiva
direta.
Assinale
a) se todas as afirmativas estiverem corretas.
b) se apenas as afirmativas II e III estiverem corretas.
c) se apenas as afirmativas I e II estiverem corretas.
d) se apenas as afirmativas I e III estiverem corretas.
131. (CONSULPLAN / Analista Judiciário / TSE / 2012)
O que você está lhe dando, na verdade, é uma licença para ser extravagante.
Acerca do período anterior, analise as afirmativas a seguir:
I. O período contém três orações.
II. O período é composto por coordenação e subordinação.
III. Há uma oração reduzida.
Assinale
a) se apenas as afirmativas I e II estiverem corretas.
b) se todas as afirmativas estiverem corretas.
c) se apenas as afirmativas I e III estiverem corretas.
d) se apenas as afirmativas II e III estiverem corretas.
132. (CONSULPLAN / Professor / 2010)
Assinale a alternativa que é frase, mas não é oração:
D ³7XGRVREUHDPRU´
E ³$GRUDPRVXPQRYREH]HUURGHRXUR´
F ³3RUTXHRWXGRQmRH[LVWH´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 138 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

G ³6LPRDPRUpyWLPR´
H ³HpHODTXHGiVDERUDRDPRU´
133. (CONSULPLAN / Advogado / Pref. St Madalena-RJ/2010)
A educação possível
A educação benevolente e frouxa que hoje predomina nas casas e escolas é
mais nociva do que uma sala de aula com teto e chão furados e livros aos
frangalhos.
Educação é algo bem mais amplo do que escola. Começa em casa, onde
precisam ser dadas as primeiras informações sobre o mundo (com criança
também se conversa!), noções de postura e compostura, respeito, limites.
Continua na vida pública, nem sempre um espetáculo muito edificante, na
qual vemos políticos concedendo-se um bom aumento em cima dos seus já
polpudos ganhos, enquanto professores recebem salários escrachadamente
humilhantes, e artistas fazendo propaganda de bebida num momento em
que médicos, pais e responsáveis lutam com a dependência química de
milhares de jovens. Quem é público, mesmo que não queira, é modelo:
artistas, líderes, autoridades. Não precisa ser hipócrita nem bancar o
santarrão, mas precisa ter consciência de que seus atos repercutem, e
muito. Mas vamos à educação nas escolas: o que é educar? Como deveria
ser uma boa escola? Como se forma e se mantém um professor eficiente,
como se preparam crianças e adolescentes para este mundo competitivo
onde todos têm direito de construir sua vida e desenvolver sua
personalidade?
É bem mais simples do que todas as teorias confusas e projetos inúteis
que se nos apresentam. Não sou contra colocarem um computador em cada
sala de aula neste reino das utopias, desde que, muito mais e acima disso,
saibamos ensinar aos alunos o mais elementar, que independe de
computadores: nasce dos professores, seus métodos, sua autoridade, seu
entusiasmo e seus objetivos claros. A educação benevolente e frouxa que
hoje predomina nas casas e escolas prejudica mais do que uma sala de aula
com teto e chão furados e livros aos frangalhos. Estudar não é brincar, é
trabalho. Para brincar temos o pátio e o bar da escola, a casa.
Sair do primeiro grau tendo alguma consciência de si, dos outros, da
comunidade onde se vive, conseguindo contar, ler, escrever e falar bem
(não dá para esquecer isso, gente!) e com naturalidade, para se informar e
expor seu pensamento, é um objetivo fantástico. As outras matérias,
incluindo as artísticas, só terão valor se o aluno souber raciocinar, avaliar,
escolher e se comunicar dentro dos limites de sua idade.
No segundo grau, que encaminha para a universidade ou para algum curso
técnico superior, o leque de conhecimentos deve aumentar. Mas não adianta
saber história ou geografia americana, africana ou chinesa sem conhecer
bem a nossa, nem falar vários idiomas se nem sequer dominamos o nosso.
Quer dizer, não conseguimos nem nos colocar como indivíduos em nosso
grupo nem saber o que acontece, nem argumentar, aceitar ou recusar em
nosso próprio benefício, realizando todas as coisas que constituem o termo
WmRHPYRJDHWmRPDODSOLFDGR³FLGDGDQLD´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 139 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

O chamado terceiro grau, a universidade, incluindo conhecimentos


especializados, tem seu fundamento eficaz nos dois primeiros. Ou tudo
acabará no que vemos: universitários que não sabem ler e compreender um
texto simples, muito menos escrever de forma coerente. Universitários,
portanto, incapazes de ter um pensamento independente e de aprender
qualquer matéria, sem sequer saber se conduzir. Profissionais competindo
por trabalho, inseguros e atordoados, logo, frustrados.
Sou de uma família de professores universitários. Fui por dez anos titular
de linguística em uma faculdade particular. Meu desgosto pela profissão ±
que depois abandonei, embora gostasse do contato com os alunos ± deveu-
se em parte à minha dificuldade de me enquadrar (ah, as chatíssimas e
inócuas reuniões de departamento, o caderno de chamada, o currículo, as
notas...) e em parte ao desalento. Já nos anos 70 recebíamos na
universidade jovens que mal conseguiam articular frases coerentes, muito
menos escrevê-las. Jovens que não sabiam raciocinar nem argumentar,
portanto incapazes de assimilar e discutir teorias. Não tinham cultura nem
base alguma, e ainda assim faziam a faculdade, alguns com sacrifício,
deixando-me culpada quando os tinha de reprovar.
Em tudo isso, estamos melancolicamente atrasados. Dizem que nossa
economia floresce, mas a cultura, senhores, que inclui a educação (ou vice-
versa, como queiram...), anda mirrada e murcha. Mais uma vez, corrigir isso
pode ser muito simples. Basta vontade real. Infelizmente, isso depende dos
políticos, depende dos governos. Depende de cada um de nós, que os
escolhemos e sustentamos.
A análise dos elementos destacados está INCORRETA em:
D ³RQGH precisam ser dadas as primeiras informações sobre o mundo´
(1º§) ± objeto direto
E  ³de que seus atos repercutem´ ž†  ± oração subordinada
substantiva completiva nominal
F ³0DLVXPDYH]FRUULJLUisso SRGHVHUPXLWRVLPSOHV´ ž† ± objeto direto
G  ³-i QRV DQRV  UHFHEtDPRV QD XQLYHUVLGDGH jovens´ ž†  ± objeto
direto
H  ³ que nossa economia floresce´ ž†  ± oração subordinada
substantiva objetiva direta
134. (CONSULPLAN / Advogado / Pref. St Madalena-RJ/2010)
No trecho ³TXHLQGHpende de computadores´a expressão em destaque
exerce a mesma função sintática que a expressão sublinhada em:
D ³1mRVRXFRQWUDFRORFDUHPXPFRPSXWDGRUem cada sala de aula neste
UHLQRGDVXWRSLDV´
E  ³$ HGXFDomR EHQHYROHQWH H IURX[D TXH KRMH SUHGRPLQD nas casas e
HVFRODV´
F ³6DLUGRSULPHLURJUDXWHQGRDOJXPDFRQVFLrQFLDde si´
G ³)XLSRUGH]DQRVWLWXODUGHOLQJXtVWLFDem uma faculdade particular´
H ³HHPSDUWHao desalento´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 140 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

135. (CONSULPLAN / Ana. Judiciário / TRE-RS / 2008)


³,JQRUkQFLDWmRYDVWDTXHQHODFDEHULD´a oração ± ³TXHQHODFDEHULD´±
traz uma idéia de:
a) Conseqüência.
b) Conclusão.
c) Explicação.
d) Causa
136. (CONSULPLAN / Téc. Administrativo / TRE-RS / 2008)
"...que ainda questiona o poder de nossa democracia, esta noite é a
resposta." O trecho grifado tem a mesma função sintática que o destacado
em:
a) Preserve a Mata Atlântica.
b) Faça uma cuidadosa leitura da prova.
c) Ele mora perto de um grande monumento.
d) A preservação da biodiversidade é necessária às gerações futuras.
e) Fui enganado por ambos.
137. (CONSULPLAN / Ana. Sistemas / Chesf / 2007)
Considere o seguinte trecho: ³&RP RV GLDV 6HQKRUD o leite primeira vez
FRDOKRX´ Em qual das alternativas abaixo o termo destacado apresenta a
mesma função sintática do termo sublinhado anteriormente?
D ³7RGDDFDVDHUDum corredor GHVHUWR´
E ³8PDKRUDGDQRLWHeles VHLDP´
F ³FRPRD~OWLPDOX]na varanda´
G ³¬Vsuas violetas, na janela, não lhes poupei água´
H ³1mRWHQKRbotão QDFDPLVD´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 141 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 04 ± Felipe Luccas Rosas

Gabaritos

1. LETRA D 36. LETRA B 71. LETRA B 106. LETRA E


2. LETRA B 37. CORRETA 72. LETRA D 107. LETRA B
3. LETRA D 38. LETRA A 73. CORRETA 108. LETRA B
4. INCORRETA 39. CORRETA 74. CORRETA 109. INCORRETA
5. CORRETA 40. LETRA A 75. LETRA C 110. INCORRETA
6. INCORRETA 41. INCORRETA 76. LETRA C 111. INCORRETA
7. CORRETA 42. LETRA C 77. LETRA B 112. INCORRETA
8. LETRA C 43. LETRA A 78. CORRETA 113. INCORRETA
9. LETRA E 44. LETRA C 79. INCORRETA 114. CORRETA
10. CORRETA 45. INCORRETA 80. LETRA A 115. INCORRETA
11. INCORRETA 46. INCORRETA 81. LETRA D 116. LETRA A
12. LETRA E 47. INCORRETA 82. LETRA B 117. LETRA D
13. INCORRETA 48. CORRETA 83. LETRA D 118. LETRA C
14. CORRETA 49. LETRA C 84. LETRA D 119. LETRA A
15. INCORRETA 50. LETRA E 85. CORRETA 120. LETRA A
16. CORRETA 51. LETRA A 86. LETRA E 121. LETRA E
17. INCORRETA 52. LETRA D 87. LETRA C 122. LETRA A
18. CORRETA 53. CORRETA 88. INCORRETA 123. LETRA A
19. LETRA A 54. INCORRETA 89. LETRA A 124. LETRA C
20. LETRA D 55. LETRA C 90. LETRA B 125. LETRA B
21. CORRETA 56. INCORRETA 91. LETRA D 126. LETRA B
22. CORRETA 57. INCORRETA 92. LETRA A 127. LETRA C
23. INCORRETA 58. LETRA D 93. LETRA B 128. LETRA C
24. CORRETA 59. LETRA C 94. LETRA C 129. LETRA E
25. CORRETA 60. LETRA C 95. LETRA D 130. LETRA B
26. INCORRETA 61. LETRA B 96. LETRA B 131. LETRA C
27. CORRETA 62. LETRA D 97. INCORRETA 132. LETRA A
28. LETRA C 63. INCORRETA 98. LETRA A 133. LETRA A
29. LETRA A 64. CORRETA 99. LETRA C 134. LETRA E
30. LETRA D 65. LETRA B 100. LETRA A 135. LETRA A
31. LETRA C 66. CORRETA 101. INCORRETA 136. LETRA A
32. INCORRETA 67. INCORRETA 102. LETRA A 137. LETRA B
33. INCORRETA 68. LETRA D 103. LETRA E
34. LETRA E 69. LETRA A 104. LETRA E
35. INCORRETA 70. CORRETA 105. LETRA E

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 142 de 142


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

As questões são as mais ambíguas possíveis./Estude o mais cedo possível.


³Em DSHQVR´³PHQRV´H³DOHUWD´VmRLQYDULiYHLV
Anexo ± Obrigado ± Mesmo ± Próprio ± Incluso ± Quite (variáveis)

Lista de Questões

1. (FCC / ELETROSUL / 2016) Adaptada


Uma frase escrita com clareza, correção e em conformidade com o texto é:
Há quinze anos, o Google tornou acessível o conteúdo, de dicionários e
enciclopédias, para que se tornassem de fácil acesso à todos que consultam-
lhe.
2. (FCC / ELETROSUL / 2016) Adaptada
Uma frase escrita com clareza, correção e em conformidade com o texto é:
Embora o saber não deva ser multiplicado, porém dividido, são louvável as
iniciativas daqueles que se empenham de compartilhar, aos outros, sua
sabedoria.
3. (CESPE / DPU / 2016) Adaptada
No Brasil, pode-se considerar marco da história da assistência jurídica, ou
justiça gratuita, a própria colonização do país, ainda no século XVI. O
surgimento de lides provenientes das inúmeras formas de relação jurídica
então existentes ² e o chamamento da jurisdição para resolver essas
contendas ² já dava início a situações em que constantemente as partes se
viam impossibilitadas de arcar com os possíveis custos judiciais das
demandas.
Seria mantida a correção gramatical do período caso a forma verbal ³GDYD´
(ľ.5) fosse flexionada no plural, escrevendo-se davam.
4. (FCC / TRF 3ªREGIÃO / ANALISTA JUDICIÁRIO / 2016)
A respeito da concordância verbal, é correto afirmar: Na frase "A maioria das
pessoas não frequentam o museu", o verbo encontra-se no plural por
concordar com "pessoas", ainda que pudesse, no singular, concordar com
"maioria".
5. (CESPE / SEDF / 2017)
Em ³$ PDLRULD GRV alunos que chegam à escola pública é oriunda
SUHFLVDPHQWH GHVVHV JUXSRV VRFLRHFRQ{PLFRV´ a forma verbal ³FKHJDP´
poderia ser corretamente flexionada no singular. Nesse caso, o pronome
³TXH´UHWRPDULDRQ~FOHRGRVXMHLWRGDRUDomRSULQFLSDO
6. (CESPE / Anvisa / 2016)
Ao combater a febre amarela, Oswaldo Cruz enfrentou vários problemas.
Grande parte dos médicos e da população acreditava que a doença se
transmitia pelo contato com roupas, suor, sangue e secreções de doentes.
$IRUPDYHUEDO³DFUHGLWDYD´ ľ.2) está flexionada no singular para concordar

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 79 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

FRP D SDODYUD ³SDUWH´ ľ.2), mas poderia ser substituída sem prejuízo à
correção gramatical pela forma verbal acreditavam, que estabeleceria
FRQFRUGkQFLDFRPRWHUPRFRPSRVWR³GRVPpGLFRVHGDSRSXODomR´ ľ.2).
7. (BIO RIO / Analista Contabilidade / 2016)
³8PJUXSRGHFULDQoDVHVWiDMRHOKDGR´
A afirmação adequada sobre a concordância dos termos nesse segmento é:
o sujeito ³XP JUXSR GH FULDQoDV´ permite uma dupla possibilidade de
concordância.
8. (FCC / TRF 3ªREGIÃO / ANALISTA JUDICIÁRIO / 2016)
A respeito da concordância verbal, é correto afirmar: Em "A aquisição de
novas obras devem trazer benefícios a todos os frequentadores", a
concordância está correta por se tratar de expressão partitiva.
9. (CESPE / CGE-PI / 2015) Adaptada
Aceito o convite, ele me leva a um restaurante que, apesar de simpático, me
pareceu um pouco estranho. Por que a maior parte das pessoas comia com
ar religioso e contrito?
Acerca das ideias e das estruturas linguísticas do texto, julgue o item a
seguir.
6HPSUHMXt]RSDUDDFRUUHomRJUDPDWLFDOGRWH[WRDIRUPDYHUEDO³FRPLD´
ľ2) poderia ser flexionada no plural.
10. (FCC / TRT-SC / 2013)
As normas de concordância estão plenamente respeitadas na frase: A
maior parte das ondas sonoras que perpassa o nosso caminho (celulares,
rádios, TVs etc.) é inaudível para os ouvidos humanos.
11. (COPESE / UFPI / Agente Pref. Timon-MA / 2016)
Considerando as relações de concordância verbal presentes no texto, é
CORRETO afirmar: Na oração ³D PDLRULD GDV SHVVRDV QmR VDEHP GHVWH
SUREOHPD´ o verbo continuaria no plural se o sujeito fosse apenas ³D
PDLRULD´
12. (CESPE / TRE-GO / 2015)
Em 1894, na primeira eleição para presidente da República, votaram 2,2%
da população. Tudo indica que, apesar de a República ter abolido o critério
censitário e adotado o voto direto, a participação popular continuou sendo
muito baixa em virtude, principalmente, da proibição do voto dos
analfabetos e das mulheres.
Julgue o item que se segue, acerca das estruturas linguísticas do texto I.
O trecho ³YRWDUDP  GD SRSXODomR´ ľ.2-3) poderia, sem prejuízo
gramatical ou de sentido para o texto, ser reescrito da seguinte forma: 2,2%
da população votou.
13. (CESPE / SEDF / 2017)
A construção do pensamento ² e sua exposição de forma clara e persuasiva
² constitui um dos objetivos mais perseguidos por todo aquele que almeja

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 80 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

sucesso na vida profissional e, muitas vezes, pessoal.


A respeito dos aspectos linguísticos do texto, julgue o item que se segue.
A VXEVWLWXLomR GD H[SUHVVmR ³todo aquele´ SRU todos manteria o sentido
original e a correção gramatical do texto.
14. (CESPE / DIPLOMATA / 2004)
Atendendo-se às prescrições gramaticais, o segmento ³6RPRV QyV TXH DV
IDEULFDPRV´poderia ser substituído por ³6RPRV QyVTXHPDVIDEULFD´.
15. (CESPE / Médico da PM de Sergipe / 2006)
Na passagem ³3RUTXHQmRIXLHXTXHFULHLD0LFURVRIW"´o segundo ³TXH´
pode ser corretamente substituído por quem, sem modificações das formas
verbais.
16. (CESPE / TCE-SC / 2016)
Além disso, a OCDE compreende um sistema de integridade como um
conjunto de arranjos institucionais, de gerenciamento, de controle e de
regulamentações que visem à promoção da integridade e da transparência
e à redução do risco de atitudes que violem os princípios éticos.
Ainda com relação a aspectos linguísticos do texto, julgue o item
subsequente.
A coesão e a correção gramatical do trecho ³HjUHGXomRGRULVFRGHDWLWXGHV
TXHYLROHPRVSULQFtSLRVpWLFRV´ O4) seriam mantidas caso a forma verbal
³YLROHP´ fosse flexionada no singular, passando, então, a concordância a
restringir-se ao termo ³ULVFR´
17. (FGV / MPE RJ / Analista Processual / 2016) Adaptada
³(VVDVSHVVRDVVRIUHPFRPDVJUDQGHVGLVWkQFLDVGRVORFDLV GHUHVLGrQFLD
com os centros comerciais e os locais onde trabalham, uma vez que a
esmagadora maioria dos habitantes que sofrem com esse processo são
WUDEDOKDGRUHVFRPEDL[RVVDOiULRV´
Sobre os componentes sublinhados nesse segmento do texto, julgue o item:
A forma verbal sofrem deveria ser substituída pela forma correta sofre
18. (FCC / TRT 24ª região / Analista / 2017)
O verbo indicado entre parênteses deverá flexionar-se de modo a concordar
com o elemento sublinhado na frase:
a) À maioria dos homens (parecer) não interessar o prazer dos dias que
estão decorrendo.
b) Não (convir) a nenhuma criatura antecipar os males que lhe reserva o
futuro.
c) Aos homens sábios não (atormentar) nos dias do presente a
infelicidade de um futuro tormentoso.
d) Sempre há aqueles a quem (caber) sofrer por antecipação o futuro
sombrio que os aguarda.
e) São numerosas as pessoas cuja obsessão as (aprisionar) em falsas
expectativas de felicidade.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 81 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

19. (FCC /SEFAZ-PI / 2015) Adaptada


Está inteiramente correta a redação deste livre comentário sobre o texto
³3RUYH]HVpSRVVtYHODWULEXLUjVSDODYUDVGHXPDIUDVHVLPSOHVRXPHVPR
EDQDOXPVHQWLGRRXWURTXHHODVDFDEDPSRUVXJHULUDRVLPDJLQRVRV´
20. (FCC / TRT / Oficial de Justiça / 2016) Adaptada
As exigências quanto à concordância verbal estão plenamente atendidas
na frase: Couberam às mulheres americanas, cansadas de se submeterem
aos machistas, travar duras lutas contra o assédio sexual e outras práticas
que as vitimam.
21. (FGV / TJ-RJ / 2014)
Na frase ³7RGRVTXHUHPRVYLYHUHPOLEHUGDGH´o exemplo de concordância
verbal em ³7RGRVTXHUHPRV´se repete na seguinte frase:
a) Não são criativos todos os brasileiros;
b) Os candidatos estamos preocupados com a prova;
c) V. Ex a . parece entristecido;
d) Todos nós desejamos a liberdade;
e) A gente não deseja mais viver.
22. (CESPE / TER-PI / 2016)
A identificação das bases eleitorais de um candidato é relevante na medida
em que para elas se direciona a maior parte da atividade desse candidato
como político. A importância atribuída às bases, no caso do Poder Executivo
estadual, decorre do fato de que a sua manutenção significa maiores
possibilidades de conquistar uma reeleição. A verificação da concentração ou
da dispersão geográfica da votação no estado para o candidato eleito é
importante para identificar as localidades onde ele possui ou não força
política.
Para o entendimento da concentração da votação em determinado lugar, é
necessário abordar a teoria do contextualismo geográfico, segundo a qual o
comportamento dos eleitores é influenciado pelo ambiente sociogeográfico
² seja pelas redes de interação social existentes, seja pela semelhança de
experiências às quais os habitantes de uma região estão submetidos.
Segundo essa linha de pensamento, a política não pode ser compreendida
desconsiderando-se o contexto no qual ocorre e as condições em que se
encontram os indivíduos. Em oposição a essa perspectiva está a teoria da
escolha racional, que considera o indivíduo o ator racional que procura
maximizar seus benefícios agindo de acordo com seu interesse individual.
Assim, entende-se que os indivíduos são mais afetados por questões
próximas à sua realidade do que por questões gerais como a ideologia,
estando as pessoas com realidades semelhantes ² o que é mais comum
quando vivem próximas geograficamente ² predispostas, no cenário
eleitoral, a votar também de modo semelhante. Em suma, deve-se atentar
para o fato de que a existência de referências comuns entre os indivíduos
pode interferir em sua ação política, direcionando-a em um mesmo sentido.
Esse compartilhamento de referências pode advir tanto da interação social

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 82 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

entre os indivíduos quanto do pertencimento a determinado contexto


geográfico.
Ainda com relação aos aspectos linguísticos do texto Geografia eleitoral e
manutenção do poder:..., assinale a opção correta.
$  $ IRUPDO YHUEDO ³RFRUUH´ ľ5) foi empregada de forma impessoal no
texto.
% $IRUPDYHUEDO³SRGH´ ľ25) está flexionada no singular por concordar
FRP³RIDWR´ ľ4).
&  2 WUHFKR ³WDQWR GD LQWHUDomR VRFLDO HQWUH RV LQGLYtGXRV TXDQWR GR
pertenciPHQWRDGHWHUPLQDGRFRQWH[WRJHRJUiILFR´ ľ26-27) exerce função
de adjunto adverbial na oração em que ocorre.
' 2WUHFKR³DPDLRUSDUWHGDDWLYLGDGHGHVVHFDQGLGDWRFRPRSROtWLFR´ ľ.
2- H[HUFHDIXQomRGHFRPSOHPHQWRGDIRUPDYHUEDO³GLUHFLRQD´ ľ .
( 2WHUPR³$LPSRUWkQFLDDWULEXtGDjVEDVHV´ ľ3) funciona como sujeito
GDIRUPDYHUEDO³GHFRUUH´ ľ4).
23. (FCC / AUDITOR / TCE-AM / 2015) Adaptada
As regras de concordância prescritas pela gramática normativa estão
respeitadas em: É de conhecimento geral que Angola detêm laços históricos
e culturais profundos com o Brasil, que, se levado em conta, trará impactos
sobre nossa brasilidade e maturidade para lidarmos com a nossa própria
diversidade cultural.
24. (IBFC / MGS / TÉCNICO CONTÁBIL / 2016)
Tem-VH ³Ki FDVDV FRP ODUHLUD TXH VH mantêm IULDV´ Nesse fragmento,
percebe-se que o acento da forma verbal em destaque deve-se à
concordância com a seguinte palavra:
D ³Ki´
E ³FDVDV´
F ³ODUHLUD´
G ³IULDV´
25. (ESAF / ANAC / Técnico Administrativo / 2016)
Assinale certo ou errado se o trecho está inteiramente correto quanto às
regras de concordância e regência da modalidade escrita formal da língua
portuguesa.
Essa atitude é tambpm fundamental no planejamento do setor, como no
caso dos estudos de demanda por aeroportos, por exemplo, que atualmente
nmo pode prescindirem da variivel preço.
26. (CESPE / TCE-PA / 2016)
É por meio dessas audiências que o responsável pela decisão tem acesso às
diversas opiniões sobre a matéria debatida e abre a oportunidade para as
pessoas que irão sofrer os reflexos da deliberação se manifestarem antes de
seu desfecho.
Em relação aos elementos linguísticos do texto, julgue o item a seguir.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 83 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

A forma verbal ³PDQLIHVWDUHP´está flexionada no plural para concordar com


³DVSHVVRDV´
27. (ESAF / Analista de Finanças e Controle / STN / 2013)
O imposto é invisível, mas não é leve. Muitas pessoas, por ser isentas do
imposto de renda, pensam que não pagam tributos.
Provoca-se incorreção gramatical ao fazer a substituição de ³VHU LVHQWDV´
por serem isentas.
28. (CESPE / Diplomata / 2011)
Seriam mantidos o sentido e a correção gramatical do texto se os infinitivos
flexionados fossem substituídos pelas respectivas formas do infinitivo não
flexionado no segmento ³)LFDPRV D REVHUYDU R MDUGLP DV JRWDV D
evaporarem, as lesmas a prepararem os corpos para novas caminhadas. O
UHFRPHoDUGDVFRLVDV´
29. (CESPE / Auditor de Contas Públicas / CGE-PB / 2008)
Nessa acepção, razão e verdade deixam de ser valores absolutos para se
transformarem em valores temporariamente válidos.
É obrigatório o emprego do infinitiYR IOH[LRQDGR ³WUDQVIRUPDUHP´ SRUTXH
seria gramaticalmente incorreto seu emprego na forma não-flexionada:
transformar.
30. (CESPE / SEDF / 2017)
A maioria dos alunos que chegam à escola pública é oriunda precisamente
desses grupos socioeconômicos. E há, entre nossas crenças pedagógicas,
um pressuposto de que cabe à escola pública contribuir, pela oferta de
educação de qualidade, para favorecer, mesmo que indiretamente, uma
melhor redistribuição da renda nacional.
O verbo haver foi empregado como sinônimo de existir. Embora esses
verbos tenham sentido semelhante, a substituição de um pelo outro no texto
PRGLILFDULDDVUHODo}HVVLQWiWLFDVHQWUHRYHUERHRWHUPR³XPSUHVVXSRVWR´.
31. (FCC / AUDITOR / TCE-AM / 2015) Adaptada
As regras de concordância prescritas pela gramática normativa estão
respeitadas em: O intuito era podermos, no contexto brasileiro, construirmos
novas narrativas para extrapolarmos categorias arcaicas de se pensarem a
África, fundando, assim, diferentes modos de ver.
32. (FCC / TRT±9ª REGIÃO / ANALISTA / 2016)
Consideradas as normas de concordância verbal, a frase em que estão
plenamente respeitadas é: Devem haver explicações para a escultura de
Picasso, embora de reconhecido valor artístico, não ter sido reunida com
frequência.
33. (Vunesp / TJM-SP / 2017)
A concordância está de acordo com a norma-padrão da língua na frase:
a) Muito antes de haver história, já existia seres humanos.
b) Animais bastante similares aos humanos modernos podiam ser

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 84 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

encontrado por volta de 2,5 milhões de anos atrás.


c) Na África Oriental de 2 milhões de anos atrás, certas características
humanas familiares poderiam ser muito bem observadas.
d) Esses humanos arcaicos competiam por status e poder, assim como
ocorriam com os chimpanzés, os babuínos e os elefantes.
e) Eles próprios não havia de suspeitar que seus descendentes um dia
viajariam à Lua.
34. (FCC / TRF-3ªREGIÃO / ANALISTA JUDICIÁRIO / 2016)
A respeito da concordância verbal, é correto afirmar: Na frase ³Hão de se
garantir as condições necessárias à conservação das obras de arte´, o verbo
³haver´ deveria estar no singular, uma vez que é impessoal.
35. (FCC / TRF-3ªREGIÃO / ANALISTA JUDICIÁRIO / 2016)
A respeito da concordância verbal, é correto afirmar: Em ³Existe atualmente,
no Brasil, cerca de 60 museus´, a concordância está correta, uma vez que o
núcleo do sujeito é ³cerca´.
36. (CESPE / FUNPRESP / 2016) Adaptada
³Mas ele nunca errava, e já nem havia mais o que errar, uma vez que não
havia mais dúvidas´
A forma verbal ³KDYLD´ em ³QmR KDYLD PDLV G~YLGDV´, poderia ser
corretamente substituída por existia.
37. (CESPE / MTE / 2014) Adaptada
Há ainda outros mitos que fazem parte do comportamento do brasileiro.
Entre eles, destacam-se o conceito de que, para ser investidor, é preciso ter
muito dinheiro disponível e a ideia de que os produtos existentes no mercado
financeiro são muito complexos.
Julgue o item subsequente, referente às ideias e aos aspectos linguísticos do
texto acima.
A forma verbal ³+i´SRGHULDVHUVXEVWLWXtGD SRU Existe sem que houvesse
prejuízo para a correção gramatical do período.
38. (CESPE / Ag. Adm. PF / 2014) Adaptada
Pôde-se constatar que, em outras partes do mundo, fenômenos sociais
semelhantes também ocorreram. Lá como cá, diferentes tipos de ação
atingiram todo o grupo social, gerando vítimas e danos materiais. Nem
sempre a intervenção das forças do Estado foi suficiente para evitar
prejuízos.
Considerando as ideias e as estruturas linguísticas do texto, julgue o item.
Sem prejuízo para o sentido e a correção gramatical do texto, o trecho
³3{GH-VHFRQVWDWDU  RFRUUHUDP´poderia ser assim reescrito: Supôs-se
que também ocorreu, em outros países do mundo, movimentos sociais
análogos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 85 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

39. (FCC / TRT±14ª / Oficial de Justiça / 2016) Adaptada


As exigências quanto à concordância verbal estão plenamente atendidas
na frase: É comum que aos homens ocorra estar no exercício de um direito
quando, em suas práticas amorosas, impõem às mulheres o que as humilha
e as desonra.
40. (CESPE / TC-DF / 2014) Adaptada
Empossado na prefeitura carioca, Negrão de Lima arregalou os olhos quando
os técnicos em urbanismo informaram-lhe que havia oito milhões de ratos
na cidade3HUJXQWRX³&RPRpTXHYRFrVFRQWDUDP"´
Julgue o item a seguir, relativo a aspectos gramaticais e ideias desenvolvidas
no texto acima.
Uma forma correta de reescrita do trecho iniciado pela conjunção temporal
³TXDQGR´ O é a seguinte: ao ser informado pelos técnicos em urbanismo
que existia oito milhões de ratos na cidade do Rio de Janeiro.
41. (CESGRANRIO / UNIRIO / PEDAGOGO / 2016)
A concordância verbal está plenamente adequada à norma-padrão no
seguinte período:
a) Fazem 15 anos que o escritor encontrou o engraxate.
b) Deve haver muitos engraxates pelos aeroportos do Rio.
c) Deseja melhores oportunidades de trabalho os brasileiros.
d) Muitos de nós quer viver sob condições melhores.
e) Cada um de nós devem ter consciência do seu valor.
42. (MPE-SC / Promotor de Justiça / 2016)
³Deve haver muitas pessoas interessadas neste parecer.´

A locução verbal Deve haver poderia ser substituída por Devem existir e a
frase continuaria gramaticalmente correta.
43. (FCC / AUDITOR / TCE-AM / 2015) Adaptada
As regras de concordância prescritas pela gramática normativa estão
respeitadas em: Tratam-se de regiões praticamente inexploradas pelas
pesquisas acadêmicas recentes, apesar de ali haverem ocorrido alguns dos
principais episódios para o desenvolvimento econômico da Angola
contemporânea.
44. (FCC / TRT 24ª / Técnico / 2017) Adaptada
A frase abaixo está escrita em conformidade com a norma -padrão da
língua:
A cultura e os costumes de um povo representa aspectos sócio-culturais
que tendem a ser reproduzidas pelos seus membros em geral e passadas
a seus decendentes, geração à geração.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 86 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

45. (FCC / TRF-3ª / TÉC. INFORMÁTICA / 2016) Adaptada


A frase cuja redação está inteiramente correta é: Londres e Barcelona
estão entre as cidades que mais destaca-se em termos de inteligência, com
avançados centros de operação de dados.
46. (FCC / TRT-20ª / Técnico Judiciário / 2016)
³$ILQDODOLWHUDWXUDGHFRUGHOpH[FHOHQWHSDUDDWUDQVIRUPDomRGDVRFiedade
em uma realidade onde exista PDLVHTXLGDGHHUHVSHLWRSHODGLYHUVLGDGH´
A respeito do verbo sublinhado acima, afirma-se corretamente: pode ser
VXEVWLWXtGRSHODIRUPD³H[LVWDP´VHPSUHMXt]RSDUDDFRUUHomR
47. (CESPE / DIPLOMATA / 2016) Adaptada
Acerca das relações semântico-sintáticas e do vocabulário, julgue (C ou E) o
item seguinte.
Na oração que inicia o segundo parágrafo: ³Torna a trazer o assunto à baila
o aparecimento e grande vendagem de Maíra, romance de Darcy Ribeiro.´ o
verbo concorda com o primeiro núcleo do sujeito posposto, concordância
verbal abonada pela gramática normativa.
48. (FCC / AUDITOR / TCE-AM / 2015) Adaptada
As regras de concordância prescritas pela gramática normativa estão
respeitadas em: É sabido que o desconhecimento e a quase ausência de
conteúdos curriculares sobre a África e as culturas africanas no Brasil
contribui para a disseminação da intolerância e dos conflitos raciais.
49. (CESPE / MPOG / 2012) Adaptada
³2 DXPHQWR GD SRSXODomR R FUHVFLPHQWR HFRQ{PLFR H D VRILVWLFDção das
relações sociais requerem mais serviços públicos, de maior qualidade e
FUHVFHQWHFRPSOH[LGDGH´
Julgue o próximo item, a respeito da organização das ideias e das estruturas
linguísticas do texto acima.
A flexão de plural em ³requerem´ MXVWLILFD-se pelo emprego do plural em
³relações sociais´.
50. (CESPE / TRE-RJ / 2012) Adaptada
Sempre se soube que um dos principais entraves ao crescimento do Brasil é
o gargalo educacional. Novas pesquisas, porém, revelam que o problema é
muito mais grave do que se supunha. A mais recente, elaborada pelo
Instituto Paulo Montenegro e pela ONG Ação Educativa, mostrou que 38%
GRV HVWXGDQWHV GR HQVLQR VXSHULRU QR SDtV VLPSOHVPHQWH ³QmR GRPLQDP
KDELOLGDGHVEiVLFDVGHOHLWXUDHHVFULWD´
Julgue o item que se segue, relativo às ideias e às estruturas linguísticas do
texto acima.
A forma verbal ³mostrou´ está no singular porque concorda com a expressão
³Instituto Paulo Montenegro´.
51. (CESPE / Auditor de Controle Externo / 2010) Adaptada
O modelo linguístico comum admite variações individuais, até certo ponto.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 87 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

Mas, quando essa individualização vai longe demais, a língua perde sua
função de meio de comunicação dentro do grupo. Entre outros exemplos,
citemos a formação da consciência moral, das modalidades de controle de
pulsões e afetos numa dada civilização, ou o dinheiro e o tempo. A cada um
deles correspondem maneiras pessoais de agir e sentir, um habitus social
que o indivíduo compartilha com outros e que se integra na estrutura de sua
personalidade.
No que se refere à organização das ideias e à estrutura do texto acima,
julgue o item.
Na linha 6, a flexão de plural em ³correspondem´ mostra que, pela
concordância, se estabelece a coesão com ³maneiras´PDVVHULDLJXDOPHQWH
correto e coerente estabelecer a coesão com ³cada um´, enfatizando este
termo pelo uso do verbo no singular: corresponde.
52. (Comperve / Contador / 2014)
Ensinar e aprender trata-se de um processo relacional que vai além dos
métodos e das tecnologias. Diz essencialmente respeito a relações humanas.
Não é entretenimento ou diversão. Tampouco é sofrimento. Envolve escutar,
avaliar, refletir e praticar. Pode ser penoso, às vezes, mas deve sempre
recompensar estudantes e professores. Pode usar novos métodos e novas
tecnologias, mas depende essencialmente da construção de um palco para
interação coletiva.
Se substituíssemos a expressão em destaque pelo verbo ser, este seria
flexionado no
a) plural, porque o sujeito é composto por duas palavras de sentidos
diferentes.
b) plural, porque o sujeito é composto por dois verbos no infinitivo, sem
determinantes e com oposição de sentidos.
c) singular, porque o sujeito é composto por duas palavras de sentidos
opostos.
d) singular, porque o sujeito é composto por dois verbos no infinitivo, sem
determinantes e sem oposição de sentidos.
53. (FGV / COMPESA / 2014)
³(XHRFRPSXWDGRUMDPDLVVHUtDPRVtQWLPRV´
Assinale a opção que indica a frase que não segue as regras de
concordância verbal da norma culta.
a) Tu e ele jamais serão íntimos.
b) Tu e ele jamais sereis íntimos.
c) Você e eu jamais seremos íntimos.
d) Vocês e ele jamais sereis íntimos.
e) Ela e ele jamais serão íntimos.
54. (CESPE / ANATEL / 2014)
A solicitação de portabilidade ou a demonstração da intenção de trocar os

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 88 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

serviços pelos oferecidos por uma concorrente que ofereça condições


melhores têm-se mostrado boas estratégias, visto que as empresas
comumente dispõem de vantagens para não perder seus consumidores.
Considerando as ideias e estruturas do texto, julgue o item seguinte.
2HPSUHJRGDIRUPDYHUEDO³têm´QDSHVVRDGRSOXUDOMXVWLILFD-se pela
FRQFRUGkQFLD FRP VXMHLWR FRPSRVWR XQLGR SHOD FRQMXQomR ³ou´ GH YDORU
inclusivo.
55. (FGV / TJ-RJ / 2014)
Escovar os dentes ou se barbear com a torneira fechada geram economia de
79 litros.
Na frase, o verbo está no plural por concordar com o sujeito composto
³HVFRYDURVGHQWHVRXVHEDUEHDU´DIUDVHDEDL[RHPTXHDIRUPDYHUEDO
deveria estar no singular é
a) deixar a torneira aberta ou fechá-la fazem muita diferença na conta
mensal de água;
b) lavar o carro com mangueira ou tomar banhos prolongados aumentam
a despesa doméstica;
c) os adultos ou as crianças podem colaborar na economia doméstica;
d) o desperdício de água ou o desmatamento mostram descuido com o
futuro do planeta;
e) cuidar dos encanamentos ou preocupar-se com vazamentos
demonstram consciência cidadã.
56. (FCC / AUDITOR FISCAL / SEFAZ-PIAUÍ / 2015)
³1mR IRVVH SHODV LQIRUPDo}HV GHVFuidadas de segunda ou terceira mão
colhidas por viajantes ou funcionários em postos remotos, estes espaços
EUDQFRVWHULDPVLGREHPPDLVYDVWRVGRTXHGHIDWRRHUDP´
A frase acima respeita as orientações da gramática normativa no que se
refere à concordância verbal e nominal, assim como ocorre com a seguinte
frase:
a) Se não fosse, naquela época, as ações de certos viajantes, muito do que
se sabe hoje permaneceria incógnito.
b) Fosse qual fossem as informações prestadas por andarilhos, tiveram todas
sua utilidade para o conhecimento do mundo do século XVIII.
c) Fossem quais fosse as intenções dos informantes, o fato é que aquilo que
notificaram recebeu registro, ainda que as notícias fossem descuidadas.
d) Caso fosse registrado com mais rigor as informações dos caçadores, e
também se elas fossem mais detalhadas, talvez mais se soubesse hoje sobre
o conhecimento da época acerca dos rios da África.
e) Quaisquer que fossem as circunstâncias, mais favoráveis, ou menos
favoráveis, cada habitante sempre enfrentava algo do mistério sobre as
cadeias de montanhas que lhe eram próximas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 89 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

57. (MPE-SC / Promotor de Justiça / 2016)


Observe as frases abaixo.
D ³7XGRLVVRVmRLQYHUGDGHV´Gisse o promotor.
b) Hoje são 20 de junho.
c) Os culpados pela elaboração do trabalho somos sempre nós.
Todas as frases estão corretas, pois a concordância do verbo ser pode
ocorrer entre o verbo e o predicativo do sujeito.
58. (COMPASS / PREFEITURA DE CARPINA / 2016)
A concordância verbal está correta em todas as alternativas, exceto em:
a) Qual de vós apoiará essa atitude?
b) Campinas são uma cidade encantadora.
c) Mais de um já me avisou do acidente ocorrido na estrada.
d) Um conselho, uma palavra amiga era suficiente para acalmá-lo.
e) As nuvens pareciam chorar.
59. (PREF. DO RIO DE JANEIRO / ENFERMEIRO / 2016)
De acordo com a norma padrão da língua, está correta a concordância do
verbo no segmento ³DPDLRULDGRVVREUHYLYHQWHVVHDGDSWDUDDVXDVQovas
YLGDV FRP PXLWR PDLV VXFHVVR´ É também correta a concordância do
verbo na seguinte frase:
a) Quantos de nós teriam sobrevivido nas mesmas cirscunstâncias?
b) Quem haveria de ser aqueles refugiados?
c) Mais de cem pessoas respondeu afirmativamente à pergunta.
d) Os Estados Unidos recebeu muitos judeus após a guerra.
60. (FGV / TJ-SC / 2015)
Numa notícia sobre locais gastronômicos do Rio de Janeiro, a revista rioshow
SXEOLFDRVHJXLQWHWH[WR³6RXPDLVIDPLOLDUL]DGDFRPRVSmHVDVWRUWDVH
os doces dessa casa que é um mix de pâtisserie, padaria e café. As tortas
alemães são o forte dali, uma tradição da família que comanda o espaço."
O segmento desse texto que contraria a norma culta de língua portuguesa
é:
D ³6RXPDLVIDPLOLDUL]DGDFRPRVSmHV
E ³FRPRVSmHVDVWRUWDVHRVGRFHVGHVVDFDVD
F ³TXHpXPPL[GHSkWLVVHULHSDGDULD e café";
G ³$VWRUWDVDOHPmHVVmRRIRUWHGDOL
H ³XPDWUDGLomRGDIDPtOLDTXHFRPDQGDRHVSDoR
61. (Cesgranrio / ANP / 2016)
Considere-VHHVWDSDVVDJHPGR7H[WR³0DVHVVDYLDJHPGLiULDPHWRUQDYD
uma criança completa de alegria.´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 90 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

Há um desvio de concordância na seguinte reescritura desse trecho do


Texto:
a) Mas essas viagens diárias enchiam de alegria aquela criança.
b) Como me tornava uma criança completa de alegria essa viagem diária!
c) Mas essas viagens diárias me tornavam uma criança completa de alegria.
d) Essa viagem diária me tornava uma criança, completo de alegria.
e) Eu me tornava uma criança completa de alegria por causa dessa viagem
diária.
62. (FGV / CODEBA / 2016)
Assinale a opção em que a concordância entre os termos está incorreta.
a) As várias eras, éons, períodos, épocas e idades.
b) Os vários períodos, éons, eras, épocas e idades.
c) Os éons, eras, períodos, épocas e idades várias.
d) As várias períodos, éons, eras, épocas e idades.
e) O éons, eras, épocas, períodos e idades vários.
63. (FGV / PREF. DE OSASCO-SP / 2014) ADAPTADA
³2V SDJDPHQWRV GDV *XLDV GH UHFROKLPHQWR GH LPSRVWRV WD[DV H
contribuições devem ser feitas pela própria empresa, nunca deixe para
serem pagos pelos responsáveis pela contabilidade, essa é uma atribuição
da empresa".
De acordo com as estruturas linguísticas do texto, julgue o item: nesse
segmento do texto há um problema de correção, que é: A concordância
HUUDGDGH³IHLWDV
64. (FGV / CONDER / 2013)
Assinale a frase que mostra uma dupla possibilidade de concordância.
D ³RVJUDQGHVFHQWURVXUEDQRVVHWRUQDUDPROXJDUSULYLOHJLDGR´
E ³(VVDVIRUDPDOJXPDVGDVUD]}HV´
F ³GHVXDSRSXODomRFRQFHQWUDGDQDVFLGDGHV´
G ³HPRGHUQL]DURVLQVWUXPHQWRVGHVHJXUDQoD´
H ³DJHVWmRGDVFLGDGHVUHFHEHXSRXFRHVWXGR´
65. (FGV / CÂMARA MUNICIPAL DO RECIFE / 2014)
³HPSUHJDUPpWRGRVEDVWDQWHYDULDGRV´a frase abaixo em que o vocábulo
³EDVWDQWH´GHYHVHUFRORFDGRQRSOXUDOp
a) Eles eram bastante amigos meus.
b) Choveu bastante nas férias.
c) Durante dias eles trabalharam bastante.
d) Eles se sentiram bastante fortes.
e) Bastante brasileiros emigraram para a Europa.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 91 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

66. (FCC ± TRF 3ª ± TÉCNICO INFORMÁTICA/2016) Adaptada


A frase cuja redação está inteiramente correta é: São necessários viabilizar
projetos de cidades inteligentes, amparados em políticas públicas que
salvaguardam os dados abertos dos cidadãos.
67. (SAAEB / Engenheiro de Segurança / 2016)
Quanto à concordância nominal, preencha as lacunas das frases e assinale a
alternativa CORRETA:
Era talvez meio-dia e «««««««TXDQGRIRUDDFKDGR
'HFHSomRp««««««««««SDUDIRUWDOHFHURVHQWLPHQWRGHUHDOLGDGH
$SHVDU GD VXSHUSRSXODomR GR DORMDPHQWR KDYLD TXDUWRV «««««««««
para os homens.
2VGRFXPHQWRVGRVDOXQRVVHJXLUDP«««««««««jVILFKDVGHLQVFULomR
As fisionRPLDV GRV KRPHQV HUDP DV PDLV GHVRODGDV ««««««««««
naquele momento.
a) meia ± bom ± bastantes ± anexos ± possíveis.
b) meio ± bom ± bastantes ± anexo ± possível.
c) meia ± boa ± bastante ± anexo ± possível.
d) meio ± boa ± bastante ± anexos ± possível.
68. (CESPE / STJ / 2015)
Consta do preâmbulo da Constituição Federal que a justiça é um dos valores
supremos da sociedade, tal qual a harmonia social e a liberdade. Nos demais
artigos da Carta Magna, esse termo costuma vir associado à ideia de justiça
social. Assim, o primeiro inciso do artigo terceiro da Constituição estabelece
que a construção de uma sociedade que seja justa é um objetivo
fundamental da República Federativa do Brasil. Ao circunscrever a justiça no
espaço da sociedade, o texto constitucional estabelece, em síntese, que a
promoção da justiça na sociedade é um fim do Estado brasileiro.
Em relação às ideias e às estruturas linguísticas do texto A justiça social
como norma constitucional, julgue o seguinte item.
Na linha 2, sem prejuízo para a correção gramatical, a expressão ³WDOTXDO´
poderia ser flexionada no plural, para concordar com ³YDORUHVVXSUHPRV´
69. (Prefeitura Lauro Muller / FAEPESUL / 2016)
Em somente uma das alternativas abaixo a concordância nominal NÃO está
de acordo com as regras nominais. Indique-o.
a) Cumprimento de menos horas extras.
b) Ponto de vista e argumentação sensatos.
c) Documentos anexos ao processo.
d) Leitura de bastante livros.
e) Crimes de leso-patriotismo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 92 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

70. (Prefeitura Nova Veneza / Psicólogo / FAEPESUL / 2016)


Sobre as regras da concordância nominal nas frases:
I. Pediu trezentos gramas de salsicha importada.
II. Havia ainda bastantes frascos contaminados sobre a mesa do laboratório.
III. Elas parecem mesmas interessadas em resolver os conflitos entre o
grupo de funcionários.
IV. Eu, felizmente, já estou quites com o imposto de renda.
Sobre essas frases, podemos afirmar que:
a) apenas I e II estão corretas.
b) apenas II e IV estão corretas.
c) apenas a frase I está correta.
d) todas estão corretas.
e) todas estão incorretas.

Mais questões comentadas

71. (CONSULPLAN / Pref. de Cascavel / Téc. Inform. / 2016)


³+iIDPtOLDVHPVLWXDo}HVGHULVFRHIUDJLOLGDGH"´ ž† $FRQFRUGkQFLDGR
verbo haver foi corretamente empregada no trecho em evidência. Assinale
a alternativa em que a concordância em relação ao mesmo verbo está
INCORRETA.
a) Houve muitas acusações às famílias.
b) Na reunião escolar haviam muitas famílias.
c) Na competição entre família e escola não há titulares.
d) As famílias e o estado se houveram bem durante a reunião.
e) O estado e a escola já haviam se manifestado em relação às famílias.
72. (CONSULPLAN / CREA-RJ / Téc. Administrativo / 2011)
Quanto à concordância verbal, assinale a afirmativa correta:
a) Minas Gerais revelaram grandes escritores.
b) Tratava-se de assuntos importantes.
c) Ainda não chegou os relatórios.
d) Os responsáveis são nós.
e) Aluga-se casas.
73. (CONSULPLAN / CREA-RJ / Téc. Administrativo / 2011)
Assinale a afirmativa gramaticalmente correta:
a) Derrepente louvamos os amigos e perdoamos os inimigos.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 93 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

b) Pediu para mim levar o dicionário para a ilha deserta.


c) Fazem dois dias que cultivamos o silêncio.
d) Vão anexas ao dicionário várias fotografias.
e) Ela mesmo entregou o dicionário.
74. (CONSULPLAN / Psicólogo / 2016)
A importância da família estruturada
Um levantamento do Ministério Público de São Paulo traz um dado revelador:
dois terços dos jovens infratores da capital paulista fazem parte de famílias que não
têm um pai dentro de casa. Além de não viverem com o pai, 42% não têm contato
algum com ele e 37% têm parentes com antecedentes criminais.
Ajudam a engrossar essas estatísticas os garotos Waldik Gabriel, de 11 anos,
morto em Cidade Tiradentes, Zona Leste de São Paulo, depois de fugir da Guarda
Civil Metropolitana, e Ítalo, de 10 anos, envolvido em três ocorrências de roubo só
em 2016, morto pela Polícia Militar no início de junho, depois de furtar um carro na
Zona Sul da cidade. O pai de Waldik é caminhoneiro e não vivia com a mãe. O de
Ítalo está preso por tráfico. A mãe já cumpriu pena por furto e roubo.
É certo que um pai presente e próximo ao filho faz diferença. Mas, mais que a
figura masculina propriamente dita, faz falta uma família estruturada,
independentemente da configuração, que dê atenção, carinho, apoio, noções de
continência e limite, elementos que protegem os jovens em fase de
desenvolvimento.
A mãe e a avó, nessa família brasileira que cresce cada vez mais matriarcal,
desdobram-se para tentar cumprir esses requisitos e preencher as lacunas, mas
VmR³DWURSHODGDV´SHODURWLQDGXUD0XLWDVYH]HVQmRWrPWHPSRHQHUJLDGLQKHLUR
e voz para lidar com esses garotos e garotas que crescem na rua, longe da escola,
em bairros sem equipamentos de esporte e cultura, próximos de amigos e parentes
que podem estar envolvidos com o crime.
A criança precisa ter muita autoestima e persistência para buscar nesse
horizonte nebuloso um projeto de vida. Sem apoio emocional, sem uma escola que
estimule seu potencial, sem ter o que fazer com seu tempo livre, sem enxergar
uma luz no fim do túnel, ela fica muito mais perto da droga, do tráfico, do delito,
da violência e da gestação na adolescência. É nessa mesma família, sem pai à vista,
de baixa renda, longe da sala de aula, nas periferias, que pipocam os quase 15%
das jovens que são mães na adolescência, taxa alarmante que resiste a baixar nas
regiões mais carentes.
E o que acontece com essa menina que engravida porque enxerga na
maternidade um papel social, uma forma de justificar sua existência no mundo?
Iludidas com a perspectiva de estabilizar um relacionamento (a família estruturada
que não têm?), elas ficam, usualmente, sozinhas, ainda mais distantes da escola e
de seu projeto de vida. O pai da criança some no mundo, e são elas que arcam com
o ônus do filho, sobrecarregando um lar que já vivia no limite. Segue-se um ciclo
que parece não ter fim.
Sem políticas públicas que foquem nessa família mais vulnerável, no apoio
emocional e social para esses jovens, em uma escola mais atraente, em projetos
de vida, em alternativas de lazer, a realidade diária na vida desses jovens
continuará a ser a gravidez na adolescência, a violência e a criminalidade.
(Jairo Bouer, 11/07/2016. Disponível em: http://epoca.globo.com/colunas-e-blogs/jairo-
bouer/noticia/2016/07/importancia-da-familiaestruturada.html.)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 94 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

Considerando as estruturas linguísticas apresentadas nos trechos a seguir


selecionados, assinale o comentário referente em que há correção.
D $LQGHWHUPLQDomRGRVXMHLWRRFRUUHHP³$MXGDPD HQJURVVDU>@´ ž† 
estando o verbo na terceira pessoa do plural.
E &DVRRWHUPR³FLFOR´VRIUHVVHYDULDomRTXDQWRDRQ~PHURWDPEpPVHULD
DOWHUDGDDIRUPDYHUEDOGHVWDFDGDHP³Segue-se um ciclo que parece não
WHUILP´ ž† 
c) É passível de variação, podendo ser aceita a forma no singular ou plural,
DIRUPDYHUEDODSUHVHQWDGDHP³>@ID]HPSDUWHGHIDPtOLDV>@´ ž† SRU
se tratar de concordância estabelecida com número fracionário.
G $IRUPDYHUEDO GHVWDFDGDHP³>@GHVGREUDP-se para tentar cumprir
HVVHV UHTXLVLWRV >@´ ž†  HVWDEHOHFH FRQFRUGkQFLD FRUUHWDPHQWH FRP D
H[SUHVVmR ³IDPtOLD EUDVLOHLUD´ SRU VH WUDWDU GH H[SUHVVmR LQGLFDWLYD GH
aspecto coletivo.
75. (CONSULPLAN / Assistente Social / 2016)
Escolhas e repercussão social
Toda sociedade grande e complexa tem, na verdade, duas qualidades: é
muito firme e muito elástica. Em seu interior, constantemente se abre um
espaço para as decisões individuais. Apresentam-se oportunidades que
podem ser aproveitadas ou perdidas. Aparecem encruzilhadas em que as
pessoas têm de fazer escolhas, e de suas escolhas, conforme sua posição
social, pode depender seu destino pessoal imediato, ou o de uma família
inteira, ou ainda, em certas situações, de nações inteiras ou de grupos
dentro delas. Pode depender de suas escolhas que a resolução completa das
tensões existentes ocorra na geração atual ou somente na seguinte. Delas
pode depender a determinação de qual das pessoas ou grupos em confronto,
dentro de um sistema particular de tensões, se tornará o executor das
transformações para as quais as tensões estão impelindo, e de que lado e
em que lugar se localizarão os centros das novas formas de integração rumo
às quais se deslocam as mais antigas, em virtude, sempre, de suas tensões.
Mas as oportunidades entre as quais a pessoa assim se vê forçada a optar
não são, em si mesmas, criadas por essa pessoa. São prescritas e limitadas
pela estrutura específica de sua sociedade e pela natureza das funções que
as pessoas exercem dentro dela. E, seja qual for a oportunidade que ela
aproveite, seu ato se entremeará com os de outras pessoas; desencadeará
outras sequências de ações, cuja direção e resultado provisório não
dependerão desse indivíduo, mas da distribuição do poder e da estrutura das
tensões em toda essa rede humana móvel.
(ELIAS, Norbert. A sociedade dos indivíduos. Rio de Janeiro: Jorge Zahar, 1994.)

As afirmativas a seguir se referem aos aspectos da construção do texto;


analise as considerações.
,(P³IXQo}HVTXHDVSHVVRDVH[HUFHPGHQWUR GHOD´KiXPDLQGLFDomRGH
circunstância temporal e de lugar, respectivamente.
,, (P ³Apresentam-se oportunidades que podem ser aproveitadas ou
SHUGLGDV´DIRUPDYHUEDOGHVWDFDGDDSUHVHQWD-se no plural corretamente e
justifica-se por se tratar de um verbo de transitividade direta.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 95 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

,,, &DVR D IRUPD YHUEDO ³WrP´ IRVVH VXEVWLWXtGD SRU ³REMHWLYDP´ HP ³DV
SHVVRDVWrPGHID]HUHVFROKDV´KDYHULDDOWHUDomRDSHQDVTXDQWRDRHIHLWR
semântico já que a relação entre o termo regente e o termo regido seria
mantida.
Está(ão) correta(s) a(s) afirmativa(s)
a) I, II e III.
b) I, apenas.
c) II, apenas.
d) II e III, apenas.
76. (CONSULPLAN / HOB / Enfermeiro / 2015)
O uso formal da língua exige o respeito às normas de concordância verbo-
nominal. Considerando esse aspecto, analise os trechos a seguir e os
respectivos comentários.
,³+RMHFRPR0HUFRVXOsão comuns jogos de futebol contra a Argentina,
o Uruguai, o Chile, o espanhol está em alta." (2º§) ± O verbo destacado
deve ficar no plural para concordar com o Q~FOHRGRVXMHLWR³MRJRV
,,³  DVUHODo}HVSHVVRDLVFRPRUHVWRGRPXQGRserão feitas no idioma
de Cervantes, de Carlos Gardel e, claro, na língua do Clinton..." (2º§) ± A
concordância do verbo destacado não é considerada correta pela norma-
padrão, pois o núcleo do sujeito está no singular.
,,,³eDUD]mRSRUTXHHPTXDOTXHUHVTXLQDGDFLGDGHVXUJHPSODFDV
de cursos de língua." (4º§) ? Também seria gramaticalmente correto
GL]HU³eDUD]mRSRUTXHHPTXDOTXHU esquina da cidade surge
placas de cursos de língua." ? A concordância verbo-nominal seria, no
FDVRFRPRWHUPR³HVTXLQD
,9 ³$V SHVVRDV DLQGD têm muito o que aprender com Tucídides, com o
general Brásidas, com o cerco de Esfactéria, com a Guerra do Peloponeso..."
(28º§) ± A concordância está conforme a norma-padrão. O núcleo do sujeito
³SHVVRDV HVWiQRSOXUDOHDWUDLRYHUERSDUDHVVDIOH[mR

De acordo com o ponto de vista da correção gramatical, estão corretos


apenas os trechos
a) I e III.
b) I e IV.
c) II e III.
d) III e IV.
77. (CONSULPLAN / Pref. de Campo Verde / Contador / 2010)
Houve ERRO de concordância em:
a) Sempre tu e ela fostes amigas inseparáveis.
b) Existem salários a peso de ouro.
c) Um grande número de jogadores não ficou nos bancos escolares.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 96 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

d) Concede-se aumentos insignificantes aos aposentados.


e) Sempre houve pessoas desonestas nesta sociedade.
78. (CONSULPLAN / Téc. de Laboratório / Congonhas / 2010)
Assinale a afirmativa que apresenta a forma verbal adequada:
a) Naquele dia, faltou dez pessoas.
b) O pessoal gritavam.
c) Ainda não chegaram os documentos.
d) Haviam muitas pessoas nesse lugar.
e) Paulo eram as alegrias daquela família.
79. (CONSULPLAN / Ag. Adm. / 2010) Adaptada.
Assinale a afirmativa que apresenta a concordância adequada:
a) Os jogadores ficaram alertas.
b) Havia bastante razões para ele jogar.
c) Ela estava meio preocupada com o resultado do jogo.
d) Mais de um avião caíram no mar.
e) Bebida alcoólica é proibida para menores.
80. (CONSULPLAN / TRE-RS / Téc. Administrativo / 2008)
Está em desacordo com a norma culta da língua apenas:
a) O Amazonas deságua no oceano Atlântico.
b) "Os EUA são um lugar onde tudo é possível."
c) Os Estados Unidos terão novo presidente.
d) Santos ficam em São Paulo.
e) Campos é cidade fluminense.
81. (CONSULPLAN / CODEVASF / Téc. em Informática / 2008)
Assinale a alternativa INCORRETA quanto à concordância verbal:
a) Alagoas fica na Região Nordeste.
b) Alguns de nós serão bem classificados no concurso.
c) Algum de nós paga o preço de custo do medicamento.
d) Os Estados Unidos está em campanha para eleger o novo presidente.
e) Derrubaram a palmeira e o coqueiro centenários.
82. (CONSULPLAN / SDC-SC / Téc. em Informática / 2008)
Todas as frases estão de acordo com a norma culta, EXCETO:
D ³$UWXU]LQKRREMHWRXTXHSUHWHQGHXVDUEDUEHDGRUHOpWULFR´
E ³&RPHP-se os ovos e toma-VHDVRSD´
F ³0DVVHVHUYHGHPRQWDULDFRPRpTXHDJHQWHYDLFRPHUHOH"´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 97 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

G ³4XHULGDHXQXQFDYLFDUQHGH]HEUDQRDoRXJXHPDVSRVVRJDUDQWLU
TXHQmRpOLVWUDGD´
H ³GHYHPRVDPDURVDQLPDLVHQmRPDOWUDWi-ORV´
83. (CONSULPLAN / SDC-SC / Téc. de Informática / 2008)
A concordância está correta em:
a) Devem haver profissionais competentes nas salas de aula.
b) Do pêlo faz-se tapetes.
c) Bateram oito horas o relógio da igreja.
d) Sopa é bom no inverno.
e) Quando chegar os livros, ficarei satisfeito.
84. (CONSULPLAN / EMBRAPA / Advogado / 2007)
³)RUWH H GRQR GH ERD PXVFXODWXUD HOH WHP LQVWLQWR DJUHVVLYR´ 6H
pluralizarmos o pronome ele, da frase anterior, teremos a forma verbal:
a) têem
b) têm
c) terão
d) teriam
e) tenham
85. (CONSULPLAN / Pref. Mun. de Porto Feliz / 2008)
Indique a seguir a alternativa em que a concordância está INADEQUADA:
A) Alugam-se barracos naquela favela.
B) Cura-se doença causada pela fome.
C) Chegaram ontem os suprimentos necessários.
D) Acabaram rápido os suprimentos.
E) Entrou mais de vinte crianças no orfanato.
86. (CONSULPLAN / CFN / Administrador / 2011)
Assinale a alternativa em que a alteração feita tenha gerado mudança do
sentido do texto e erro de concordância:
$ ³RQGH RVVHUHVLPRUWDLVVHPDQLIHVWDYDP´ ž† RQGHRVVHUHVLPRUWDLV
manifestavam-se.
% ³0DLVViELRTXHHVVHKRPHPHXVRX´ ž† (XVRXPDLVViELRTXHHVVH
homem.
& ³6HHOHHUDRKRPHPPDLVViELRGD*UpFLDHQWmRRYHUGDGHLURViELRp
aquele que tem conscLrQFLD GD SUySULD LJQRUkQFLD´ ž†   6H HOH HUD R
homem mais sábio da Grécia, logo o verdadeiro sábio é aquele que tem
consciência da própria ignorância.
'  ³D JUDQGH PDLRULD GDV SHVVRDV   QmR VDEH´ ž†   D PDLRULD GDV
pessoas (...) não sabem.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 98 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

(  ³E continuava fazendo perguntas em cima de perguntas, até levar os


exaustos interlocutores a conclusões opostas às que haviam dado
LQLFLDOPHQWH´ ž† (FRQWLQXDYDID]HQGRSHUJXQWDVHPFLPDGHSHUJXQWDV
até levar os exaustos interlocutores a conclusões opostas às que havia dado
inicialmente.
87. (CONSULPLAN / Pref. de Santa Maria / Adm. / 2010)
A educação possível
A educação benevolente e frouxa que hoje predomina nas casas e escolas é
mais nociva do que uma sala de aula com teto e chão furados e livros aos
frangalhos.
Educação é algo bem mais amplo do que escola. Começa em casa, onde
precisam ser dadas as primeiras informações sobre o mundo (com criança
também se conversa!), noções de postura e compostura, respeito, limites.
Continua na vida pública, nem sempre um espetáculo muito edificante, na
qual vemos políticos concedendo-se um bom aumento em cima dos seus já
polpudos ganhos, enquanto professores recebem salários escrachadamente
humilhantes, e artistas fazendo propaganda de bebida num momento em
que médicos, pais e responsáveis lutam com a dependência química de
milhares de jovens. Quem é público, mesmo que não queira, é modelo:
artistas, líderes, autoridades. Não precisa ser hipócrita nem bancar o
santarrão, mas precisa ter consciência de que seus atos repercutem, e
muito.
Mas vamos à educação nas escolas: o que é educar? Como deveria ser uma
boa escola? Como se forma e se mantém um professor eficiente, como se
preparam crianças e adolescentes para este mundo competitivo onde todos
têm direito de construir sua vida e desenvolver sua personalidade?
É bem mais simples do que todas as teorias confusas e projetos inúteis que
se nos apresentam. Não sou contra colocarem um computador em cada sala
de aula neste reino das utopias, desde que, muito mais e acima disso,
saibamos ensinar aos alunos o mais elementar, que independe de
computadores: nasce dos professores, seus métodos, sua autoridade, seu
entusiasmo e seus objetivos claros. A educação benevolente e frouxa que
hoje predomina nas casas e escolas prejudica mais do que uma sala de aula
com teto e chão furados e livros aos frangalhos. Estudar não é brincar, é
trabalho. Para brincar temos o pátio e o bar da escola, a casa.
Sair do primeiro grau tendo alguma consciência de si, dos outros, da
comunidade onde se vive, conseguindo contar, ler, escrever e falar bem (não
dá para esquecer isso, gente!) e com naturalidade, para se informar e expor
seu pensamento, é um objetivo fantástico. As outras matérias, incluindo as
artísticas, só terão valor se o aluno souber raciocinar, avaliar, escolher e se
comunicar dentro dos limites de sua idade.
No segundo grau, que encaminha para a universidade ou para algum curso
técnico superior, o leque de conhecimentos deve aumentar. Mas não adianta
saber história ou geografia americana, africana ou chinesa sem conhecer
bem a nossa, nem falar vários idiomas se nem sequer dominamos o nosso.
Quer dizer, não conseguimos nem nos colocar como indivíduos em nosso
grupo nem saber o que acontece, nem argumentar, aceitar ou recusar em

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 99 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

nosso próprio benefício, realizando todas as coisas que constituem o termo


WmRHPYRJDHWmRPDODSOLFDGR³FLGDGDQLD´
O chamado terceiro grau, a universidade, incluindo conhecimentos
especializados, tem seu fundamento eficaz nos dois primeiros. Ou tudo
acabará no que vemos: universitários que não sabem ler e compreender um
texto simples, muito menos escrever de forma coerente. Universitários,
portanto, incapazes de ter um pensamento independente e de aprender
qualquer matéria, sem sequer saber se conduzir. Profissionais competindo
por trabalho, inseguros e atordoados, logo, frustrados.
Sou de uma família de professores universitários. Fui por dez anos titular de
linguística em uma faculdade particular.
Meu desgosto pela profissão ± que depois abandonei, embora gostasse do
contato com os alunos ± deveu-se em parte à minha dificuldade de me
enquadrar (ah, as chatíssimas e inócuas reuniões de departamento, o
caderno de chamada, o currículo, as notas...) e em parte ao desalento. Já
nos anos 70 recebíamos na universidade jovens que mal conseguiam
articular frases coerentes, muito menos escrevê-las. Jovens que não sabiam
raciocinar nem argumentar, portanto incapazes de assimilar e discutir
teorias. Não tinham cultura nem base alguma, e ainda assim faziam a
faculdade, alguns com sacrifício, deixando-me culpada quando os tinha de
reprovar.
Em tudo isso, estamos melancolicamente atrasados. Dizem que nossa
economia floresce, mas a cultura, senhores, que inclui a educação (ou vice-
versa, como queiram...), anda mirrada e murcha. Mais uma vez, corrigir isso
pode ser muito simples. Basta vontade real. Infelizmente, isso depende dos
políticos, depende dos governos. Depende de cada um de nós, que os
escolhemos e sustentamos.
(Lya Luft. Veja. 23 de maio de 2007. Adaptado)
Analise as afirmativas:
,(P³desde que, muito mais e acima disso, saibamos ensinar aos alunos
RPDLVHOHPHQWDU´ ž† DH[SUHVVmRGHVWDFDGDLQGLFDFRQGLomR
II. A coerência, o sentido original do texto e a correção gramatical serão
mantidos caso se substitua ³ SRUWDQWR LQFDSD]HV GH DVVLPLODU H GLVFXWLU
WHRULDV´ ž† SRU³SRUWDQWRLQFDSD]HVGHDVVLPLODUWHRULDVHGLVFXWL-ODV´
,,,$IRUPDYHUEDO³TXHLUD´ ž† IRLHPSUHJDGDQRSUHVHQWHGRLQGLFDWLYR
porque a forma verbal anterior a ela também está no presente.
,92WUHFKR³FRPRVHSUHSDUDPFULDQoDVHDGROHVFHQWHV´ ž† HTXLYDOH
D³FRPRFULDQoDVHDGROHVFHQWHVVmRSUHSDUDGRV´
Está(ão) correta(s) apenas a(s) alternativa(s):
A) I, II, III B) I, II, IV C) II, III D) III, IV E) IV
88. (CONSULPLAN / Pref. Londrina / Administrador / 2011)
Sobre os aspectos referentes à concordância, assinale a alternativa correta:
$ (P³$DWXDOJHUDomRGHDGXOWRVIRLFULDQoD´RYHUER³IRL´SRGHULDVHU
corretamente flexionado no plural concordando FRP³DGXOWRV´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 100 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

% (P³2IODJUDQWHGHVFDVRFRPREHPS~EOLFRWHPVXDVUDt]HVILQFDGDV´
HVWDULDFRUUHWRRXVRGRYHUERQRSOXUDO³WrP´
& ³([LVWHXPDUHODomRHQWUHRQtYHOGHHGXFDomRGHXPSRYR´RYHUER
³H[LVWH´WHPFRPRUHIHUHQWH³XPDUHODomRHQWUH RQtYHO´
' ³$FRQFHSomRGHEHPS~EOLFRFRPRDOJRYDORURVRQXQFDpHVSRQWkQHD´
2DGMHWLYR³HVSRQWkQHD´SRGHULDVHUFRUUHWDPHQWHIOH[LRQDGRQRPDVFXOLQR
plural.
( ³WRQHODGDVGHOL[RIRUDPUHFROKLGDVGDVSUDLDVFDULRFDV´SRGH-se
corretameQWHXVDUQRVLQJXODU³IRLUHFROKLGR´FRQFRUGDQGRFRP³OL[R´
89. (CONSULPLAN / CFN / Advogado / 2011)
TEXTO:
Quando confrontados pelos aspectos mais obscuros ou espinhosos da
existência, os antigos gregos costumavam consultar os deuses (naquela
época, não havia psicanalistas). Para isso, existiam os oráculos ± locais
sagrados onde os seres imortais se manifestavam, devidamente encarnados
em suas sacerdotisas. Certa vez, talvez por brincadeira, um ateniense
perguntou ao conceituado oráculo de Delfos se haveria na Grécia alguém
PDLVViELRTXHRHVTXLVLWmR6yFUDWHV$UHVSRVWDIRLVXPiULD³1mR´
O inesperado elogio divino chegou aos ouvidos de Sócrates, causando-lhe
uma profunda sensação de estranheza. Afinal de contas, ele jamais havia se
considerado um grande sábio. Pelo contrário: considerava-se tão ignorante
quanto o resto da humanidade. Após muito meditar sobre as palavras do
oráculo, Sócrates chegou à conclusão de que mudaria sua vida (e a história
do pensamento). Se ele era o homem mais sábio da Grécia, então o
verdadeiro sábio é aquele que tem consciência da própria ignorância. Para
colocar à prova sua descoberta, ele foi ter com um dos figurões intelectuais
da época. Após algumas horas de conversa, percebeu que a autoproclamada
sabedoria do sujeito era umDFDVFDYD]LD(FRQFOXLX³0DLVViELRTXHHVVH
homem eu sou. É provável que nenhum de nós saiba nada de bom, mas ele
supõe saber alguma coisa e não sabe, enquanto eu, se não sei, tampouco
suponho saber. Parece que sou um tantinho mais sábio que ele exatamente
SRU QmR VXSRU VDEHU R TXH QmR VHL´ $ SDUWLU GDt 6yFUDWHV FRPHoRX XPD
cruzada pessoal contra a falsa sabedoria humana ± e não havia melhor palco
para essa empreitada que a vaidosíssima Atenas. Em suas próprias palavras,
HOHVHWRUQRXXP³YDJDEXQGRORTXD]´± uma usina ambulante de insolência
iluminadora, movida pelo célebre bordão que Sócrates legou à posteridade:
³6yVHLTXHQDGDVHL´
Para sua tarefa audaz, Sócrates empregou o método aprendido com os
professores sofistas. Mas havia grandes diferenças entre a dialética de
Sócrates e a de seus antigos mestres. Em primeiro lugar, Sócrates não
FREUDYD GLQKHLUR SRU VXDV ³OLo}HV´ ± aceitava conversar com qualquer
pessoa, desde escravos até políticos poderosos, sem ganhar um tostão. Além
disso, os diálogos de Sócrates não serviam para defender essa ou aquela
posição ideológica, mas para questionar a tudo e a todos sem distinção. Ele
geralmente começava seus debates com perguntas diretas sobre temas
HOHPHQWDUHV³2TXHpR$PRU"´³2TXHpD9LUWXGH"´³2TXHpD0HQWLUD"´
Em seguida, destrinchava as respostas que lhe eram dadas, questionando o

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 101 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

significado de cada palavra. E continuava fazendo perguntas em cima de


perguntas, até levar os exaustos interlocutores a conclusões opostas às que
haviam dado inicialmente ± e tudo isso num tom perfeitamente amigável.
Assim, o pensador demonstrava uma verdade que até hoje continua
universal: na maior parte do tempo, a grande maioria das pessoas
(especialmente as que se consideram mais sabichonas) não sabe do que está
falando.
(José Francisco Botelho. Revista Vida Simples, edição 91, abril de 2010 / com adaptações)
Marque V para as afirmativas verdadeiras e F para as falsas:
 (P³QmRKDYLDSVLFDQDOLVWDV´ ž† DIRUPDYHUEDO³KDYLD´SRGHULDHVWDU
QRSOXUDOFRQFRUGDQGRFRP³SVLFDQDOLVWDV´
 (P³onde RVVHUHVLPRUWDLVVHPDQLIHVWDYDP´ ž† DSDODYUDGHVWDFDGD
pode ser substituída, sem que haja alteração do sentido do período, por nos
quais.
 $FRORFDomRGHXPDYtUJXODGHSRLVGRWHUPR³SHUJXQWRX´ ž† PDQWpP
o sentido e a correção gramatical do período.
 (P³mas HOHVXS}HVDEHUDOJXPDFRLVDHQmRVDEH´ ž† DSDODYUDHP
destaque pode ser substituída, sem alteração do sentido do período, por
todavia.
 2HPSUHJRGHSUHSRVLomRHP³DFRQFOXV}HVRSRVWDV´ ž† MXVWLILFD-se
SHODUHJrQFLDGH³LQWHUORFXWRUHV´ ž† 
A sequência está correta em:
A) F, V, F, V, F
B) F, V, V, F, V
C) V, F, F, F, F
D) F, V, V, F, F
E) V, V, F, F, V
90. (CONSULPLAN / Advogado / 2011)
Considerando os conhecimentos sobre concordância verbal e nominal,
DQDOLVHDVDILUPDWLYDVWHQGRFRPREDVHRSHUtRGR³(ODVTXHULDPpVDEHUVH
O Amigo da Bruxinha, de Eva Furnari, ou alguma história de Ziraldo estavam
GLVSRQtYHLV´HLQGLTXHDFRUUHWD
$ ³(VWDYDPGLVSRQtYHLV´SRGHVHUVXEVWLWXtGRSRU³HVWDYDGLVSRQtYHO´
% $IRUPD³HVWDYDPGLVSRQtYHLV´pD~QLFDDFHLWDSRLVDGHFODUDomRFRQWLGD
no predicado é atribuída a todos os núcleos do sujeito composto.
&  &DVR ³HVWDYDP GLVSRQtYHLV´ DQWHFHGD R VXMHLWR WHUi VXD IRUPD
REULJDWRULDPHQWHDOWHUDGDSDUD³HVWDYDGLVSRQtYHO´
'  &DVR ³HVWDYDP GLVSRQtYHLV´ DQWHFHGD R VXMHLWR VXD IRUPD SRGHUi
SHUPDQHFHUDPHVPDRXVHUDOWHUDGDSDUD³HVWDYDGLVSRQtYHO´
( ³(VWDYDPGLVSRQtYHLV´SRGHVHUVXEVWLWXtGRSRU³HVWDYDPGLVSRQtYHO´Mi
TXH³GLVSRQtYHO´pXPDGMHWLYRQmRIRUPDQGRXPDORFXomRYHUEDO

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 102 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

91. (CONSULPLAN / Câm. de Queimados / Ag. Adm. / 2005)


A frase abaixo que atende às normas da língua padrão no que se refere à
concordância é:
A) O relógio deram duas horas.
B) A doença, a tristeza, a solidão tudo isso me fez abandonar os estudos.
C) Cerca de dez pessoas ficou ao meu lado.
D) Rir e chorar traz paz ao coração.
E) A multidão gritavam desesperados.
92. (CONSULPLAN / DEMASP / Ag.Adm. / PSF / 2008)
Assinale a seguir a frase em que há ocorrência do desvio da norma culta em
relação à concordância verbal:
A) Os Lusíadas é um grande poema de Camões.
B) Dançar e nadar é importante para o desenvolvimento infantil.
C) A maior parte dos alunos perdeu aula hoje.
D) Precisam-se de jovens e adultos para o coral.
E) O diretor com o professor assumiram a liderança da gincana.
93. (CONSULPLAN / Pref. Chiador / Ag. Adm. / 2005)
A frase abaixo que atende às normas da língua padrão no que se refere à
concordância é:
A) A gente vamos olhar a gaiola no outro dia;
B) Cerca de dez pessoas viu o pássaro doente;
C) Nenhum homem, nenhuma mulher, nenhuma criança fariam isso;
D) Tanto o sogro como a mulher se negaram a sacrificar o canário;
E) N.R.A.
94. (CONSULPLAN / Pref. Chiador / Ag. Adm. / 2005)
A mulher ficou ______ angustiada com a situação do canário. Ela
___________ resolveu a questão. Quanto à concordância nominal, marque
a alternativa que preencha adequadamente as lacunas acima:
A) meia ± mesma;
B) meio ± mesma ;
C) meio ± mesmo ;
D) meia ± mesmo;
E) N.R.A.
95. (CONSULPLAN / Pref. São Leopoldo/ AG. ADM. / 2010)
Assinale a afirmativa que apresenta a forma verbal adequada:
A) Vossa Excelência pediu calma.
B) Mais de dois alunos faltou.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 103 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

C) Deu duas horas no relógio da igreja.


D) Haviam sérios compromissos.
E) Faziam cinco anos que ele não vinha a São Paulo.
96. (CONSULPLAN / Ag. de Saúde / 2011)
Assinale a afirmativa que apresenta a concordância correta.
A) Algum de nós entregaremos o prêmio.
B) Haviam muitos negros na universidade.
C) São bem mais de uma hora.
D) Paulo era as emoções da casa.
E) Fazem dois anos que ele saiu.
97. (CONSULPLAN / Ag. Com de Saúde / 2010)
Assinale a afirmativa que se encontra de acordo com a norma culta da
língua:
A) Cerca de duas pessoas compareceu à reunião.
B) É proibido a entrada de estranhos.
C) Faltam cinco minutos para começar o espetáculo.
D) A porta estava meia aberta.
E) Elas mesmos não quiseram falar.
98. (CONSULPLAN / Ag. Comunitário de Saúde / 2010)
Assinale a alternativa que se encontra de acordo com a norma culta da
língua:
A) Eu, tu e ele fizemos a tarefa.
B) Bateu quatro horas na torre da igreja.
C) Cem milhões são muito.
D) Sucedeu, naquela época, acontecimentos inevitáveis.
E) Natal ou Recife é bons lugares para as férias.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 104 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA BH
Aula 06 ± Felipe Luccas Rosas

Gabaritos
1. INCORRETA 34. INCORRETA 67. LETRA A
2. INCORRETA 35. INCORRETA 68. INCORRETA
3. INCORRETA 36. INCORRETA 69. LETRA D
4. CORRETA 37. INCORRETA 70. LETRA A
5. CORRETA 38. INCORRETA 71. LETRA B
6. CORRETA 39. CORRETA 72. LETRA B
7. CORRETA 40. INCORRETA 73. LETRA D
8. INCORRETA 41. LETRA B 74. LETRA B
9. CORRETA 42. CORRETA 75. LETRA C
10. CORRETA 43. INCORRETA 76. LETRA B
11. INCORRETA 44. INCORRETA 77. LETRA D
12. CORRETA 45. INCORRETA 78. LETRA C
13. INCORRETA 46. CORRETA 79. LETRA C
14. CORRETA 47. CORRETA 80. LETRA D
15. INCORRETA 48. INCORRETA 81. LETRA D
16. INCORRETA 49. INCORRETA 82. LETRA C
17. INCORRETA 50. INCORRETA 83. LETRA D
18. LETRA C 51. INCORRETA 84. LETRA B
19. CORRETA 52. LETRA D 85. LETRA E
20. INCORRETA 53. LETRA D 86. LETRA E
21. LETRA B 54. CORRETA 87. LETRA B
22. LETRA E 55. LETRA A 88. LETRA C
23. INCORRETA 56. LETRA E 89. LETRA A
24. LETRA B 57. CORRETA 90. LETRA B
25. INCORRETA 58. LETRA B 91. LETRA B
26. CORRETA 59. LETRA A 92. LETRA D
27. INCORRETA 60. LETRA D 93. LETRA D
28. CORRETA 61. INCORRETA 94. LETRA B
29. INCORRETA 62. LETRA D 95. LETRA A
30. CORRETA 63. CORRETA 96. LETRA D
31. INCORRETA 64. LETRA C 97. LETRA C
32. INCORRETA 65. LETRA E 98. LETRA A
33. LETRA C 66. INCORRETA

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 105 de 105


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

Lista de questões

1. (FGV / IBGE / 2016) Adaptada


A frase abaixo, de Millôr Fernandes, exemplifica o emprego da vírgula por
inserção de um segmento entre sujeito e verbo:
³2GLItFLO TXDQGRIRUHPFRPXQVDVYLDJHQV LQWHUSODQHWiULDV VHUiDJHQWH
GHVFREULURSODQHWDHPTXHIRUDPSDUDUDVEDJDJHQV´
2. (CESPE / TCU / 2015) Adaptada
Escreve H. Summer Maine que algumas experiências societárias, ao
permitirem o declínio do poder real e o enfraquecimento de monarcas
hereditários, acabaram por favorecer a emergência de aristocracias...
2HPSUHJRGHYtUJXODORJRDSyV³+6XPPHU0DLQHSUHMXGLFDULDDFRUUHomR
gramatical do período.
3. (FGV / TJ PI / 2016) Adaptada
³$WXDOPHQWH D JUDQGH PDLRULD GRV FDVRV GH DGXOWpULR p FRPELQDGD SRU
telefones pessoais, pois dessa forma não há tanto risco de outra pessoa
atender às ligações".
A afirmação correta sobre a estrutura desse segmento do texto 1 é: a
primeira vírgula do segmento marca a presença de um termo deslocado da
ordem direta.
4. (CESPE / Téc. Judiciário / STJ / 2012) Adaptada
A um coronel que se queixava da vida no quartel, um jornalista disse:
² O senhor não sabe como é chato militar na imprensa.
Com relação às ideias e aos aspectos linguísticos do trecho acima, julgue os
LWHQVDVHJXLU2HPSUHJRGDYtUJXODDSyV³TXDUWHO´pIDFXOWDWLYR
5. (CESPE / SEDF / 2017)
Quando indaguei a alguns escritores de sucesso que manuais de estilo
tinham consultado durante seu aprendizado, a resposta mais comum foi
³QHQKXP´'LVVHUDPTXHHVFUHYHUSDUDHOHVDFRQWHFHXQDWXUDOPHQWH
No que se refere ao texto precedente, julgue o item a seguir.
(P ³'LVVHUDP TXH HVFUHYHU SDUD HOHV DFRQWHFHX QDWXUDOPHQWH´, a
supressão das vírgulas preservaria a correção gramatical do período, mas
prejudicaria seu sentido original.
6. (IESES / Assistente Social / 2017)
Assinale C (certo) ou E (errado) para a justificativa do emprego da vírgula
na proposição a seguir.
 (P³quando a prática do envio de SMS já está enraizada, após um ano,
µQmRKiQHQKXPDOLJDomRHQWUHRQtYHOGHRUWRJUDILDWUDGLFLRQDOHDIRUPD
GRV606¶DVYtUJXODVMXVWLILFDP-se por estar isolando um adjunto adverbial
intercalado.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 74 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

7. (CESPE / Suframa / 2014)


Após fechar outubro com índice histórico de mão de obra direta (127.800
trabalhadores), o Polo Industrial de Manaus (PIM) deu sequência aos bons
resultados e encerrou novembro de 2013 com novo recorde de empregos:
129.663 trabalhadores, entre efetivos, temporários e terceirizados. O
faturamento acumulado do PIM no período de janeiro a novembro de 2013
também avançou, totalizando R$ 76,6 bilhões (US$ 35.7 bilhões),
registrando-se crescimento de 12,40% (2,04% na moeda americana) em
relação ao mesmo período de 2012.
Os dados fazem parte dos indicadores de desempenho do PIM, os quais são
apurados mensalmente pela SUFRAMA junto às empresas incentivadas do
parque industrial da capital amazonense.
$ YtUJXOD HPSUHJDGD DSyV ³  WUDEDOKDGRUHV ´ LVROD RUDomR
subordinada adverbial anteposta.
8. (IESES / Assistente Social / 2017)
Assinale C (certo) ou E (errado) para a justificativa do emprego da vírgula
na proposição a seguir.
( ) Em: ³(VVHHVWXGRPRVWUDTXH TXDQGRRVMRYHQVFRPHoDPDHVFUHYHU
SMS, é o nível de escrita tradicional que determina a forma dos SMS
HQYLDGRV´DVYtUJXODVHVWmRLVRODQGRXma oração subordinada adverbial.
9. (FCC / TRF 3ª REGIÃO / 2016) Adaptada
Mas foi com o samba que João Gilberto rompeu as estruturas da nossa
canção. E se o rompimento não foi universal, culpa é do brasileiro, que não
tem vocação pra exportar coisa alguma.
Sem prejuízo para a correção e o sentido, pode-se acrescentar uma vírgula
imediatamente após o termo "E", em E se o rompimento não foi universal...
10. (Instituto Excelência / Almoxarife / 2017) Adaptada
Analise a pontuação do item abaixo:
III ± ³(GHUHSHQWHHXPHYLHPXPDPLVVmR´
Em III, a vírgula é utilizada a fim de separar o adjunto adverbial antecipado.
11. (ESAF / ANAC-Técnico Administrativo / 2016)
Assinale a opção em que a pontuação permanece correta, apesar de ter sido
modificada.
a) Há quase dois anos, fui empossado técnico administrativo (...)
b) (...) na ANAC, de São Paulo e estou muito satisfeito de trabalhar lá.
F   QDDGPLQLVWUDomRS~EOLFDSRUpPSUHIHULILFDURQGHHVWRX «
G  6LQFHUDPHQWH VRX SDUWLGiULR GR ³QmR VH PH[H HP WLPH TXH HVWi
JDQKDQGR´
e) Trabalho na área administrativa, junto com outros técnicos e analistas,
DOpPGHVHUJHVWRUVXEVWLWXWR « 

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 75 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

12. (CESPE / INSS / 2016) Adaptada


Consta-nos que o autor, solicitado pelos numerosos amigos, leu há dias a
comédia em casa do Sr. Estêvão Soares...
Acerca de aspectos linguísticos do texto, julgue o item a seguir.
A correção gramatical e o sentido do texto seriam mantidos caso o termo
³HPFDVD´IRVVHLVRODGRSRUYtUJXODV
13. (CESPE / CPRM / 2016) Adaptada
Por meio de ações governamentais, todos os cidadãos devem ser
constantemente instruídos...
2 HPSUHJR GD YtUJXOD TXH LVROD D H[SUHVVmR ³3RU PHLR GH Do}HV
JRYHUQDPHQWDLV´pREULJDWyULR
14. (CESPE / INSS / 2016) Adaptada
[...] Tanto que, quando seu Joaquim, ao preencher a nota de encomenda,
perguntou-me onde seria entregue a estante, tive um momento de
hesitação.
1RSHUtRGR³7DQWRTXHTXDQGR  PRPHQWRGHKHVLWDomR´RHPSUHJR
de todas as vírgulas deve-se à mesma regra de pontuação.
15. (CESPE / TCE SC / 2016) Adaptada
Nesse sentido, a gestão de integridade refere-se às atividades
empreendidas para estimular e reforçar a integridade e também para
prevenir a corrupção e outros desvios dentro de determinada organização.
2WUHFKR³HWDPEpP´SRGHULDVHUFRUUHWDPHQWHLVRODGRSRUYtUJXODVUHFXUVR
que lhe conferiria ênfase.
16. (CESPE / TJ DFT / 2015) Adaptada
Enquanto cientistas e governos buscam novas fontes de energias
sustentáveis, faça sua parte.
A vírgula empregada logo GHSRLV GH ³VXVWHQWiYHLV p obrigatória, e sua
supressão prejudicaria a correção gramatical do texto.
17. (CESPE / TELEBRAS / 2015) Adaptada
A partir de dados coletados com base em censos do Reino Unido, os
pesquisadores verificaram diminuição de empregos que envolviam grande
esforço, como trabalho e minas de carvão...
A correção gramatical e o sentido do texto seriam mantidos caso, no início
do segundo parágrafo, fosse inserida uma vírgula imediatamente após
³FROHWDGRV´HVXSULPLGDDXWLOL]DGDORJRDSyV³5HLQR 8QLGR´
18. (FGV / Fiscal ISS Niterói / 2015) Adaptada
Entre os segmentos do texto 1, aquele que mostra o emprego de vírgula em
função de um adjunto adverbial deslocado é: ³+RMHWXGRVHUHGX]DXPD
questão de marketing".

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 76 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

19. (CESPE / SEDF / 2017)


Um estudo coordenado pela Fundação Getúlio Vargas aponta que, enquanto
80% dos professores de educação infantil da rede pública do país têm nível
superior completo, 65,6% dos 4 docentes dessa mesma etapa na rede
privada têm igual escolaridade.
Acerca dos sentidos e de aspectos linguísticos do texto anteriormente
apresentado, julgue o item que se segue.
A correção gramatical do texto seria mantida caso a vírgula empregada logo
GHSRLVGH³TXH´IRVVHVXSULPLGD
20. (CESPE / CONTADOR TEM / 2014) Adaptada
Saiu finalmente a conta da contribuição da nova classe média brasileira ²
aquela que, na última década, ascendeu ao mercado de consumo, como
uma avalanche de quase 110 milhões de cidadãos.
No que se refere aos aspectos linguísticos e às ideias do texto acima, julgue
o próximo item.
2 YRFiEXOR ³ILQDOPHQWH´ SRGHULD VHU FRUUHWDPHQWH HPSUHJDGR HQWUH
vírgulas.
21. (IESES / Assistente Social / 2017)
Assinale C (certo) ou E (errado) para a justificativa do emprego da vírgula
na proposição a seguir.
Em: ³8PDYH]TXHRFHOXODUHR606VmRXVDGRVFRPIDFLOLGDGHHHQWXVLDVPR
por adolescentes, eles poderiam ser usados como um suporte de
DSUHQGL]DGRHVFRODU´ a vírgula justifica-se por estar isolando uma oração
reduzida antecipada.
22. (IFPE / Técnico Eletrônica / 2017)
Julgue a correção do item a seguir: Em ³&RP R WHPSR YRFr YDL VH
DFRVWXPDQGRHSHUFHEHTXHSDVPHPDLQGDpSRUWXJXrV´as vírgulas que
isolam a forma verbal ³SDVPHP´ poderiam ser substituídas por dois
travessões.
23. (CESPE / FUB / 2015)

Com relação às ideias e às estruturas do texto acima, julgue o item que se


segue.

Seria mantida a correção gramatical do período caso o fragmento ³(VWDomR


do ano mais aguardada pelos brasileiros" (l.1) fosse deslocado e inserido,
entre vírgulas, após ³YHUmR O) feitos os devidos ajustes de maiúsculas e

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 77 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

minúsculas.
24. (CESPE / TCE RN / 2015) Adaptada
Exercer a cidadania é muito mais que um direito, é um dever, uma
obrigação.
A substituição da última vírgula da frase pela conjunção e não acarreta erro
gramatical ao texto nem traz prejuízo à sua interpretação original.
25. (Instituto Excelência / Almoxarife / 2017) Adaptada
Analise a pontuação do item abaixo:
I ± ³(XYLDPDLVOLQGDJDURWDKRMHQRDoRXJXH*DUILHOG´
Em I, a vírgula é utilizada a fim de separar o aposto.
26. (CESPE/ TJ CE / 2014) Adaptada
Papel, amigo papel, não recolhas tudo o que escrever esta pena vadia.
Querendo servir me, acabarás desservindo-me, porque se acontecer que eu
me vá desta vida, sem tempo de te reduzir a cinzas, os que me lerem depois
da missa de sétimo dia, ou antes, ou ainda antes do enterro, podem cuidar
que te confio cuidados de amor.
Não, papel. Quando sentires que insisto nessa nota, esquiva-te da minha
mesa, e foge. A janela aberta te mostrará um pouco de telhado, entre a rua
e o céu, e ali ou acolá acharás descanso. Comigo, o mais que podes achar
é esquecimento, que é muito, mas não é tudo; primeiro que ele chegue, virá
a troça dos malévolos ou simplesmente vadios.
Escuta, papel. O que naquela dama Fidélia me atrai é principalmente certa
feição de espírito, algo parecida com o sorriso fugitivo, que já lhe vi algumas
vezes. Quero estudá-la se tiver ocasião. Tempo sobra-me, mas tu sabes que
é ainda pouco para mim mesmo, para o meu criado José, e para ti, se tenho
vagar e quê ² e pouco mais.
Sem prejuízo da correção gramatical do texto ou de seu sentido original, a
YtUJXODHPSUHJDGDHP³(VFXWDSDSHO´SRGHULDVHUVXSULPLGD
27. (Instituto Excelência / Almoxarife / 2017) Adaptada
Analise a pontuação do item abaixo:
II ± ³)RL XPD YLVmR OLQGD HOD HP Sp QR EDOFmR EHP HP IUHQWHDR ItJDGR
PRtGR´
Em II, as vírgulas são utilizadas a fim de separar o vocativo.
28. (CESPE / FUNPRESP / 2016) Adaptada
Com relação às ideias e aos aspectos linguísticos do texto Um amigo em
talas, julgue o item que se segue.
As vírgulas em ³$PDGHX$PDUDO-~QLRUHPHVWDGRGHGHVHPSUHJRDFHLWD
esmolas, donativos, roupa velha, pão dormido" foram todas empregadas
para separar itens de uma enumeração.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 78 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

29. (IESES / Assistente Social / 2017)


Assinale C (certo) ou E (errado) para a justificativa do emprego da vírgula
na proposição a seguir.
( )Em: ³$OpPGLVVRDHVFULWDWUDGLFLRQDOHQVLQDGDQDHVFRODHDVPHQVDJHQV
GH WH[WR UHGLJLGDV IRUD GH TXDOTXHU TXDGUR LQVWLWXFLRQDO µGHSHQGHP GDV
meVPDVKDELOLGDGHVFRJQLWLYDV¶, a vírgula justifica-se por separar termos
coordenados de uma oração.
30. (CESPE / DEPEN / 2015) Adaptada
É preciso compreender que o preso conserva os demais direitos (educação,
integridade física, segurança, saúde, assistência jurídica, trabalho e outros)
adquiridos como cidadão...
No trecho entre parênteses no início do primeiro parágrafo, as vírgulas
foram empregadas para isolar elementos de mesma função sintática em
uma enumeração.
31. (IFPE / Revisor / 2017)
Julgue a correção do item a seguir: No trecho ³&DGDXPUHOHXVHXFRQWR
realizou outra entrevista com o parente-personagem e produziu uma
VHJXQGDYHUVmR´, a utilização da vírgula se justifica por organizar orações
coordenadas.
32. (CESPE / SEDF / 2017)
Como qualquer profissional do ambiente escolar, os monitores também são
educadores, e cabe à equipe gestora realizar ações formativas para que eles
saibam como interagir com as crianças e os jovens nos diversos...
Seria mantida a correção gramatical do texto caso a vírgula empregada
LPHGLDWDPHQWHDSyV³HGXFDGRUHV´IRVVHVXSULPLGD.
33. (CESPE / FUNPRESP / 2016)
Senti como se estivesse nascendo naquele momento. Uma vida nova,
passada a limpo, me esperava em direção a um Norte mais nítido, a uma
morte mais próxima e sem alternativa. Mas aquela casa me protegia, e
dentro dela uma mulher se esforçava por me fazer feliz. Aquelas folhas de
papel me esperavam também, intocadas, e era minha obrigação escurecê-
las de ideias, histórias, sortilégios capazes, talvez, de fazer alguém parar no
seu cotidiano e se pôr a sonhar.
A respeito de aspectos linguísticos do texto, julgue o próximo item.
$YtUJXODHPSUHJDGDORJRDSyV³SURWHJLD´VHSDUDRUDo}HVDGLWLYDVTXHWrP
sujeitos distintos.
34. (CESPE / STJ / 2015) Adaptada
Desse modo, o termo justiça como conformidade da conduta a uma norma
é empregado para julgar o comportamento da pessoa humana diante de
uma norma, seja esta moral, seja de direito natural ou de direito positivo.
Em ³VHMDHVWDPRUal, seja de direito natural", é obrigatório o emprego da
vírgula para indicar a relação de alternância entre os elementos de orações

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 79 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

de mesmo nível sintático.


35. (ESAF / ANAC / 2016) Adaptada
Assinale a opção correta quanto à justificativa em relação ao emprego de
vírgulas.
As vírgulas no trecho "... os maiores mercados são Estados Unidos, Brasil,
França, Canadá, Alemanha, Inglaterra, Japão e México." separam:
a) aposto explicativo que complementa oração principal.
b) palavras de natureza retificativa e explicativa.
c) oração subordinada adjetiva explicativa.
d) complemento verbal composto por objeto direto.
e) termos de mesma função sintática em uma enumeração.
36. (FCC / TRT MT / 2016) Adaptada
Com respeito à pontuação, atente para as seguintes afirmações:
No segmento O fato é que não me sobrou nenhuma e elas ganharam,
talvez por isso... (5° parágrafo), pode-se acrescentar uma vírgula
imediatamente antes de "e", sem prejuízo para a correção e o sentido.
37. (CESPE / TCE RN / 2015) Adaptada
Ao Poder Legislativo é conferida a função de elaborar a lei; ao Poder
Executivo, a função de administrar a aplicação da lei; ao Poder Judiciário, a
função de dirimir os conflitos legais surgidos entre pessoas ou entre estas e
o Estado.
As vírgulas empregadas logo DSyV RV QRPHV ³([HFXWLYR H ³-XGLFLiULR
indicam a elisão da forma verbal composta que as precede no texto.
38. (FCC / TRT MT / 2016) Adaptada
Com respeito à pontuação, atente para as seguintes afirmações:

Na frase Conseguia às vezes juntar um punhado, outras vezes apenas dois


ou três pode-se acrescentar uma vírgula imediatamente antes de apenas,
mantendo-se a correção e o sentido.
39. (FUNCAB / EMSERH / Radiologia / 2016)
A última vírgula do trecho: ³$V FULDQoDV WHUmR RXWUDV PHPyULDV RXWUDV
brincadeiras, outras alegULDVRVDGXOWRVQRYDVVHQVDo}HVHSRVVLELOLGDGHV´
foi empregada para:
a) marcar o aposto.
b) separar o vocativo.
c) separar elementos de mesma função sintática.
d) indicara omissão de uma palavra.
e) separar orações coordenadas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 80 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

40. (CESPE / PMSP / 2016) Adaptada


³2VOL[}HVGHYHUmRGDUOXJDUDDWHUURVsanitários, que, se não representam
uma solução perfeita, ao menos são locais mais adequados para o depósito
dos rejeitos, uma vez que evitam problemas como os citados
DQWHULRUPHQWH´

A VXSUHVVmR GD YtUJXOD HPSUHJDGD ORJR DSyV ³VDQLWiULRV´ SUHVHUYDULD R


sentido do trecho.
41. (FCC / TRT SE / Analista / 2016)
Atente para a construção das seguintes frases:
I. Para o caso do escritor, apenas o segundo conceito é obrigatório.
II. A solução de um problema não cabe aos escritores, cuja preocupação
maior está em sua exposição.
III. Ele não confia muito nos escritores, que apresentam soluções mais ou
menos óbvias.
A supressão da vírgula altera significativamente o sentido da frase que está
em
a) I, II e III.
b) I e II, apenas.
c) II e III, apenas.
d) I e III, apenas.
e) II, apenas.
42. (CESPE / Funpresp / 2016) Adaptada
O homem que só tinha certezas quase nunca utilizava ponto de
interrogação.

Julgue o item seguinte, referente aos aspectos linguísticos e às ideias do


texto O homem que só tinha certezas. O sentido original do texto seria
DOWHUDGRFDVRDRUDomR³TXHVyWLQKDFHUWH]DVIRVVHLVRODGDSRUYtUJXODV
43. (CESPE / TCU / 2015) Adaptada
Os tribunais de contas, de modo geral, são acionados pelo cidadão por meio
de denúncias.
Quando o caso que der origem à denúncia envolver dinheiro federal, a
denúncia de ser feita ao TCU, que possui unidades em cada um dos estados
do Brasil.
O emprego das vírgulas no primeiro período do segundo parágrafo do texto
justifica-se por regras distintas.
44. (FGV / Pref. Niterói / Ag. Fazendário / 2015) Adaptada
A redução da maioridade penal fere uma das cláusulas da Constituição

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 81 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

Federal que não podem ser modificadas por congressistas.

A redação do trecho acima apresenta erro no que diz respeito ao emprego


da vírgula, por omissão ou uso indevido.
45. (CESPE / SEDF / 2017)
Pedir ao educador que situe o centro de gravidade na própria criança é pedir-
lhe nada menos que fazer uma revolução, se é verdade que até agora o
centro de gravidade foi situado fora dela. É essa revolução ² exigência
fundamental do movimento da educação nova ² que Claparède compara à
que Copérnico realizou na astronomia
Os travessões foram empregados no texto para isolar uma expressão de
natureza explicativa.
46. (CESPE / DPU / 2016) Adaptada

Ainda a respeito das ideias e dos aspectos linguísticos do texto, julgue o


item subsecutivo.
$VXSUHVVmRGDYtUJXODHPSUHJDGDORJRDSyV³SUHUURJDWLYD´ O manteria
a coerência do texto, embora alterasse o seu sentido.
47. (IFPE / Revisor / 2017)
Julgue a correção do item a seguir: Em ³8PHVFULWRUSURILFLHQWHQRHQWDQWR
não faz a revisão só no ILPGRWUDEDOKR´, as vírgulas estão corretamente
postas, pois separam expressão deslocada de sua posição original.
48. (FEPESE / Prefeitura de Criciúma-SC / 2016) Adaptada
Quanto à correção gramatical julgue o item a seguir: Todas as informações
procediam de documentos, de testemunhas; havia, porém, algumas que
vinham da própria vítima.
49. (ESAF / Técnico / ANAC / 2016)

Sobre as vírgulas e as aspas empregadas no texto é correto afirmar que

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 82 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

a) a primeira vírgula separa duas orações coordenadas.


E DYtUJXODDQWHVGR³H´ O RFRUUHSRUTXHRYHUERGDRUDomR³HGXURX
uma ERDKRUD´pGLIHUHQWHGRYHUERGDRUDomRDQWHULRU
F DYtUJXODDQWHVGH³VREUHYLYL´ O PDUFDDGLIHUHQoDHQWUHRVWHPSRV
YHUEDLVGH³HVWRXHVFUHYHQGR´H³VREUHYLYL´
G  D YtUJXOD TXH RFRUUH GHSRLV GR ³TXH´ O   H D TXH RFRUUH GHSRLV GH
³YLROHQWR´ l.10) estão isolando oração intercalada.
e) DVDVSDVQDVSDODYUDV³YLROHQWR´ O H³DUUHPHVVH´ O VHMXVWLILFDP
porque tais palavras pertencem ao vocabulário técnico da aviação.
50. (CESGRANRIO / IBGE / Agente de Pesquisas / 2016)
O uso das vírgulas atende ao que é preconizado pela norma-padrão da
língua portuguesa em:
a) A retirada de madeira para uso doméstico é pontual e, portanto não
deve ser comparada com os impactos, do desmatamento da Amazônia.
b) Os principais benefícios dos fogões ecológicos são: o menor consumo
de lenha e a utilização, de restos de madeira de demolição.
c) É preciso reduzir o consumo de lenha para que se consiga controlar, na
Mata Atlântica, o processo de desmatamento.
d) Segundo a OMS, a exposição à fumaça dos fogões a lenha, é a causa
da morte prematura de quase dois milhões de pessoas no mundo.
e) Algumas atividades, provocam o desmatamento na Mata Atlântica: a
caça, a abertura de trilhas, a criação de pequenas roças.
51. (CESGRANRIO / IBGE / Agente de Pesquisas / 2016)
O emprego da vírgula é gramaticalmente facultativo em
a) Cristiano estudou todo o conteúdo, ou seja, todas as três apostilas.
b) Aqui está, crianças, o que eu havia prometido.
c) Queremos ir à praia. Não será, porém, nesta viagem.
d) Hoje, mais da metade da população está acima de peso.
e) Tua irmã, aluna do quarto ano, já está dispensada.
52. (FEPESE / Ministério Público-SC / 2016) Adaptada
A frase abaixo está gramaticalmente correta.
O índice de casos da gripe H1N1 neste ano está preocupando o governo;
contribuíram para isso o número de doentes infectados e o de óbitos.
53. (ESAF / MPOG / 2015) Adaptada
O homem é um animal. Porém, não é "apenas mais um animal". Ele é único.
O ponto final do primeiro período pode ser substituído por ponto e vírgula,
sem contrariar as regras de pontuação.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 83 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

54. (IDECAN / INCA / 2017)


³3RU LVVR SHQVR R GHEDWH VREUH D OHJDOL]DomR GDV GURJDV HVWi
FRPSOHWDPHQWH XOWUDSDVVDGR´ O uso de dois-pontos ( : ) no trecho em
destaque foram utilizados para anunciar:
a) Uma causa.
b) Uma explicação enumerativa.
c) Uma síntese sobre o que foi exposto anteriormente.
d) Uma informação ligada ao que foi anunciado anteriormente.
55. (FGV / PROCURADOR / Prefeitura de Paulínia / 2016)
Observe a frase a seguir:
³2VIDQWDVPDVVmRIUXWRVGRPHGRTXHPQmRWHPPHGRQmRYrIDQWDVPDV´
Os dois pontos entre os dois segmentos da frase podem ser adequadamente
substituídos pelo seguinte conectivo:
a) pois. b) logo. c) contudo. d) entretanto. e) no entanto.
56. (FCC / TRT 11ª / Técnico / 2017)
Freud uma vez recebeu carta de um conhecido pedindo conselhos diante de
uma escolha importante da vida. A resposta é surpreendente: para as
decisões pouco importantes, disse ele, vale a pena pensar bem. Quanto às
grandes escolhas da vida, você terá menos chance de errar se escolher por
impulso.

De acordo com as estruturas linguísticas do texto, julgue o item:

No primeiro parágrafo, o sinal de dois-pontos introduz uma síntese do que


foi dito antes.
57. (FCC / TRE SP / ANALISTA / 2017)
O museu não é uma estrutura sagrada e quem o frequenta deve permanecer
em contato com a natureza do lado de fora...
Quanto à pontuação do período acima, pode-se
,DFUHVFHQWDUXPDYtUJXODLPHGLDWDPHQWHDQWHVGDFRQMXQomR³H´XPDYH]
que separaria orações com sujeitos diferentes.
,,VXEVWLWXLUDFRQMXQomR³H´SRUGRLV-pontos, pois o que se segue pode ser
entendido como uma explicação da primeira parte da frase.
,,,LVRODUFRPYtUJXODVDH[SUHVVmR³HPFRQWDWR´XPDYH]TXHVHWUDWDGH
locução adverbial, sem alteração do sentido original.
Está correto o que consta em
a) II, apenas.
b) I, II e III.
c) II e III, apenas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 84 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

d) I e III, apenas.
e) I e II, apenas..
58. (CESPE / INSS / 2016) Adaptada
Os monarcas portugueses, após o terremoto que dizimou Lisboa, se orgulhavam
de, a despeito dos destroços, terem erguido uma grande biblioteca: A real Livraria.

Acerca de aspectos linguísticos e dos sentidos do texto acima, julgue o


item que se segue. O sinal de dois-pontos empregado imediatamente após
³ELEOLRWHFD´LQWURGX]XPWHUPRGHQDWXUH]DH[SOLFDWLYD.
59. (CESPE / TELEBRAS / 2015) Adaptada
Desde 1990, no Brasil, tem havido uma melhora sistemática do coeficiente
de Gini, índice comumente utilizado para medir a desigualdade de
distribuição de renda: melhorou dos 0,603 de 1993 para os 0.501 de 2013.

No final do primeiro parágrafo, caso se substituíssem o sinal de dois-pontos


SRUYtUJXODHDSDODYUD³PHOKRURX´SRUTXHSDVVRXDFRUUHomRJUDPDWLFDO
do período seria mantida.
60. (CESPE / TRE RS / 2015) Adaptada
Mais uma vez, trata-se de uma falácia: desde sempre, figuras notórias
puxam votos, sem que isso represente prejuízo irremediável para a
democracia...

Os dois-SRQWRV HPSUHJDGRV ORJR DSyV ³IDOiFLD LQWURGX]HP XPD


enumeração.
61. (CESPE / MEC / 2015) Adaptada

Na linha 9, os dois-pontos têm a função de introduzir uma explicação


referente à informação anterior.
62. (CESPE / DEPEN / 2015) Adaptada
Uma casa tem muita vez as suas relíquias, lembranças de um dia ou de
outro, da tristeza que passou, da felicidade que se perdeu.
O emprego de dois-pontos em substituição à vírgula logo após a expressão
³VXDVUHOtTXLDV´QmRJHUDULDHUURJUDPDWLFDO
63. (CESPE / FUB / 2015) Adaptada
O levantamento mostra significativo avanço da Unb. O salto qualitativo
deve-se a três fatores: o corpo docente, o impacto na Internet e a reputação

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 85 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

acadêmica.
O sinal de dois-SRQWRV HPSUHJDGR ORJR DSyV ³IDWRUHV´ LQWURGX] XPD
enumeração.
64. (FGV / CODEBA / 2016) Adaptada
Fantasma: o sinal exterior e visível de um medo interior.
Nessa frase ocorre o emprego de dois pontos (:) com a seguinte finalidade:
a) indicar o significado de um termo anterior.
b) preceder uma enumeração de termos.
c) marcar uma citação.
d) introduzir uma síntese do que foi enunciado.
e) separar o vocativo.
65. (ESAF / FUNAI / Contador / 2016)
Assinale o trecho em que foram plenamente atendidas as regras de emprego
dos sinais de pontuação.
a) No Brasil, a função do índio romântico foi significativa e extravasou do
campo da literatura. Já inexistente nas regiões civilizadas, o índio se tornou
a imagem ideal, que permitia, a identificação do brasileiro com o sonho de
originalidade e de passado honroso; além de contribuir para reforçar o
sentimento de unidade nacional.
b) Como escreveu Roger Bastide, o índio romântico serviu de álibi para se
conceituar, de maneira confortadora, a mestiçagem, que lhe foi atribuída
estrategicamente. A mestiçagem com o negro, mais frequente, era
considerada humilhante em virtude da escravidão.
c) O indianismo criou um antepassado mítico a quem foram atribuídas
arbitrariamente virtudes convencionais, incluindo-se, as relacionadas ao
cavaleiro medieval, tão em voga, na literatura romântica.
d) Até hoje é geral, o uso de prenomes e sobrenomes indígenas, não raro
tomados de textos literários; a própria Monarquia ao distribuir títulos de sua
nobreza improvisada, associouos à convenção nativista, em combinações
pitorescas como: barão de Pindamonhangaba, marquês de Quixeramobim...
e) Função paralela à do índio, foi exercida no Romantismo, pela exaltação
à natureza. Com efeito, na falta de uma ilustre tradição local que permitisse
evocar paladinos e varões sábios desde a Antiguidade (como ocorria na
Europa) a natureza brasileira entrou, de certo modo, em seu lugar como
motivo de orgulho.
66. (Vunesp / MPE SP / Analista Científico / 2016)
Assinale a alternativa em que os sinais de pontuação estão empregados
segundo os mesmos princípios da norma padrão adotados na passagem ±
com certa diferença na duração do mandato: o dos senadores, mais longo;
o dos deputados, mais curto.
a) A separação os fez perder muita coisa: ele, a guarda dos filhos; ela, a
casa em que morava com as crianças.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 86 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

b) Há algo importante a explicar: a perda de clientes, muitos deles


inadimplentes; entretanto, ninguém fala nada.
c) Os meios de divulgação são os seguintes: internet, mensagem de celular
e jornais; com eles, atingiremos o público.
d) Foi o que disse o funcionário: o carregamento não chegou, ainda; e os
pedidos estão se acumulando, mais e mais.
e) Fui reticente, mas agora me explico: meu dinheiro acabou, nada me
resta; e meu pai não pode me ajudar, coitado.
67. (FUNCAB / EMSERH / Auxiliar Operacional / 2016)
A carta de amor
No momento em que Malvina ia por a frigideira no fogo, entrou a
cozinheira com um envelope na mão. Isso bastou para que ela se tornasse
nervosa. Seu coração pôs-se a bater precipitadamente e seu rosto se
afogueou. Abriu-o com gesto decisivo e extraiu um papel verde-mar, sobre
RTXDOVHOLDPHPFDUDFWHUHVHQHUJpWLFRVPDVFXOLQRVHVWDVSDODYUDV³9RFr
VHUiDPDGD´
2V³WUrVSRQWRVGHUHWLFrQFLDV´QDIUDVHHVFULWDQRSDSHOYHUGH-mar indicam:
a) introdução à fala de um personagem.
b) realce da palavra anterior ao sinal.
c) indicação de uma transcrição.
d) interrupção da frase.
e) fim da ação verbal.
68. (Copeve / UFMS / 2016)

$VUHWLFrQFLDV³´SUHVHQWHVQRVEDO}HVGHGLiORJRGDFKDUJHVmRXVDGDVSDUD
a) Criar um suspense sobre o que está sendo discutido pela África.
b) Indicar entusiasmo na fala da África.
c) Demonstrar que a fala da África tem continuidade.
d) Evitar repetição.
e) Deixar o texto ambíguo. -

69. (CESPE / Téc. Judiciário / STJ / 2012) Adaptada


A um coronel que se queixava da vida no quartel, um jornalista disse:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 87 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

² O senhor não sabe como é chato militar na imprensa.


Com relação às ideias e aos aspectos linguísticos do trecho acima, julgue os
itens a seguir.
2SRQWRILQDOHPSUHJDGRORJRDSyV³LPSUHQVD´poderia ser corretamente
substituído por reticências.
70. (IESES / Bioquímico-Pref. SJC / 2017)
Analise as proposições a seguir sobre a pontuação do seguinte trecho:
Curiosamente, uma das formas de manifestar chateação, com perdão da
H[SUHVVmR p ³S  TXH R SDULX´ $TXL R SURQRPH REOtTXR DSDUHFH
Entretanto, ninguém vai dizer que esse é um argumento para sustentar que
o pronome oblíquo está vivo. Se disser...
I. A primeira vírgula é opcional, ou seja, sua presença é apenas um recurso
de entonação.
II. A segunda e a terceira vírgula estão isolando uma oração explicativa.
III. As aspas foram empregadas para indicar que a expressão é própria da
linguagem verbal.
IV. O segundo ponto de exclamação que aparece no trecho foi empregado
para indicar espanto.
Agora assinale a alternativa que contenha análise correta sobre as
proposições.
a) Estão corretas apenas as proposições I, II e IV.
b) Estão corretas apenas as proposições I, III e IV.
c) Estão corretas apenas as proposições II e IV.
d) Estão corretas apenas as proposições I e III
71. (CESPE / TJ DFT / 2015) Adaptada

Acerca dos aspectos linguísticos do texto apresentado, julgue o item


seguinte.
No primeiro parágrafo, as aspas foram empregadas em trechos que

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 88 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

reproduzem discursos de outras pessoas, e não da autora do texto.


72. (ESAF / MPOG / 2015) Adaptada
O homem é um animal. Porém, não é "apenas mais um animal". Ele é único.
O autor grafou a expressão "apenas mais um animal" entre aspas
para atribuir-lhe um tom sarcástico e negativo.
73. (CESPE / TRE RS / 2015) Adaptada

As aspas foram empregadas tanto em 'doações' (l.21) quanto em 'gratuita'


(l.23) com a mesma finalidade.
74. (FGV / CODEMIG / 2015) Adaptada
Desde 2008, o ibope pergunta à população em idade de votar quão satisfeita
ela está com o funcionamento da democracia no Brasil. Os resultados nunca
foram brilhantes ainda menos se comparados com países latino-americanos
como Uruguai e Argentina, mas jamais haviam sido tão chocantes quanto
DJRUD 6y  GRV EUDVLOHLURV VH GL]HP ³VDWLVIHLWRV  RX ³PXLWR
satisfeitos" (1%) com o jeito que o regime democrático funciona no país.
(Estado de São Paulo, 04/09/2015)

2VWHUPRV³VDWLVIHLWRVH³PXLWRVDWLVIHLWRVDSDUHFHPHQWUHDVSDVSRUTXH
a) destacam elementos importantes no contexto;
b) mostram termos técnicos da pesquisa;
c) indicam respostas dos entrevistados;
d) apontam a presença de tom irônico;
e) demonstram a precisão da pesquisa.
75. (IDECAN / INCA / 2017)
Em ³6H LQVLVWLUPRV QRV GRJPDV GLWRV UHYROXFLRQiULRV ± como a luta de
classes e a demonização da iniciativa privada ±, não sairemos do
LPSDVVH TXH LQYLDELOL]RX R UHJLPH FRPXQLVWD RQGH HOH VH LPSODQWRX´, a
vírgula logo após o segundo travessão
a) tem seu emprego justificado já que separa oração adverbial anteposta

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 89 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

à principal, conferindo correção gramatical ao trecho.


b) é facultativa, seu emprego advém da necessidade de ser atribuída uma
maior ênfase à oração imediatamente posposta.
c) é obrigatória e separa objetos pleonásticos conferindo à argumentação
a ênfase necessária à compreensão do discurso apresentado.
d) poderia ser omitida preservando-se a correção gramatical do texto já
que seu emprego tem por objetivo apenas conferir ênfase à informação
limitada pelos travessões.
76. (CESPE / MEC / 2015) Adaptada

Na linha 5, o emprego do travessão tem a função de enfatizar a ausência de


contato humano nas atividades realizadas no cotidiano, que são narradas
no primeiro parágrafo.
77. (FCC / SEDUS / 2016) Adaptada
Em 1596, William Shakespeare e seus atores tiveram de deixar o teatro
isabelino The Theatre, localizado em Shoreditch, em Londres, até então o
recanto da dramaturgia inglesa. O período de 21 anos de concessão do
terreno ao ator e empresário James Burbage havia chegado ao fim, e o
senhorio exigia as terras de volta. Desolados, Shakespeare e os homens de
VXDFRPSDQKLD/RUG&KDPEHUODLQ
V0HQVHXQLUDPSDUDURXEDURWHDWURí
WiEXDSRUWiEXDSUHJRSRUSUHJRíHUHFRQVWUXt-lo em outro lugar.

1RWH[WRDIXQomRGRVWUDYHVV}HVHP³íWiEXDSRUWiEXDSUHJRSRUSUHJR
í´ é destacar o modo de realização da ação verbal.
78. (CESPE / MEC / 2015) Adaptada
Em terra, se você subisse em uma construção de 150 metros² a catedral
de Colônia ou o monumento de Washington, digamos², a mudança de
pressão, de tão pequena, seria imperceptível.
Julgue: O emprego da vírgula após o travessão é facultativo.
79. (FCC / TRT MT / 2016) Adaptada
Além disso, do manual de instruções de um aparelho eletrônico à numeração
das linhas de ônibus, passando pelo desenho das vias urbanas, pelos
impostos escorchantes e pelas regras que somos obrigados a obedecer ±
inclusive nos atos mais simples, como o de andar a pé í, há uma evidente
arbitrariedade, às vezes melíflua, às vezes violenta, que se insinua no
cotidiano.
A vírgula colocada imediatamente após o travessão pode ser suprimida, sem

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 90 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

prejuízo da correção e do sentido.


80. (FCC / TRT MT / 2016) Adaptada
Com respeito à pontuação, atente para as seguintes afirmações:
Mas eu jamais seria capaz de reconhecer uma árvore de mulungu. Um
dia, procurei no dicionário e descobri que mulungu é o mesmo que
corticeira e que também é conhecido pelo nome de flor-de-coral. ''Árvore
regular, ornamental, da família das leguminosas, originária da Amazônia
e de Mato Grosso, de flores vermelhas, dispostas em racimos multifloros,
sendo as sementes do fruto do tamanho de um feijão (mentira!), e
vermelhas com mácula preta (isto, sim)'', dizia.
No parágrafo, os parênteses indicam juízos da escritora, que, portanto, não
constam da definição encontrada no dicionário.
81. (FGV / Prefeitura de Paulínia / 2016)
³3DUD HIHLWR GH FRPSDUDomR   D PpGLD GH PRUWHV QR ,UDTXH QD ~OWLPD
década,(2) país que está em guerra,(3) foi de 550 mil. No mesmo
período,(4) o Brasil registrou a mesma quantidade de mortes. Segundo o
Relatório Global sobre Homicídios da ONU,(5) em 2012,(6) o país,(7) que
representa 3% da população mundial,(8) registrou 10% dos homicídios
ocorridos em todo o mundo".
Nesse segmento do texto 2, há oito ocorrências de vírgula, devidamente
numeradas; a afirmação correta sobre o emprego desse sinal de pontuação
é:
a) os casos 7 e 8 marcam a presença de um aposto;
b) os casos 1 e 5 mostram a mesma razão para a vírgula;
c) os casos 2 e 3 marcam uma inversão de termos;
d) o caso 4 marca uma explicação;
e) o caso 6 indica uma enumeração.
82. (ESAF / Despachante Aduaneiro / 2016)
Assinale a opção que apresenta a versão que está gramaticalmente correta
e que preserva as ideias gerais do Texto.
Quem olhar a carta geográfica da região amazônica, verificará que essa
larga faixa, representa uma vasta e praticamente desconhecida região.
83. (ESAF / Despachante Aduaneiro / 2016)
Julgue o item a seguir.

A ideia de que tais áreas periféricas escapam das prioridades nacionais é


um dos inúmeros mitos que cercam a região, porque essa região, não afeta
a vida no resto desses países.
84. (ESAF / Despachante Aduaneiro / 2016)
³4XHPROKDUFRPDOJXPDDWHQomRDFDUWDJHRJUiILFDGD$PpULFDGR6XOH
mais precisamente, da região amazônica, verificará que a larga faixa que se

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 91 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

estende ao longo das fronteiras do Brasil com seus vizinhos a norte e a oeste
UHSUHVHQWDXPDYDVWDUHJLmRSUDWLFDPHQWHGHVFRQKHFLGD´
Assinale a opção correta referente às estruturas linguísticas desse trecho.
a) A retirada da segunda vírgula que separa o DGMXQWR DGYHUELDO ³FRP
DOJXPDDWHQomR´PDQWHULD gramaticalmente correto esse trecho.
E $VH[SUHVV}HV³FRPDOJXPDDWHQomR´H³PDLV SUHFLVDPHQWH´HVWDEHOHFHP
entre si uma relação de gradação de sentido.
F 2VXMHLWRGH³YHULILFDUi´p³UHJLmRDPD]{QLFD´ expressão que poderia ser
corretamente substituída, nesse trecho, pelo pronome ela.
G  $ RUDomR LQWURGX]LGD SRU ³TXH´ DSyV ³YHULILFDUi´ é uma oração
subordinada substantiva subjetiva.
H 2YHUER³UHSUHVHQWD´WHPFRPRVXMHLWR³XPD vasta região praticamente
GHVFRQKHFLGD´.
85. (FCC / TRE SP / Analista / 2017)
Atente para as seguintes frases:
I. O sentido controverso da palavra discussão, deve-se ao modo pelo qual
costumam agir, os contendores, ao exporem seus argumentos.
II. Há discussões nas quais, por excesso de paixão, os argumentos sequer
são considerados, dada a exacerbação dos ânimos.
III. Parece improvável que numa discussão acirrada, possa imperar a
racionalidade dos argumentos que sequer são analisados.
Quanto à virgulação, está inteiramente correto o que consta APENAS em
a) II.
b) I.
c) III.
d) I e II.
e) II e III.
86. (ESAF / Adido Agrícola / 2017)
Em relação às estruturas sintáticas do texto, assinale a opção correta.
A agricultura no Brasil tem natureza dualista, pois coexistem a produção de
grande escala e as propriedades agrícolas tradicionais, com milhares de
pequenos agricultores produzindo, com recursos reduzidos, para próprio
consumo ou para mercados locais. Porém, a lacuna no desempenho do
trabalho na agricultura está declinando, com melhorias rápidas na
produtividade, impulsionadas principalmente pela maior produção de capital
intensivo. Parte desse crescimento ocorreu nas propriedades agrícolas de
pequeno porte que produzem produtos de alto valor.
D  2 HPSUHJR GH YtUJXOD DSyV ³GXDOLVWD´ O   MXVWLILFD-se porque isola
oração subsequente com a noção de consequência.
E $H[SUHVVmR³FRPUHFXUVRVUHGX]LGRV´ O3) está entre vírgulas porque
se trata de aposto.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 92 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

F 2WHUPR³3RUpP´ O 4) confere ao período uma noção de condição em


relação às informações anteriores.
G  2 WHUPR ³LPSXOVLRQDGDV´ O 6) está no plural para concordar com o
DQWHFHGHQWH³PHOKRULDVUiSLGDV´ O5).
e) Mantém-se a mesma relação sintática entre as orações ao se empregar
XPDYtUJXODDSyV³SHTXHQRSRUWH´ O8).

Lista de mais questões comentadas

87. (CONSULPLAN / (TJ MG) / DIREITO / 2017)


O apocalipse digital
O problema não são os equipamentos eletrônicos. O problema é que
criamos diante da correspondência digital uma atitude ansiosa e passiva.
Deu no jornal que o primeiroǦministro da Bélgica, Elio Di Rupo, interrompeu
um discurso que fazia no Parlamento para atender e responder a uma
mensagem pelo celular. A discussão na imprensa (e entre as pessoas que
leram a notícia) acabou tendendo na direçãRGR³DSRFDOLSVHGLJLWDO´eDOJR
mais previsto e mais anunciado do que o fim do mundo pelo Calendário
Maia. O apocalipse digital, segundo os seus profetas, é um processo
acelerado de despersonalização das relações humanas face a face, que
serão substituídas pelas engenhocas eletrônicas: computadores, notebooks,
palmtops, smartphones, tablets etc. As pessoas só falarão umas com as
outras por meio desses aparelhos.
Ninguém vai mais sair de casa para visitar os amigos: ficarão conversando
pelo Messenger ou pelo Skype. E um dos primeiros sinais disso é que
qualquer conversa face a face é interrompida se o aparelho de alguém tocar.
O aparelho tem sempre prioridade, como comprovou o ministro belga.
Eu detestaria viver num mundo onde as pessoas não saíssem mais juntas,
não conversassem olhando para o rosto da outra, e tudo o mais. Sinto falta
(por exemplo) do tempo em que alguns amigos passeavam juntos,
conversando. LembramǦse disso? É excêntrico, mas se praticava bastante.
As pessoas se encontravam e saíam andando pela calçada, conversando
sobre qualquer assunto, e percorrendo cinco, dez, 15 ou 20 quarteirões até
chegarem ao lugar para onde se dirigiam, ou então até avistarem por acaso
um café simpático ou uma praça acolhedora e fazerem ali uma parada. Hoje
ninguém caminha mais.
Todo mundo vai de carro até para uma distância de dois quarteirões. Se
você disser que quer caminhar de uma ponta à outra da Avenida Paulista ou
da Rio Branco, vão dizer que você não está regulando bem. Quem vai dizer
isso são pessoas que andam 50 minutos de carro até uma academia, onde
pagam uma nota preta para ficar andando numa esteira que não sai do
lugar.
O ministro belga calaria os críticos se provasse que o torpedo recebido
durante o discurso era de um assessor ou secretário enviando Ǧlhe uma

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 93 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

informação essencial para aquele pronunciamento público. Só isso (no meu


entender) o redimiria; mas é bem capaz de ter sido a mulher dele
perguntando: ³Vai dar tempo de irmos à ópera hoje?´, ou algo assim.
O problema não são os equipamentos eletrônicos. O problema é que criamos
GLDQWH GD FRUUHVSRQGrQFLD GLJLWDO XPD DWLWXGH DQVLRVD ³SUHFLVR
XUJHQWHPHQWH VDEHU TXH UHFDGR p HVWH´  H SDVVLYD ³VH D PHQVDJHP
FKHJRXWHQKRGHREHGHFHUWHQKRGHROKDU´).
(Braulio Tavares. Disponível em:
http://www.cartafundamental.com.br/single/show/80. Publicado em:
Nov./2013. Adaptado.)
Analise as justificativas para o emprego da vírgula nas seguintes
orações e assinale a INCORRETA.
A  ³e H[FrQWULFR PDV VH SUDWLFDYD EDVWDQWH´ ž†  ± separar oração
coordenada sindética
B  ³2 DSRFDOLSVH GLJLWDO VHJXQGR RV VHXV SURIHWDV p XP SURFHVVR >@´
(1º§) ± separar termos explicativos
C  ³>@ FRPSXWDGRUHV QRWHERRNV SDOPWRSV VPDUWSKRQHV WDEOHWV HWF´
(1º§) ± separar elementos enumerativos
D  ³'HX QR MRUQDO TXH R SULPHLURǦministro da Bélgica, Elio Di Rupo,
interrompeu um discurso [...]´ (1º§) ± separar vocativo.
88. (CONSULPLAN / TÉC. EM ENFERMAGEM / 2017)
As famílias da sociedade órfã
A família transformou-se em bode expiatório das mazelas de nossa
sociedade. Crianças se descontrolam, brigam, desobedecem? Jovens fazem
algazarras, bebem em demasia, usam drogas ilegais, namoram
escandalosamente em espaços públicos? Faltou educação de berço. Como é
ERPWHUXPD³*HQL´SDUDQHOD atirar todas as pedras, principalmente quando
se trata dos mais novos.
Até o Secretário Estadual da Educação de São Paulo, em um artigo de sua
DXWRULDSDUDGHIHQGHUVXDWHVHGHTXHHVWDPRVYLYHQGRHPXPD³VRFLHGDGH
yUIm´LQLFLDVXDVMXVWLILFDWLYDVDILUPDQGRTXH³DIUDJPHQWDomRGDIDPtOLD
a perda de importância da figura paterna ± e também a materna ± a
irrelevância da Igreja e da Escola em múltiplos ambientes geram um
FRQYtYLRDPRUIR´
As escolas também costumam agir assim: quando um aluno é considerado
problemático e indisciplinado, ou apresenta um ritmo de aprendizagem
diferente do esperado pela instituição, a família é chamada para resolver o
³SUREOHPD´
9DPRV UHIOHWLU VREUH H[SUHVV}HV XVDGDV D UHVSHLWR GD IDPtOLD ³IDPtOLD
IUDJPHQWDGD´³IDPtOLDGHVHVWUXWXUDGD´³IDPtOLDGLVIXQFLRQDO´³IDPtOLDVHP
YDORUHV´ H RXWUDV VHPHOKDQWHV 1mR OKH SDUHFH FDUR OHLWRU TXH WDLV
expressões apontam na direção de que a família decidiu entornar o caldo da
sociedade?
Não é a família que está fragmentada: é a vida. Hoje, os tratamentos

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 94 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

médicos, o conhecimento, as metodologias, as relações interpessoais, as


escolas, o Estado etc. estão fragmentados. Mesmo não sendo a família um
agente passivo nesse contexto, é salutar lembrar que ela se desenvolve
conectada ao clima sociocultural em que vive.
A família não está desestruturada ou disfuncional: ela passa por um período
de transição, com sucessivas e intensas mudanças, o que provoca uma
redefinição de papéis e funções. Esse processo está em andamento, o que
nos permite falar, hoje, não em família, mas em famílias, no plural, já que
há grande diversidade de desenhos, dinâmicas etc.
As famílias não estão sem valores: elas têm valores fortes, em sua maioria
eleitos pelas prioridades que a sociedade determina. O consumo é um deles:
as famílias não decidiram consumir cada vez mais, foi o sistema econômico
que apontou esse valor para elas.
Há problemas com a escola, sim: ela tem ensinado sem educar devido,
principalmente, à primazia do conteúdo ± que insisto em dizer que não é
conhecimento ±, às políticas públicas adotadas e à ausência de outras,
prioritárias. Por isso, a escola tem tido um papel irrelevante na formação
dos mais novos.
Há famílias em situações de risco e fragilidade? Há. A escola perdeu sua
importância na socialização de crianças e jovens? Sim. Mães e pais podem
estar mais ocupados com suas vidas do que com os filhos? Sim. Mas isso
ocorre porque as ideologias socioculturais da juventude, do sucesso e da
instantaneidade ganharam grande relevância, e não há políticas públicas ±
de novo ± que busquem equilibrar tal contexto. E, mesmo assim, têm sido
as famílias a instituição protetora dos mais novos!
A sociedade não precisa, tampouco demanda, que o Estado exerça a função
de babá, de pai ou de mãe. Ela necessita que o Estado reconheça, na prática,
que as famílias e a escola dependem de ações públicas de apoio ao seu pleno
desenvolvimento e que garantam os seus direitos.
(Rosely Saião. Disponível em:
http://www1.folha.uol.com.br/colunas/roselysayao/2016/04/1759920-as-
familias-da-sociedade-orfa.shtml.)
³1mR OKH SDUHFH caro leitor, que tais expressões apontam na
GLUHomRGHTXHDIDPtOLDGHFLGLXHQWRUQDURFDOGRGDVRFLHGDGH"´2
trecho sublinhado apresenta-se entre vírgulas porque trata-se de
A) um vocativo.
B) uma enumeração.
C) uma expressão explicativa.
D) um adjunto adverbial deslocado.
E) elementos coordenados assindéticos.
89. (CONSULPLAN / TJMG / SERV. SOCIAL / 2016)
Ódio ao Semelhante ± Sobre a Militância de Tribunal

Ninguém pode negar o conflito como parte fundamental do fenômeno

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 95 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

político. Só existe política porque existem diferenças, discordâncias, visões


de mundo que se distanciam, ideologias, lutas por direitos, por hegemonia.
Isso quer dizer que no cerne do fenômeno político está a democracia como
um desejo de participação que implica as tenções próprias à diferença que
busca um lugar no contexto social. [...]
Esse texto não tem por finalidade tratar da importância do conflito ou da
crítica, mas analisar um fenômeno que surgiu, e se potencializou, na era
GDV UHGHV VRFLDLV D ³PLOLWkQFLD GH WULEXQDO´ (VVD SUiWLFD p DSUHVHQWDGD
como manifestação de ativismo político, mas se reduz ao ato de proferir
julgamentos, todos de natureza condenatória, contra seus adversários e,
muitas vezes, em desfavor dos próprios parceiros de projeto político. São
típicos julgamentos de excessão, nos quais a figura do acusador e do
julgador se confundem, não existe uma acusação bem delimitada, nem a
oportunidade do acusado se defender. Nesses julgamentos, que muito
UHYHODGR³PLOLWDQWHGHWULEXQDO´RVHYHQWXDLVHUURVGR³DFXVDGR´SRUXP
lado, são potencializados, sem qualquer compromisso com a facticidade; por
outro, perdem importância para a hipótese previamente formulada pelo
acusador-julgador, a partir de preconceitos, perversões, ressentimentos,
inveja e, sobretudo, ódio.
ÏGLRGLUHFLRQDGRDRLQLPLJRDTXHOHFRPRTXDOR³DFXVDGRU-MXOJDGRU´QmR
se identifica e, por essa razão, nega a possibilidade de dialogar e, o que tem
se tornado cada vez mais frequente, o ódio relacionado ao próximo, aquele
que é, ou deveria ser, um aliado nas trincheiras políticas. Ódio que nasce
GDTXLORTXH)UHXGFKDPRXGH³QDUFLVLVPRGDVSHTXHQDVGLIHUHQoDV´ÏGLR
ao semelhante, aquele que admiramos, do qual somos ³SDUFHLURV´DRTXDO
contudo, dedicamos nosso ódio sempre que ele não faz exatamente aquilo
que deveria ± ou o que nós acreditamos que deveria ± fazer.
Exemplos não faltam. Pense-se na militante feminista que gasta mais tempo
D ³FRQGHQDU´ RXWUDV PXOKHUHV D MXOJDU RXWURV ³IHPLQLVPRV´ GR TXH QR
enfrentamento concreto à dominação masculina. A Internet está cheia de
exemplos de especialistas em julgamento e condenação. A caça por sucesso
QDTXLORTXHLPDJLQDPVHUR³FOXELQKR GDVIHPLQLVWDV´ SRUPXLWDVTXHVH
dizem feministas enquanto realizam o feminismo como uma mera moral)
tem algo da antiga caça às bruxas que regozija até hoje o machismo
HVWUXWXUDO 1XQFD VH YHUi D ³PLOLWDQWH GH WULEXQDO IHPLQLVWD´ HP DWLWXGH
isenta elogiando a postura correta, mas sempre espetacularizando a postura
³HUUDGD´ GDTXHOD TXH GHVHMD FRQGHQDU 0XLWDV FRQVWURHP VHXV QRPHV
virtuais, seu capital político, aquilo que imaginam ser um verdadeiro
protagonismo feminista, no meio dessas pequenas guerras e linchamentos
virtuais nas quais se consideram vencedoras pela gritaria. Há, infelizmente,
feministas que se perdem, esvaziam o feminismo e servem de espetáculo
àqueles que adoram odiar o feminismo. [...] Apoio mesmo, concreto, às
grandes lutas do feminismo, isso não, pois não é tão fácil nem deve dar
tanto prazer quanto a condenação no tribunal virtual montado em sua
própria casa. [...]
(Marcia Tiburi e Rubens Casara. Disponível em:
http://revistacult.uol.com.br/home/2016/01/odio-ao-semelhante-sobre-a-
militanciadetribunal/.Publicado dia: 10/01/2016. Adaptado.)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 96 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

Considerando-se a adequação do texto de acordo com a norma


padrão da língua, assinale a alternativa cuja indicação apresenta-se
correta em relação às regras de pontuação.
A) Seria gramaticalmente correto o emprego de dois-pontos após ³H[LVWHP´
(1º§).
B  &RP R REMHWLYR GH GDU GHVWDTXH j SDODYUD ³FRQIOLWR´ ž†  VHULD
gramaticalmente correto separar tal vocábulo colocando-o entre vírgulas.
C) No 2º§, seria gramaticalmente correto o emprego de um travessão
imediatamente antes do primeiro ³PDV´HPVXEVWLWXLomRjYtUJXODXWLOL]DGD
indicando o ponto de vista dos autores do texto.
D 'RSRQWRGHYLVWDJUDPDWLFDODVYtUJXODVTXHVHSDUDPDH[SUHVVmR³HVH
SRWHQFLDOL]RX´ ž†  SRGHULDP VHU UHWLUDGDV GHVGH TXH RV GRLV SRQWRV GR
período fossem UHWLUDGRVHFRORFDGRVDSyV³SRWHQFLDOL]RX´
90. (CONSULPLAN / MOTORISTA / 2016)
1R WUHFKR ³'HQRPLQD-se gravidez na adolescência a gestação
ocorrida em jovens de até 21 anos que se encontram, portanto, em
pleno desenvolvimento dessa fase da vida ± a adolescêQFLD´ R
travessão foi utilizado para
A) inserir dúvida.
B) assinalar estrangeirismo.
c) realizar citação incompleta.
d) separar expressão explicativa.
e) indicar possibilidade alternativa de leitura.
91. (CONSULPLAN / AUX. ADM. (CM CARATINGA) / 2015)
No WUHFKR³$LPSODQWDomRGR6LVWHPDIRLGHJUDQGHYDOLDQRVHWRUGD
saúde do brasileiro, porém, hoje, sabeǦse que esse Sistema não
funciona essencialmente conforme seus princípios: saúde como
direito de todos, pregando pela Universalidade, Equidade e
Integralidade da atenção à saúde da populaçãR EUDVLOHLUD´ ž† 
os dois pontos ( : ) foram utilizados para
A) esclarecer algo.
B) finalizar frase imperativa.
C) marcar pausa de curta duração.
D) separar orações coordenadas adversativas.
92. (CONSULPLAN / MOTORISTA (Patos de Minas) / 2015)
1R WUHFKR ³0XWDo}HV HP WDLV SURWHtQDV SURYRFDULDP GHVHTXLOtEULR
entre essas funções antagônicas e afetariam o aprendizado, a
OLQJXDJHP D FRPXQLFDomR VRFLDO H D PHPyULD´ ž†  Ds vírgulas
foram utilizadas para
A) exprimir surpresa ou espanto.
B) marcar pausa de curta duração.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 97 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

C) separar elementos coordenados.


D) indicar interrupção do pensamento.
93. (CONSULPLAN/ AUXILIAR DE LABORATÓRIO / 2015)
Pequenas ações mudam o mundo
Com atos simples, adotados no dia a dia, todos podem contribuir para evitar
o desperdício, tirando proveito do meio ambiente de forma sustentável.
Há uma semana, pessoas do mundo inteiro apagaram suas luzes
voluntariamente na Hora do Planeta, um evento que contou com a
participação de 125 países. Medidas como esta, de economizar energia
elétrica, além de conscientizar a população sobre as questões ambientais,
contribuem para a preservação do meio ambiente.
Adotar práticas sustentáveis tais como dar preferência a produtos
ecologicamente corretos, reciclar, evitar desperdícios, não jogar lixo nas
ruas e plantar mais árvores são outras medidas sugeridas pelo professor de
Direito Ambiental, membro da comissão de Meio Ambiente da OAB, o
advogado e biólogo Victor Sarmento.
Mais do que diminuir a conta no final do mês, economizar energia elétrica
UHGX] R FRQVXPR GH iJXD QDV XVLQDV KLGUHOpWULFDV ³'HPRUDU PHQRV QR
banho, desligar o chuveiro na hora que estiver se ensaboando, verificar se
as torneiras estão bem fechadas e não lavar calçadas também são
procedLPHQWRVLPSRUWDQWHV´OHPEURX
³'HPRUDUPHQRVQREDQKRGHVOLJDURFKXYHLURQDKRUDTXHHVWLYHU
se ensaboando, verificar se as torneiras estão bem fechadas e não
ODYDUFDOoDGDVWDPEpPVmRSURFHGLPHQWRVLPSRUWDQWHV´OHPEURX
As aspas foram utilizadas no trecho anterior com a função de
A) indicar uma citação.
B) separar uma explicação.
C) indicar o uso da linguagem informal.
D) separar uma enumeração de ações.
E) isolar explicações.
94. (CONSULPLAN / (TJ MG) / DIREITO / 2014)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 98 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

(P ³'H  RX  JLJDV "´ o uso dos pontos de interrogação e
exclamação ( ?! ) justificaǦse por
A) reforçar a confirmação do objeto encontrado.
B) estar muito espantado com a descoberta do menino.
C) não aguentar esperar para saber as informações sobre o objeto.
D) questionar o item encontrado, assim como estar surpreso, não
acreditando na descoberta.
95. (CONSULPLAN / AG. ADM. (CANTAGALO) /2013)
(P³8PDYH]GHFLGLGRTXHQmRVHTXHUPDLVRVDJXLRTXHID]HUFRP
RDQLPDO"´RSRQWRGHLQWHUUogação ( ? ) foi utilizado para
A) assinalar gírias.
B) exprimir indignação.
C) marcar uma abreviatura.
D) marcar um questionamento.
E) indicar a continuação de um fato.
96. (CONSULPLAN / SERVIÇOS GERAIS / CISAMAPI / 2011)
Isso é muita sabedoria
Quando fazemos tudo para que nos amem e não conseguimos, resta-nos
um último recurso: não fazer mais nada. Por isso, digo, quando não
obtivermos o amor, o afeto ou a ternura que havíamos solicitado, melhor
será desistirmos e procurar mais adiante os sentimentos que nos negaram.
Não fazer esforços inúteis, pois o amor nasce, ou não, espontaneamente,
mas nunca por força de imposição. Às vezes, é inútil esforçar-se demais,
nada se consegue; outras vezes, nada damos e o amor se rende aos nossos
pés.
Os sentimentos são sempre uma surpresa. Nunca foram uma caridade
mendigada, uma compaixão ou favor concebido. Quase sempre amamos a
quem nos ama mal, e desprezamos quem melhor nos quer. Assim, repito,
quando tivermos feito tudo para conseguir um amor, e falhado, resta nos
um só caminho... o de mais nada fazer.
(Clarice Lispector)
(P³2VVHQWLPHQWRVVmRVHPSUHXPDVXUSUHVD´RSRQWRILQDO  
foi utilizado para
A) realizar um questionamento, uma pergunta.
B) demonstrar espanto.
C) realizar enumeração.
D) finalizar a afirmativa.
E) isolar explicações.
97. (CONSULPLAN / PREF. CASCAVEL / TÉC. TOPOG. / 2016)
³e IiFLO HQWHQGHU RV PRWLYRV TXH OHYDP RV PDLV MRYHQV D VHUHP

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 99 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

frequentadores assíduos desses canais: estão isolados, sem espaços


S~EOLFRVSDUDHQFRQWUDURXWUDVFULDQoDVHSDUDEULQFDU´
No trecho destacado, os dos dois-pontos foram utilizados para
a) indicar um resumo do que foi dito antes.
b) anunciar uma citação dentro de um discurso.
c) anunciar as consequências do uso da internet.
d) anunciar uma informação que se opõe à anterior.
e) indicar as causas de um resultado anunciando anteriormente.
98. (CONSULPLAN / PREF. CASCAVEL / AG. COMUN. / 2016)
³4XDVHPHWDGHGRVQRYRVFDVRVGH$,'6RFRUUHHQWUHRVMRYHQVFRPLGDGH
HQWUHHDQRV´
No trecho anterior, o ponto final ( . ) foi utilizado para
a) marcar uma transcrição.
b) enfatizar uma expressão.
c) anteceder uma explicação.
d) indicar dúvida ou incerteza.
e) marcar pausa de longa duração.
99. (CONSULPLAN / ENGENHEIRO / 2015)
Recomeço: a vida dos refugiados sírios em São Paulo
A construção linguística empregada na frase indica que o sinal de dois
pontos foi utilizado com o propósito de introduzir um(a)
a) conclusão, justificativa.
b) adendo que se intercala no discurso.
c) conceito para a expressão que o antecede.
d) especificação, detalhamento de uma informação.
100. (CONSULPLAN / TRE-MG / TÉCNICO / 2015)
Em relação à pontuação, assinale o trecho do texto que está de
acordo com as normas gramaticais da língua portuguesa.
D ³(QWUHWDQWRHVVHVGLUHLWRVQHPVHPSre são respeitados e, ainda, cabe a
sua regulamentação."
E  ³(QWmR MXULGLFDPHQWH IDODQGR SDUD TXH R DQLPDO WHQKD R VHX GLUHLWR
exercido, é necessário que alguém responda por ele, por isso cabe ao dono
o dever de guarda ou controle."
F  ³0DV DR FRQtrário do que muita gente pensa, não existem direitos
específicos para os animais de estimação. Como parte do meio ambiente
eles têm proteção garantida contra práticas que os submetem à crueldade."
G  ³( QR GLUHLWR EUDVLOHLUR XP DQLPDO p FRQVLGHUDGR XPD FRLVD GLItFLO GH
entender, pois, 'coisa' dá uma ideia de algo inanimado, mas talvez seja pelo

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 100 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

fato de um animal não possuir personalidade jurídica, não respondendo


assim pelos seus atos."
101. (CONSULPLAN / PREF. CARATINGA / AUX. ADM. / 2015)
No trecho ³$LPSODQWDomRGR6LVWHPDIRLGHJUDQGHYDOLDQRVHWRUGDVD~GH
do brasileiro, porém, hoje, sabe-se que esse Sistema não funciona
essencialmente conforme seus princípios: saúde como direito de todos,
pregando pela Universalidade, Equidade e Integralidade da atenção à
VD~GHGDSRSXODomREUDVLOHLUD´, os dois pontos ( : ) foram utilizados
para
a) esclarecer algo.
b) finalizar frase imperativa.
c) marcar pausa de curta duração.
d) separar orações coordenadas adversativas.
102. (CONSULPLAN / TERRACAP / ADVOGADO / 2014)
Considerando que as frases são organizadas segundo princípios gerais de
dependência e independência semântica e sintática, assinale a justificativa
para o emprego das vírgulas no trecho ³2JUXSRGHHVSHFLDOLVWDVFDOFXODTXH
as emissões de dióxido de carbono, o principal gás produzido pela atividade
humana responsável pelo aquecimento da atmosfera, estejam crescendo
>@´.
a) Separar uma aposição.
b) Separar termos coordenados.
c) Separar orações coordenadas.
d) Separar oração adjetiva restritiva
e) Separar oração adjetiva de valor explicativo.
103. (CONSULPLAN / MAPA / ADMINISTRADOR / 2014)
Considerando as várias funções da vírgula e sua importância, identifique o
motivo pelo qual as vírgulas foram empregadas em ³>@HHVVDEXVFDLQFOXtD
FRQYHUVDomRHQWUHLJXDLVDSROrPLFDRGHEDWHDFRQWURYpUVLD´.
a) Separar uma enumeração.
b) Separar expressões retificativas.
c) Separar uma aposição explicativa.
d) Separar termos que serão retomados por pronome.
104. (CONSULPLAN / TRE-MG / ANALISTA / 2013)
Sobre o uso das vírgulas no WUHFKR³$GHPRFUDFLDUHJLPHHPTXHDPDLRULD
escolhe os governantes, é também o regime da iguDOGDGH´, é correto
afirmar, mantendo-se a correção de acordo com a norma culta, que a
D VXEVWLWXLomRGDYtUJXODDSyV³JRYHUQDQWHV´SHORSRQWRSUHVHUYDRYDORU
semântico e a coerência do período.
E LQVHUomRGRVLQDOGHGRLVSRQWRVDSyVRWHUPR³GHPRFUDFLD´SHUPLWHD

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 101 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

retirada das vírgulas de todo o período.


F  UHWLUDGD GD H[SOLFDomR ³UHJLPH HP TXH D PDLRULD HVFROKH RV
JRYHUQDQWHV´SHUPLWHDPDQXWHQomRGDYtUJXODDSyVRWHUPR³GHPRFUDFLD´
d) retirada das vírgulas manteria a coerência textual, enfatizando a
H[SOLFDomR³UHJLPHHPTXHDPDLRULDHVFROKHRVJRYHUQDQWHV´
e) substituição pelo duplo travessão manteria a coerência textual
GHOLPLWDQGRDH[SOLFDomR³UHJLPHHPTXHDPDLRULDHVFROKHRVJRYHUQDQWHV´
105. (CONSULPLAN / TRT 13ª REGIÃO / ESTÁGIO / 2012)
Em ³0DVQRPHLRGHWXGRLVVRIRUDGLVVRDWUDYpVGLVVRDSHVDUGLVVRWXGR
- há amor.", o uso do travessão justifica-se por
a) indicar a mudança de interlocutor.
b) destacar enfaticamente a parte final de um enunciado.
c) substituir os parênteses.
d) isolar, num contexto, palavras ou frases.
e) denotar uma pausa maior.
106. (CONSULPLAN / TRT 13ª REGIÃO / ESTÁGIO / 2012)
Quanto à pontuação empregada no trecho ³2WUDEDOKRSRUPHLRGDDomRGR
reconhecimento, constitui uma segunda chance para edificar e desenvolver
nossa identidade e adquirir assim uma melhor resistência psíquica em face
dos desafios da vida.", assinale a afirmativa correta
a) As vírgulas foram utilizadas para separar termos deslocados,
demonstrando uma quebra da sequência sintática.
E  $ YtUJXOD DSyV ³WUDEDOKR SRGHULD VHU HOLPLQDGD VHP TXH KRXYHVVH
prejuízo quanto à estrutura linguística do período.
F  $R LQLFLDU R SHUtRGR FRP D H[SUHVVmR ³SRU PHLR GD DomR GR
reconhecimento", as vírgulas são eliminadas.
d) O uso GDYtUJXODDSyV³WUDEDOKRWHPSRUREMHWLYRGHVWDFDURWHPDVREUH
o qual os argumentos do texto são construídos.
e) O uso das vírgulas indica a separação de uma expressão que retifica o
fato mencionado anteriormente.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 102 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 05 ± Felipe Luccas Rosas

Gabaritos

1. CORRETA 53. CORRETA 105. LETRA B


2. CORRETA 54. LETRA D 106. LETRA A
3. CORRETA 55. LETRA A
4. CORRETA 56. INCORRETA
5. CORRETA 57. LETRA E
6. CORRETA 58. CORRETA
7. CORRETA 59. CORRETA
8. CORRETA 60. INCORRETA
9. CORRETA 61. CORRETA
10. CORRETA 62. CORRETA
11. LETRA A 63. CORRETA
12. INCORRETA 64. LETRA A
13. CORRETA 65. LETRA B
14. CORRETA 66. LETRA A
15. INCORRETA 67. LETRA D
16. CORRETA 68. LETRA C
17. INCORRETA 69. CORRETA
18. CORRETA 70. LETRA B
19. INCORRETA 71. CORRETA
20. CORRETA 72. INCORRETA
21. INCORRETA 73. CORRETA
22. CORRETA 74. LETRA C
23. CORRETA 75. LETRA A
24. INCORRETA 76. CORRETA
25. INCORRETA 77. CORRETA
26. INCORRETA 78. INCORRETA
27. INCORRETA 79. INCORRETA
28. INCORRETA 80. CORRETA
29. INCORRETA 81. LETRA B
30. CORRETA 82. INCORRETA
31. CORRETA 83. INCORRETA
32. CORRETA 84. LETRA B
33. CORRETA 85. LETRA A
34. CORRETA 86. LETRA D
35. LETRA E 87. LETRA D
36. CORRETA 88. LETRA A
37. CORRETA 89. LETRA A
38. CORRETA 90. LETRA D
39. LETRA D 91. LETRA A
40. INCORRETA 92. LETRA C
41. LETRA C 93. LETRA A
42. CORRETA 94. LETRA D
43. CORRETA 95. LETRA D
44. CORRETA 96. LETRA D
45. CORRETA 97. LETRA E
46. CORRETA 98. LETRA E
47. CORRETA 99. LETRA D
48. CORRETA 100. LETRA B
49. LETRA D 101. LETRA A
50. LETRA C 102. LETRA A
51. LETRA D 103. LETRA A
52. CORRETA 104. LETRA E

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 103 de 103
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

Considerações Finais
Meus queridos alunos, vejam que, no fim das contas, a interpretação é uma técnica,
um exercício bem prático. Cada texto é um texto, não há fórmulas universais.
Porém, com o domínio das técnicas mostradas aqui e com o cuidado de interpretar
os enunciados, para saber se pedem informações explícitas ou implícitas, é
SRVVtYHOVLPDFHUWDUDVWHPLGDVTXHVW}HVGH³LQWHUSUHWDomR´
Sugiro que sempre leiam seu texto marcando palavras-chave, verbos carregados
de sentido opinativo, afirmações categóricas. Faça resumos mentais enquanto lê,
ou, se não for comprometer o tempo da sua prova, escreva do lado de cada
parágrafo sua ideia principal. Essas são pistas que levarão você a desvendar o
mistério de um texto.
Releiam as técnicas de desenvolvimento de parágrafos introdutórios e de
desenvolvimento, pois aquelas estruturas são muito frequentes e sinalizam
fortemente que um texto é dissertativo. Leiam sempre os títulos e as fontes dos
textos das provas, são grandes pistas sobre a finalidade deles.
Abraço. Sucesso nos estudos.
Professor Felipe Luccas Rosas

Lista de questões

1. (IF-PE / Técnico em Laboratório / 2016)


Analise as proposições do texto em relação à tipologia e gênero textual:
1. A Fábula é uma Tipologia textual e não um gênero de texto;
2. O gênero textual fábula pertence à tipologia narrativa;
3. O Gênero e a tipologia textual se definem igualmente
4. São características que definem a fábula: os animais que falam e uma
linguagem erudita
Assinale a alternativa correta:
a) 1 e 2
b) 1, 2 e 3
c) 2 e 4
d) Apenas 2
e) Todas estão corretas
2. (MS-Concursos / Fiscal de Tributos / 2017)
Assinale a alternativa incorreta.
a) No discurso direto, o narrador reproduz na íntegra a fala das personagens
ou interlocutores. Geralmente essa fala é introduzida por travessão.
b) No discurso indireto, o narrador exprime indiretamente a fala da
personagem. O narrador funciona como testemunha auditiva e passa para o
leitor o que ouviu da personagem.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 73 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

c) O discurso indireto livre é resultante da mistura dos discursos direto e


indireto.
d) O discurso indireto geralmente apresenta verbos de elocução (declarativos
ou dicendi) que indicam quem está emitindo a mensagem.
3. (FGV / Taquígrafo / 2013)

Com relação aos constituintes linguísticos e gráficos da tira acima, assinale a


afirmativa correta.
³$WLUDpXPH[HPSORFODURGHWH[WRQDUUDWLYRMiTXHDSUHVHQWDXPDVHTXrQFLD
FURQROyJLFDGHDo}HV´
4. (MPE-RS / Promotor de Justiça / 2017)
O professor encerra seu número, numa senha para que a mulher se apresse.
Amei nosso entretém, monsieur, só lamento não poder ........ para o jantar.
Você também é sempre bem-vinda, Carminha, nem que seja apenas para
brincar com a Piaf. Vou ........, diz Anne enxugando as mãos num pano de
prato. De repente, dá um suspiro curto e um saltito juvenil: um momento,
monsieur Hollander. Tira da geladeira um rocambole cheirando a maçã e
separa uma fatia num prato de sobremesa: o senhor disse que seu pai morou
na Alemanha? Entrega-me o pratinho coberto com um papel de pão: é uma
receita da minha avó alsaciana, ele vai gostar. ........ em direção à sala, onde
a Minhoca brinca mais uma vez com a Piaf. Henri Beauregard fecha o piano e
se refugia num banheiro. Ainda procuro protelar o adeus, alisando o piano e
tecendo elogios ao seu design art déco, quando escuto o ruído da chave na
fechadura e vejo a maçaneta girar sozinha. Paralisado defronte da porta por
onde entrará meu irmão alemão, repasso na memória as ideias mais
fantasiosas que fiz dele, desde que soube da sua existência. Recordo quantas
vezes sonhei com ele, a cada sonho com uma cara diferente, caras que eram
transfiguradas pelo aquário do sonho, seres que a luz da manhã desvanecia,
durante os anos em que ansiei por este encontro. E agora já não quero que a
porta se abra, por mim aquela maçaneta poderia girar perpetuamente. Prefiro
continuar a ver meu irmão em sonhos, com sua cara ainda sem acabamento.
Penso que vê-lo assim à queima-roupa, com excessiva nitidez, será como ver
escancarada numa tela de cinema a personagem de um romance que eu vinha
adivinhando fio a fio à medida que lia. Se pudesse, eu pediria ao meu irmão
que me esperasse lá fora, para ser de novo o vulto noturno que apenas entrevi.
Mas a porta range, a maçaneta desfaz seu giro, e o que tenho diante de mim
não pode ser meu irmão alemão. É um homem da minha idade, com a pele
branca meio escamada, o nariz adunco de Henri e uma calvície precoce. É
sinceramente um tipo banal, desses que a memória não fixa, que não

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 74 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

frequentam os sonhos. Eis meu filho Christian, diz Anne em francês, e este
cavalheiro aqui, ele é o monsieur Hollander, namorado da Carminha. Christian
cumprimenta-nos com a cabeça, porque está sobrecarregado de livros, e se
escafede escada acima. Anne abre a porta da rua: au revoir. A Minhoca me
puxa pela manga, e já do lado de fora pergunto de supetão: e o outro,
madame? O outro? O seu outro filho, madame. Ouço um som de descarga, e
mesmo na contraluz percebo como Anne enrubesce: não temos outro filho,
monsieur Hollander. Fecha a porta, e estou no portão quando ela torna a abri-
la: psiu. É para a Piaf, que vinha atrás da Minhoca e volta correndo para
dentro.

No texto, o narrador utiliza expressões que caracterizam ou sugerem


sentimentos, atitudes ou intenções ora de outros personagens, ora próprios
dele, narrador.
Assinale a alternativa em que ele caracteriza um sentimento próprio.
a) O professor encerra seu número, numa senha para que a mulher se
apresse (l.01)
b) Henri Beauregard fecha o piano e se refugia num banheiro (l.10)
c) É sinceramente um tipo banal, desses que a memória não fixa (l.27-28)
d) Christian cumprimenta-nos com a cabeça [...] e se escafede escada acima
(l.30-31)
e) [...] mesmo na contraluz percebo como Anne enrubesce: não temos outro
filho (l.32)
5. (CESPE / MPU / Segurança Instit. e Transporte / 2015)
A partir de uma ação do Ministério Público Federal (MPF), o Tribunal Regional
Federal da 2.a Região (TRF2) determinou que a Google Brasil retirasse, em
até 72 horas, 15 vídeos do YouTube que disseminam o preconceito, a
intolerância e a discriminação a religiões de matriz africana, e fixou multa
diária de R$ 50.000,00 em caso de descumprimento da ordem judicial. Na
ação civil pública, a Procuradoria Regional dos Direitos do Cidadão (PRDC/RJ)
alegou que a Constituição garante aos cidadãos não apenas a obrigação do
Estado em respeitar as liberdades, mas também a obrigação de zelar para que
elas sejam respeitadas pelas pessoas em suas relações recíprocas.
Para a PRDC/RJ, somente a imediata exclusão dos vídeos da Internet
restauraria a dignidade de tratamento, que, nesse caso, foi negada às religiões
de matrizes africanas. Corroborando a visão do MPF, o TRF2 entendeu que a
veiculação de vídeos potencialmente ofensivos e fomentadores do ódio, da
discriminação e da intolerância contra religiões de matrizes africanas não
corresponde ao legítimo exercício do direito à liberdade de expressão. O
tribunal considerou que a liberdade de expressão não se pode traduzir em
desrespeito à diferentes manifestações dessa mesma liberdade, pois ela
encontra limites no próprio exercício de outros direitos fundamentais.
A respeito das ideias e das estruturas linguísticas do texto, julgue o item
subsequente.
Predomina no texto em apreço o tipo textual narrativo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 75 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

6. (FCC / TRT 3ª REGIÃO / Contabilidade / 2015)


Atenção: A questão refere-se à crônica que segue.
Dona Doida
Uma vez, quando eu era menina, choveu grosso,
com trovoada e clarões, exatamente como chove agora.
Quando se pôde abrir as janelas,
as poças tremiam com os últimos pingos.
Minha mãe, como quem sabe que vai escrever um poema,
decidiu inspirada: chuchu novinho, angu, molho de ovos.
Fui buscar os chuchus e estou voltando agora,
trinta anos depois. Não encontrei minha mãe.
A mulher que me abriu a porta, riu de dona tão velha,
com sombrinha infantil e coxas à mostra.
Meus filhos me repudiaram envergonhados,
meu marido ficou triste até a morte,
eu fiquei doida no encalço.
Só melhoro quando chove.

Na construção do poema, predomina o tipo narrativo, sinalizado por advérbios


como agora e quando.
7. (VUNESP / FUNDACENTRO / 2014)
Leia o texto para responder à questão.

O marido, na cama, foi despertado pelo puxão nervoso e pelas palavras ainda
mais nervosas de dona Irene:
± Imagina: me roubaram e me devolveram meu relógio!
± Que relógio?
± Este aqui ± e ela estendeu o pulso, esquecida de que o pusera na bolsa, sem
tempo e sem calma para atar novamente a pulseira, depois do fato. Abriu a
bolsa e exibiu o relógio recuperado.
± Mas você não levou relógio nenhum, filha. Você esqueceu ele na mesinha de
cabeceira. Está ali. Quando eu dei fé, corri à janela para avisar, mas não vi
mais você.
Sujeito assustado, aquele ladrão! Mais medroso do que a medrosa dona Irene.

A última frase do texto ± Sujeito assustado, aquele ladrão! Mais medroso do


que a medrosa dona Irene. ± corresponde a uma reflexão
a) do marido, em relação ao comportamento da mulher.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 76 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

b) do narrador, em relação ao comportamento do ladrão.


c) da mulher, em relação ao comportamento do ladrão.
d) da mulher, em relação ao seu próprio comportamento.
e) do marido, em relação ao comportamento do ladrão.
8. (MP-RS / ASSESSOR / CIÊNCIAS JURÍDICAS E SOCIAIS)
O advogado Jairo Adriano de Mello contesta com raciocínio claríssimo colegas
que defendem o boicote à fiscalização com base na presunção da inocência e
no direito de não produzir prova contra si: ± Estão invertendo certas lógicas,
e muitos repetem os argumentos como papagaios. Todos são inocentes até
que se prove ________ contrário, mas, no momento ________ eu dificulto a
prova, sou contra ela, a lógica autoriza a inversão da presunção da inocência.
O teste do bafômetro não é prova contra mim. É a possibilidade que me é dada
de provar que não estou alcoolizado.

Observe os trechos do texto abaixo transcritos e as propostas de sua reescrita


em discurso indireto.

1. Estão invertendo certas lógicas, e muitos repetem os argumentos como


papagaios:
O advogado afirmou que certas lógicas estão sendo invertidas e que muitos
repetem os argumentos como papagaios.
2. [...] eu dificulto a prova, sou contra ela:
O advogado declarou que ele havia dificultado a prova, por ser contra ela.
3 [...] O teste do bafômetro não é prova contra mim:
O advogado disse que o teste do bafômetro não era prova contra ele.

Quais propostas de reescrita em discurso indireto estão corretas?


(A) Apenas 1 e 3.
(B) Apenas 1.
(C) Apenas 2.
(D) Apenas 2 e 3.
(E) 1, 2 e 3.
9. (UFPR / COPEL / ENGENHEIRO / 2017)
Assinale a alternativa em que o trecho transcrito NÃO apresenta nenhum tipo
de julgamento de valor/opinião do autor.
D  ³2 DQR GH  SDVVDUi DRV OLYURV FRPR XP GRV SHUtRGRV PDLV GLItFHLV
SDUDRVGLUHLWRVKXPDQRVGDEUHYHKLVWyULDGHPRFUiWLFDEUDVLOHLUD´
E ³2XWURLPSRUWDQWHSULQFtSLRH[SUHVVRQRWH[WRGDQRYDOHLGHPLJUDomRp
RGRFRPEDWHj[HQRIRELD´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 77 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

F  ³2 Q~PHUR GH PLJUDQWHV QR %UDVLO DXPHQWRX VLJQLILFDWLYDPHQWH QRV


últimos anos, principalmente por conta do afluxo de haitianos que buscavam
saída para o agravamento da crise humanitária no país depois do terremoto
GH´
G ³$H[LVWrQFLDGHXPPDUFROHJDOSRVLWLYR SRUWDQWR pIXQGDPHQWDOSDUD
SURWHJHUHVVDVSHVVRDV´
H  ³(P GH]HPEUR D &kPDUD GRV 'HSXWDGRV DSURYRX XPD OHL TXH VH
confirmada pelo Senado e sancionada pela Presidência, substituirá, por fim, o
retrógrado e inconstitucional Estatuto do Estrangeiro, criado durante a
GLWDGXUD´
10. (CESPE / SEDF / 2017)
Rubião tinha vexame, por causa de Sofia; não sabia haver-se com senhoras.
Felizmente, lembrou-se da promessa que a si mesmo fizera de ser forte e
implacável. Foi jantar. Abençoada resolução! Onde acharia iguais horas? Sofia
era, em casa, muito melhor que no trem de ferro. Lá vestia a capa, embora
tivesse os olhos descobertos; cá trazia à vista os olhos e o corpo,
elegantemente apertado em um vestido de cambraia, mostrando as mãos, que
eram bonitas, e um princípio de braço. Demais, aqui era a dona da casa, falava
mais, desfazia-se em obséquios; Rubião desceu meio tonto.
2WUHFKR³6RILD  HPREVpTXLRV´ O1 a 8) é predominantemente narrativo,
o que se comprova pelas formas verbais flexionadas no pretérito imperfeito,
empregadas pelo narrador para apresentar ações rotineiras de Sofia.
11. (FGV / Taquígrafo / 2013
"Dvorak arrastou-se montanha acima, na velocidade que os ferimentos
permitiam. Encostou-se a um grande tronco e escorregou por ele até o chão,
arranhando a pele dura das costas. Parou um momento de mexer-se e passou
a escutar os barulhos da floresta".
Esse é um pequeno fragmento de um romance. Nesse caso, o texto é
corretamente classificado como
a) narrativo com segmentos descritivos.
b) descritivo com segmentos narrativos.
c) exclusivamente narrativo.
d) narrativo, com segmentos descritivos e argumentativos.
e) descritivo, com segmentos narrativos e argumentativos.
12. (Cesgranrio/ BNDES/ 2009)
Em qual sequência é caracterizada uma descrição?
a) "Leves, classudos, num tom esportivamente escuro, cada lente com uma
sombra que subia de baixo para cima,"
b) " 'Pois é, mas eu estava com a vista cada vez mais cansada, até que fui
ao oculista...' "
c) "Mês depois, encontrei uma amiga cujo pai é oftalmologista."
d) "ela me contou que um curioso cliente do pai havia pedido um modelo de
óculos sem grau."

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 78 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

e) "É, era ele mesmo - o editor."


13. (CESPE / SUFRAMA / 2014)
O homem habita a Amazônia há mais de 11.000 anos.
No entanto, foi só no século XVI que o rio Amazonas foi navegado pela primeira
vez, pelo explorador e conquistador espanhol Don Francisco de Orellana
(1511-1546). Em busca de vastas florestas de canela e da lendária cidade do
ouro El Dorado, Orellana deixou Quito, no Equador, em fevereiro de 1541. Não
encontrou nem canela nem ouro, e, sim, o maior rio da Terra. O explorador
EDWL]RX R ULR ³UHFpP-GHVFREHUWR´ GH ULR GH 2UHOODQD 7DO QRPH GHSRLV VHULD
abandonado em troca do nome rio Amazonas, inspirado na mítica tribo de
guerreiras.
Passaram-se muitos anos até a Amazônia receber uma nova expedição ² a
primeira a subir o rio inteiro. Entre 1637 e 1638, as primeiras informações
detalhadas sobre a região, sua história natural e seu povo foram registradas
pelo Padre Cristóvão de Acuña, que viajou como membro de uma grande
expedição comandada pelo general português Pedro Teixeira. Ele registrou
dados de impressionante precisão acerca da extensão e do tamanho do rio
Amazonas, e da topografia de seu curso, com descrições detalhadas das áreas
de floresta inundada ao longo do rio, da fauna aquática, dos sistemas agrícolas
e das plantações dos povos indígenas.
No que se refere aos aspectos linguísticos e à tipologia do texto acima, julgue
o item que se segue: No texto, de caráter informativo, há trechos narrativos
que tratam da navegação na região amazônica.
14. (IADES / TRE-PA / Taquigrafia / 2014)
Com relação ao parágrafo dissertativo na redação jurídica, assinale a
alternativa que define, respectivamente, a dissertação expositiva e a
argumentativa.
a) Exposição sucinta de fatos; discussão de uma ideia, de um assunto ou de
uma doutrina.
b) Representação escrita de uma sequência de aspectos jurídicos; exposição
de um assunto, com inserção de comentários pessoais.
c) Posicionamento sobre determinado assunto; relato detalhado de natureza
persuasiva.
d) Discussão de uma ideia, de um assunto ou de uma doutrina; exposição de
ideias com o objetivo de convencer o leitor.
e) Técnica de persuasão necessária no discurso forense; exposição de
opiniões de forma clara e objetiva.
15. (CESPE / TRE-ES / Taquigrafia / 2011)
No Brasil, a tradição política no tocante à representação gira em torno de três
ideias fundamentais. A primeira é a do mandato livre e independente, isto é,
os representantes, ao serem eleitos, não têm nenhuma obrigação,
necessariamente, para com as reivindicações e os interesses de seus eleitores.
O representante deve exercer seu papel com base no exercício autônomo de
sua atividade, na medida em que é ele quem tem a capacidade de
discernimento para deliberar sobre os verdadeiros interesses dos seus

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 79 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

constituintes. A segunda ideia é a de que os representantes devem exprimir


interesses gerais, e não interesses locais ou regionais. Os interesses nacionais
seriam os únicos e legítimos a serem representados. A terceira ideia refere-se
ao princípio de que o sistema democrático representativo deve basear-se no
governo da maioria. Praticamente todas as leis eleitorais que vigoraram no
Brasil buscaram a formação de maiorias compactas que pudessem governar.

Julgue o item que se segue, relativo às estruturas sintáticas e semânticas do


texto. Nesse fragmento de texto, o tópico frasal corresponde ao primeiro
período.
16. (IADES / TRE-PA / Taquigrafia / 2014)
6HJXQGR 5HDOH  S  ³R GLUHLWR p UHDOLGDGH XQLYHUVDO 2QGH TXHU TXH
H[LVWDRKRPHPDtH[LVWHRGLUHLWRFRPRH[SUHVVmRGHYLGDHGHFRQYLYrQFLD´
No trecho apresentado, o tópico frasal é representado pelo vocábulo
a) realidade. b) homem. c) vida. d) convivência. e) direito.
17. (UFG / DP-GO / 2014)
Leia o Texto para responder à questão

LEI Nº 8.069, DE 13 DE JULHO DE 1990

Dispõe sobre o Estatuto da Criança e do Adolescente e dá outras providências.

O PRESIDENTE DA REPÚBLICA: Faço saber que o Congresso Nacional decreta


e eu sanciono a seguinte Lei:

Título I
Das Disposições Preliminares
Art. 1º Esta Lei dispõe sobre a proteção integral à criança e ao adolescente.
Art. 2º Considera-se criança, para os efeitos desta Lei, a pessoa até doze anos
de idade incompletos, e adolescente aquela entre doze e dezoito anos de
idade.
Parágrafo único. Nos casos expressos em lei, aplica-se excepcionalmente este
Estatuto às pessoas entre dezoito e vinte e um anos de idade.
Art. 3º A criança e o adolescente gozam de todos os direitos fundamentais
inerentes à pessoa humana, sem prejuízo da proteção integral de que trata
esta Lei, assegurando-se-lhes, por lei ou por outros meios, todas as
oportunidades e facilidades, a fim de lhes facultar o desenvolvimento físico,
mental, moral, espiritual e social, em condições de liberdade e de dignidade.
Art. 4º É dever da família, da comunidade, da sociedade em geral e do poder
público assegurar, com absoluta prioridade, a efetivação dos direitos
referentes à vida, à saúde, à alimentação, à educação, ao esporte, ao lazer, à

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 80 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

profissionalização, à cultura, à dignidade, ao respeito, à liberdade e à


convivência familiar e comunitária.
Parágrafo único. A garantia de prioridade compreende:
a) primazia de receber proteção e socorro em quaisquer circunstâncias;
b) precedência de atendimento nos serviços públicos ou de relevância pública;
c) preferência na formulação e na execução das políticas sociais públicas;
d) destinação privilegiada de recursos públicos nas áreas relacionadas com a
proteção à infância e à juventude.
Art. 5º Nenhuma criança ou adolescente será objeto de qualquer forma de
negligência, discriminação, exploração, violência, crueldade e opressão,
punido na forma da lei qualquer atentado, por ação ou omissão, aos seus
direitos fundamentais.

Em sua acepção técnica, lei equivale a uma regra escrita, dotada de poder
normativo. No Texto, a normatividade do conteúdo da lei é marcada por:

a) uso esporádico de recursos explicativos dos princípios legais.


b) estratégias injuntivas e de construção da neutralidade.
c) recorrência de raciocínio indutivo.
d) expressões de possibilidade geradoras de intimidação no leitor.
e) escolha lexical de valor ambíguo.
18. (FGV / ALEMA / 2013)

A finalidade básica do texto acima é


a) regulamentar. b) informar. c) ensinar. d) convencer. e) prever.
19. (CESPE / Escrivão / PC-DF / 2013)
O problema intercultural não se resolve, como pretendem os multiculturalistas,
pelo simples reconhecimento da isonomia axiológica entre culturas distintas,
mas, fundamentalmente, pelo diálogo interpessoal entre indivíduos de culturas
diferentes e, mais ainda, pelo acesso individual à própria diversidade cultural,
como condição para o exercício da liberdade de pertencer a uma cultura, de
assimilar novos valores culturais ou, simplesmente, de se reinventar
culturalmente. Aliás, o reconhecimento da isonomia axiológica entre culturas

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 81 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

é importante não porque limita a individualidade a uma estrita visão


antropológica que projeta a condição humana ao círculo concêntrico da cultura
do agrupamento familiar e social a que pertence o indivíduo, mas porque o
liberta, ao lhe dar amplitude de opção cultural, que, transcendendo a esfera
da identidade individual como simples parte de uma cultura, dimensiona a
individualidade no campo da liberdade ² da liberdade de criar a si mesmo.
Por fim, a passagem para a democracia não totalitária, ou seja, democracia na
e para a diversidade, decorre, justamente, da sensibilização do político e da
democratização do espaço pessoal, antes preso à teia indizível do monismo
cultural ocidental, tornando-se papel do Estado o oferecimento das condições
de acessibilidade à diversidade cultural, ambiente imprescindível à autogestão
da identidade pessoal.

Em relação ao texto acima, julgue o seguinte item.


De acordo com o autor do texto, a solução dos conflitos interculturais requer
o emprego de mecanismos mais complexos do que o proposto pelos
multiculturalistas.
20. (CESPE / DELEGADO / PC-GO / 2017)
Texto CB1A1AAA
A diferença básica entre as polícias civil e militar é a essência de suas
atividades, pois assim desenhou o constituinte original: a Constituição da
República Federativa do Brasil de 1988 (CF), em seu art. 144, atribui à polícia
federal e às polícias civis dos estados as funções de polícia judiciária ² de
natureza essencialmente investigatória, com vistas à colheita de provas e,
assim, à viabilização do transcorrer da ação penal ² e a apuração de infrações
penais.
Enquanto a polícia civil descobre, apura, colhe provas de crimes, propiciando
a existência do processo criminal e a eventual condenação do delinquente, a
polícia militar, fardada, faz o patrulhamento ostensivo, isto é, visível, claro e
perceptível pelas ruas. Atua de modo preventivo-repressivo, mas não é seu
mister a investigação de crimes. Da mesma forma, não cabe ao delegado de
polícia de carreira e a seus agentes sair pelas ruas ostensivamente em
patrulhamento. A própria comunidade identifica na farda a polícia repressiva;
quando ocorre um crime, em regra, esta é a primeira a ser chamada. Depois,
havendo prisão em flagrante, por exemplo, atinge-se a fase de persecução
penal, e ocorre o ingresso da polícia civil, cuja identificação não se dá
necessariamente pelos trajes usados.
Infere-se das informações do texto que
a) o uso de fardamento pela polícia militar é o que a diferencia da polícia
civil, que prescinde dos trajes corporativos.
b) a essência da atividade do delegado de polícia civil reside no controle, na
prevenção e na repressão de infrações penais.
c) ao delegado de polícia cabem a condução da investigação criminal e a
apuração de infrações penais.
d) a tarefa precípua dos delegados de polícia civil e de seus agentes é o
patrulhamento ostensivo nas ruas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 82 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

e) a função de polícia judiciária concretiza-se no policiamento ostensivo,


preventivo e repressivo.
21. (CESPE / DELEGADO / PC-GO / 2017)
O texto texto CB1A1AAA(Questão 20) é predominantemente
a) injuntivo. b) narrativo. c) dissertativo. d) exortativo. e) descritivo.
22. (IBFC / Perito Criminal / PC-RJ / 2013)
No verso ³(XQmRPHOHPEURmais´a palavra em destaque permite que o leitor
infira um conteúdo pressuposto sobre a lembrança referida pelo sujeito lírico.
Indique- o.
a) Ele nunca se lembrou.
b) Ele agora se lembra mais do que já lembrara um dia.
c) Ele lembrará certamente num futuro próximo.
d) Ele já não se lembra daquilo que lembrara um dia
e) Ele não se lembra com a mesma intensidade do passado.-
23. (COMPERVE / UFERSA / CONTADOR / 2015)
Considere o trecho reproduzido abaixo.
Distritos residenciais foram erguidos cada vez mais distantes das áreas
centrais, onde tradicionalmente estão os postos de trabalho. O movimento
pendular entre moradia e emprego tornou-se obrigatório para milhões de
habitantes.
Em relação às informações implícitas, é correto afirmar que nele existem
a) um subentendido marcado linguisticamente e um pressuposto sem
marcação linguística.
b) dois subentendidos marcados linguisticamente.
c) dois pressupostos marcados linguisticamente.
d) um pressuposto sem marcação linguística e um subentendido marcado
linguisticamente.
24. (UEG / DELEGADO / PC-GO / 2013)
Na frase ³>R KRPHP@ GHL[RXGH H[HUFHU VXD IRUoD SHUDQWHXPD IRUoD
maior´ há o seguinte pressuposto acionado linguisticamente pelo verbo
³GHL[DU´
a) No passado, o homem exerceu sua força perante uma força maior.
b) O homem é por natureza um ser que procura impor-se pela força física.
c) O homem esperto sabe que pode exercer sua força perante o mais fraco.
d) Nos dias atuais, o homem busca várias formas de exercer seu poder sobre
os demais.
25. (Consulplan / MAPA / 2014)
É sina de minha amiga penar pela sorte do próximo, se bem que seja um
penar jubiloso. Explico-me. Todo sofrimento alheio a preocupa e acende nela
o facho da ação, que a torna feliz. Não distingue entre gente e bicho, quando

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 83 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

tem de agir, mas, como há inúmeras sociedades (com verbas) para o bem dos
homens, e uma só, sem recurso, para o bem dos animais, é nesta última que
gosta de militar. Os problemas aparecem-lhe em cardume, e parece que a
escolhem de preferência a outras criaturas de menor sensibilidade e iniciativa
(...).

Dissertar significa debater um tema, ou seja, apresentar uma tese e encontrar


argumentos para defendê-la.
Considerando tal pressuposto, é correto afirmar que o ponto de vista assumido
no texto defende que
D DGLVWLQomRHQWUH³JHQWH´H³ELFKR´pLQDGHTXada em qualquer situação.
b) pessoas menos sensíveis são mais suscetíveis a problemas do que as
outras.
c) as ações solidárias, de ajuda ao próximo, são trabalhosas, mas causam
satisfação.
d) todo sofrimento deve ser evitado, não importando tratar-se GH³JHQWH´RX
³ELFKR´
26. (Questão Inédita / 2017)
As causas do desemprego no mundo
Atualmente o mundo atingiu um nível muito alto de desemprego, fato que só
havia acontecido, em proporções similares, após a crise de 29.
Segundo os órgãos internacionais, existem hoje, aproximadamente, 850
milhões de pessoas desempregadas, algumas profissões foram superadas
outras extintas, o crescimento constante de tecnologias provoca alterações no
mercado de trabalho em todo o mundo.
Até mesmo em países de terceiro mundo, as fábricas e indústrias estão
sofisticadas e modernas. As empresas são obrigadas a investir maciçamente
em tecnologia para garantir rapidez e melhorar a qualidade, itens necessários
em um mercado tão competitivo.
De acordo com os fragmentos abaixo, julgue os itens:
VI- Consoante algumas instituições internacionais, um número próximo de
850 milhões de pessoas estão desempregadas, pois o desenvolvimento
das tecnologias de automação modificou profundamente as relações de
trabalho, aumentando a rotatividade nos postos de trabalho.
VII- Segundo o autor, o desemprego no Brasil atingiu um nível muito alto,
algo que só ocorrera após a depressão de 1929.
VIII- Fábricas em países de terceiro mundo, ao contrário do que possa
parecer, ostentam plantas modernas, em que há grandes investimentos
em tecnologia, pois esse é um fator necessário para sobreviver num
mercado competitivo, assim como a qualidade da mão de obra.
IX- De acordo com organismos internacionais, há aproximadamente 850
milhões de desempregados, tendo em vista que algumas profissões
foram superadas e extintas, além do fato de que o crescimento
constante de tecnologias provoca manutenção das relações de trabalho

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 84 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

no mercado em todo o mundo. Tal nível de desemprego é sem


precedentes na história.
X- Os investimentos em tecnologia são um grande fator para a deterioração
dos benefícios trabalhistas, constitucionalmente garantidos, acentuando
a condição de hipossuficiente dos operários das modernas e sofisiticadas
fábricas em todo o mundo.
27. (FCC / TRT 24ª REGIÃO / Técnico Judiciário / 2017)
Aspectos Culturais de Mato Grosso do Sul
A cultura de Mato Grosso do Sul é o conjunto de manifestações artístico-
culturais desenvolvidas pela população sul-mato-grossense muito influenciada
pela cultura paraguaia. Essa cultura estadual retrata, também, uma mistura
de várias outras contribuições das muitas migrações ocorridas em seu
território.
O artesanato, uma das mais ricas expressões culturais de um povo, no Mato
Grosso do Sul, evidencia crenças, hábitos, tradições e demais referências
culturais do Estado. É produzido com matérias primas da própria região e
manifesta a criatividade e a identidade do povo sul-mato-grossense por meio
de trabalhos em madeira, cerâmica, fibras, osso, chifre, sementes, etc.
As peças em geral trazem à tona temas referentes ao Pantanal e às populações
indígenas, são feitas nas cores da paisagem regional e, além da fauna e da
flora, podem retratar tipos humanos e costumes da região.
Depreende-se corretamente do texto que a cultura de Mato Grosso do Sul é
a) formada principalmente pela influência da cultura de vários povos
migrantes e também pela influência secundária da cultura paraguaia.
b) formada não apenas pela influência da cultura paraguaia, mas também
pela influência da cultura dos povos que migraram para essa região.
c) muito influenciada pela cultura paraguaia, mas também o é pela cultura
de povos de outros países sul-americanos.
d) fortemente influenciada pela cultura de nações sul-americanas, mas o é
também pela cultura de povos de outras regiões do Brasil.
e) reflexo de uma forte influência da cultura paraguaia, e a cultura de outras
regiões não a influenciou de forma relevante.
28. (CESPE / DPU / 2016)
No Brasil, pode-se considerar marco da história da Assistência jurídica, ou
justiça gratuita, a própria colonização do país, ainda no século XVI. O
surgimento de lides provenientes das inúmeras formas de relação jurídica
então existentes ² e o chamamento da jurisdição para resolver essas
contendas ² já dava início a situações em que constantemente as partes se
viam impossibilitadas de arcar com os possíveis custos judiciais das demandas.
A partir de então, a chamada assistência judiciária praticamente evoluiu junto
com o direito pátrio. Sua importância atravessou os séculos, e ela passou a
ser garantida nas cartas constitucionais.
1RVpFXOR;;RWH[WRFRQVWLWXFLRQDOGHQRFDStWXOR,,³'RVGLUHLWRVH
das garantias indLYLGXDLV´HPVHXDUWIH]PHQomRDHVVDSURWHomRDR
SUHYHU TXH ³$ 8QLmR H RV HVWDGRV FRQFHGHUmR DRV QHFHVVLWDGRV DVVLVWrQFLD

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 85 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

judiciária, criando para esse efeito órgãos especiais e assegurando a isenção


GHHPROXPHQWRVFXVWDVWD[DVHVHORV´3RUVXa vez, a Constituição de 1946
SUHYLXQRPHVPRFDStWXORTXHDGHHPVHXDUW†TXH³2SRGHU
público, na forma que a lei estabelecer, concederá assistência judiciária aos
QHFHVVLWDGRV´ $ OHL H[WUDYDJDQWH YHLR HP  PDWHULDOL]DGD QD /HL Qº
1.060, que especifica normas para a concessão de assistência judiciária aos
QHFHVVLWDGRV 1R DUW ž GHVVD OHL KDYLD PHQomR DR ³UHQGLPHQWR RX
YHQFLPHQWRTXHSHUFHEHHRVHQFDUJRVSUySULRVHRVGDIDPtOLD´HFRQVWDYDD
exigência de atestado de pobreza, expedido pela autoridade policial ou pelo
prefeito municipal. Foi o art. 1.º, § 2.º, da Lei n.º 5.478/1968 que criou a
simples afirmação (da pobreza), ratificado pela Lei n.º 7.510/1986, que deu
nova redação a dispositivos da Lei n.º 1.060/1950. Em 1988, a Carta Cidadã
ampliou o escopo da assistência judiciária ao empregar o termo assistência
jurídica integral e gratuita, que é mais abrangente e que abarca o termo usado
anteriormente, restrito apenas à assistência de demanda judicial já proposta
ou a ser interposta. O termo atual também engloba atos jurídicos
extrajudiciais, aconselhamento jurídico, patrocínio da causa, além de ações
coletivas e mediação.
Hoje, portanto, alguém que se vê incapaz de arcar com os custos que uma lide
judicial impõe, mas necessita da imediata prestação jurisdicional, pode,
mediante simples afirmativa, postular as benesses dessa prerrogativa,
garantida pela Constituição Federal vigente.

No que se refere às ideias e informações do texto, julgue os itens a seguir.


Infere-se do texto que a Lei n.º 1.060/1950 ainda está em vigência, embora
tenha passado por algumas alterações.
29. (CESPE / DPU / 2016)
Utilizar o texto da questão 28.
O autor do texto visa convencer o leitor acerca da necessidade de que se
tratem como iguais os desiguais, por meio da prestação jurisdicional gratuita.
30. (CESPE / DPU / 2016)
Utilizar o texto da questão 28.
Sem prejuízo do sentido e da correção gramatical do texto, o primeiro período
poderia ser reescrito da seguinte forma: a própria colonização do Brasil, ainda
no século XVI, pode ser considerada marco da história da assistência jurídica,
ou justiça gratuita, no país.
31. (CESPE / DPU / 2016)
Utilizar o texto da questão 28.
Depreende-se do texto que, de acordo com a Constituição Federal de 1988, é
proibido à pessoa possuidora de bens requerer o direito à assistência jurídica
integral e gratuita.
32. (CESPE / DPU / 2016)
Utilizar o texto da questão 28.
Conclui-se do texto que, ao prever a substituição do atestado de pobreza pela

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 86 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

simples afirmativa da pessoa de que ela não pode arcar com os custos judiciais
da demanda, a lei teria buscado uma forma de tornar mais acessível ao
necessitado o exercício de seu direito.
33. (FCC / TRT 24ª REGIÃO / Técnico Judiciário / 2017)
Instituições financeiras reconhecem que é cada vez mais difícil detectar se
uma transação é fraudulenta ou verdadeira
Os bancos e as empresas que efetuam pagamentos têm dificuldades de
controlar as fraudes financeiras on-line no atual cenário tecnológico conectado
e complexo. Mais de um terço (38%) das organizações reconhece que é cada
vez mais difícil detectar se uma transação é fraudulenta ou verdadeira, revela
pesquisa realizada por instituições renomadas.
O estudo revela que o índice de fraudes on-line acompanha o aumento do
número de transações on-line, e 50% das organizações de serviços financeiros
pesquisadas acreditam que há um crescimento das fraudes financeiras
eletrônicas. Esse avanço, juntamente com o crescimento massivo dos
pagamentos eletrônicos combinado aos novos avanços tecnológicos e às
mudanças nas demandas corporativas, tem forçado, nos últimos anos, muitas
delas a melhorar a eficiência de seus processos de negócios.
De acordo com os resultados, cerca de metade das organizações que atuam
no campo de pagamentos eletrônicos usa soluções não especializadas que,
segundo as estatísticas, não são confiáveis contra fraude e apresentam uma
grande porcentagem de falsos positivos. O uso incorreto dos sistemas de
segurança também pode acarretar o bloqueio de transações. Também vale
notar que o desvio de pagamentos pode causar perda de clientes e, em última
instância, uma redução nos lucros.
Conclui-se que a fraude não é o único obstáculo a ser superado: as instituições
financeiras precisam também reduzir o número de alarmes falsos em seus
sistemas a fim de fornecer o melhor atendimento possível ao cliente.
Infere-se corretamente do texto que
a) está cada vez mais fácil, no atual cenário tecnológico, verificar se uma
transação on-line é falsa ou verdadeira.
b) bem mais da metade das organizações atuantes no campo de pagamentos
eletrônicos usa soluções não especializadas.
c) as instituições financeiras precisam acabar não só com as fraudes no
sistema on-line, mas também com os alarmes falsos.
d) o único obstáculo a ser superado ainda pelas instituições financeiras, no
atual cenário tecnológico, são os alarmes falsos
e) o uso de sistemas de segurança especializados pode provocar o bloqueio
de transações, mas sem perda da clientela.
34. (CONSULPLAN / CFESS / 2017)
História de bem-te-vi
Com estas florestas de arranha-céus que vão crescendo, muita gente pensa
que passarinho é coisa de jardim zoológico; e outras até acham que seja
apenas antiguidade de museu. Certamente chegaremos lá; mas por enquanto
ainda existem bairros afortunados onde haja uma casa, casa que tenha um

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 87 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

quintal, quintal que tenha uma árvore. Bom será que essa árvore seja a
mangueira. Pois nesse vasto palácio verde podem morar muitos passarinhos.
Os velhos cronistas desta terra encantaram-se com canindés e araras, tuins e
VDELiV PDUDFDQmV H ³TXHUHMXiV WRGRV D]XLV GH FRU ILQtVVLPD´ 1yV
esquecemos tudo: quando um poeta fala num pássaro, o leitor pensa que é
leitura...
Mas há um passarinho chamado bem-te-vi. Creio que ele está para acabar.
E é pena, pois com esse nome que tem ± e que é a sua própria voz ± devia
estar em todas as repartições e outros lugares, numa elegante gaiola, para no
momento oportuno anunciar a sua presença. Seria um sobressalto providencial
e sob forma tão inocente e agradável que ninguém se aborreceria.
O que leva a crer no desaparecimento do bem-te-vi são as mudanças que
começo a observar na sua voz. O ano passado, aqui nas mangueiras dos meus
simpáticos vizinhos, apareceu um bem-te-vi caprichoso, muito moderno, que
se recusava a articular as três sílabas tradicionais do seu nome, limitando-se
DJULWDU³WH-vi! ...te-YL´FRPDPDLRULUUHYHUrQFLDJUDPDWLFDO&RPRGL]HP
que as últimas gerações andam muito rebeldes e novidadeiras, achei natural
que também os passarinhos estivessem contagiados pelo novo estilo humano.
Logo a seguir, o mesmo passarinho, ou seu filho ou seu irmão ± como posso
saber, com a folhagem cerrada da mangueira? ± animou-se a uma audácia
maior. Não quis saber das duas sílabas, e começou a gritar apenas daqui, dali,
LQYLVtYHOHEULQFDOKmR³YLYL´RTXHPHSDUHFHXGLYHUWLGRQHVWDHUDGR
twist.
O tempo passou, o bem-te-vi deve ter viajado, talvez seja cosmonauta, talvez
tenha voado com o seu team de futebol ± que se não há de pensar de bem-
te-vis assim progressistas, que rompem com o canto da família e mudam o
leme dos seus brasões? Talvez tenha sido atacado por esses crioulos fortes
que agora saem do mato de repente e disparam sem razão nenhuma no
primeiro indivíduo que encontram.
Mas hoje ouvi um bem-te-YLFDQWDU(FDQWDYDDVVLP³%HP-bem-bem...te ±
YL´3HQVHL³eXPDQRYDHVFRODSRpWLFDTXHVHHOHYDGDPDQJXHLUD´'HSRLV
RSDVVDULQKRPXGRX(IH]³%HP-te-te-WHYL´7RUQHLDUHIOHWLU³'HYHHVWDU
HVWXGDQGRDVXDFDUWLOKD(VWDUiVROHWUDQGR´(RSDVVDULQKR³%HP-bem-
bem...te-te-te... vi-vi-YL´
Os ornitólogos devem saber se isso é caso comum ou raro. Eu jamais tinha
ouvido uma coisa assim! Mas as crianças, que sabem mais do que eu, e vão
GLUHWDV DRV DVVXQWRV RXYLUDP SHQVDUDP H GLVVHUDP ³4XH HQJUDoDGR 8P
bem-te-YLJDJR´
(É: talvez não seja mesmo exotismo, mas apenas gagueira...)
(MEIRELES, Cecília. 1901-1964 ± Escolha o seu sonho: (crônicas) ± 26ª ed. ±
Rio de Janeiro: Record, 2005.)
De acordo com o texto, o processo de extinção do bem-te-vi pode ser
observado
a) pela modificação do jeito de cantar dessa ave.
b) pela proliferação exarcebada de arranha-céus nas cidades.
c) pela preferência dos velhos cronistas por aves mais exóticas.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 88 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

d) pela necessidade da existência de outras espécies de árvores..


35. (CONSULPLAN / CFESS / 2017)
³0DVKRMHRXYLXPEHP-te-YLFDQWDU (FDQWDYDDVVLPµ%HP-bem-bem...te-
YL¶3HQVHLµeXPDQRYDHVFRODSRpWLFDTXHVHHOHYDGDPDQJXHLUD¶´ ž† 
A narradora pensa ser uma nova escola poética porque o cantar do passarinho
a) é triste, enfadonho, monótono.
b) ressoa, agora, mais alto e mais longe.
c) é feito de uma forma distinta da usual.
d) é compartilhado por outros passarinhos.
36. (CONSULPLAN / CFESS / 2017)
³ DSDUHFHX XP EHP-te-vi caprichoso, muito moderno, que se recusava a
articular as três sílabas tradicionais do seu nome, limitando-VHDJULWDU³WH
vi! ...te-YLFRPDPDLRULUUHYHUrQFLDJUDPDWLFDO´ ž† $QDUUDGRUDIDODGH
irreverência gramatical porque se trata
a) de uma inadequação vocabular.
b) do emprego de linguagem coloquial.
c) de um erro de concordância nominal.
d) de uma impropriedade do uso do pronome átono..
37. (CONSULPLAN / Assistente Social / 2016)
O coronel, que então morava já na cidade, tinha um compadre sitiante que ele
estimava muito. Quando um filho do compadre Zeferino ficava doente, ia para
a casa do coronel, ficava morando ali até ficar bom, o coronel é que arranjava
médico, remédio, tudo.
Quase todos os meses o compadre pobre mandava um caixote de ovos para
o coronel. Seu sítio era retirado umas duas léguas de uma estaçãozinha da
Leopoldina, e compadre Zeferino despachava o caixote de ovos de lá, frete a
pagar. Sempre escrevia no caixote: CUIDADO É OVOS ± e cada ovo era
enrolado em sua palha de milho com todo cuidado para não se quebrar na
viagem. Mas, que o quê: a maior parte quebrava com os solavancos do trem.
Os meninos filhos do coronel morriam de rir abrindo o caixote de presente
do compadre Zeferino; a mulher dele abanava a cabeça como quem diz:
qual...Os meninos, com as mãos lambuzadas de clara e gema, iam separando
os ovos bons. O coronel, na cadeira de balanço, ficava sério; mas, reparando
bem, a gente via que ele às vezes sorria das risadas dos meninos e das
bobagens que eles diziam: por exemplo, um gritava para o outro ± ³Fuidado,
pRYRV´
Quando os meninos acabavam o serviço, o coronel perguntava:
± Quantos salvaram?
2VPHQLQRVGL]LDP(QWmRHOHVHYROWDYDSDUDDPXOKHU³0XOKHUDTXDQWR
HVWiDG~]LDGHRYRVDTXLQR&DFKRHLUR"´$PXOKHUGL]LD(QWmRHOHID]LDXm
cálculo do frete que pagara, mais do carreto da estação até a casa e coçava a
cabeça com um ar engraçado:
± Até que os ovos do compadre Zeferino não estão me saindo muito caros

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 89 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

desta vez. [...]


(BRAGA, R. O Compadre Pobre. In. BRAGA, R. 200 crônicas escolhidas. Rio
de Janeiro: Record, 2013. Fragmento.)
Considerando o modo de organização como o texto se apresenta e/ou
características linguísticas utilizadas, pode-se afirmar que
a) predominam os verbos de situação e as expressões qualificativas em geral.
b) o predomínio da descrição revela a caracterização da composição do
ambiente.
c) através da sequência da enunciação dos fatos pode-se reconhecer
determinadas ações encadeadas temporalmente.
d) a narrativa apresentada é um recurso argumentativo utilizado pelo autor
para expor de forma explícita seu ponto de vista.
38. (CONSULPLAN / Assistente Social / 2016)
A expressão do ponto de vista do narrador pode ser identificada através de
alguns recursos, sendo um deles o da adjetivação. Tal fato pode ser
identificado no fragmento transcrito em:
D  ³>@ FRPSDGUH =HIHULQR GHVSDFKDYD R FDL[RWH GH RYRV GH Oi IUHWH D
SDJDU´ ž† 
E ³>@ILFDYDPRUDQGRDOLDWpILFDUERPRFRURQHOpTXHDUUDQMDYDPpGLFR
UHPpGLRWXGR´ ž†
F ³(QWmRHOHVHYROWDYDSDUD DPXOKHUµ0XOKHU DTXDQWRHVWi DG~]LD GH
RYRVDTXLQR&DFKRHLUR"¶´ ž†
G ³2FRURQHOQDFDGHLUDGHEDODQoRILFDYDVpULRPDVUHSDUDQGREHPD
JHQWHYLDTXHHOHjVYH]HVVRUULD>@´ ž† 
39. (CONSULPLAN / Psicólogo / 2016)
A importância da família estruturada
Um levantamento do Ministério Público de São Paulo traz um dado
revelador: dois terços dos jovens infratores da capital paulista fazem parte de
famílias que não têm um pai dentro de casa. Além de não viverem com o pai,
42% não têm contato algum com ele e 37% têm parentes com antecedentes
criminais.
Ajudam a engrossar essas estatísticas os garotos Waldik Gabriel, de 11
anos, morto em Cidade Tiradentes, Zona Leste de São Paulo, depois de fugir
da Guarda Civil Metropolitana, e Ítalo, de 10 anos, envolvido em três
ocorrências de roubo só em 2016, morto pela Polícia Militar no início de junho,
depois de furtar um carro na Zona Sul da cidade. O pai de Waldik é
caminhoneiro e não vivia com a mãe. O de Ítalo está preso por tráfico. A mãe
já cumpriu pena por furto e roubo.
É certo que um pai presente e próximo ao filho faz diferença. Mas, mais que
a figura masculina propriamente dita, faz falta uma família estruturada,
independentemente da configuração, que dê atenção, carinho, apoio, noções
de continência e limite, elementos que protegem os jovens em fase de
desenvolvimento.
A mãe e a avó, nessa família brasileira que cresce cada vez mais matriarcal,

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 90 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

desdobram-se para tentar cumprir esses requisitos e preencher as lacunas,


PDVVmR³DWURSHODGDV´SHODURWLQDGXUD0XLWDVYH]HVQmRWrPWHPSRHQHUJLD
dinheiro e voz para lidar com esses garotos e garotas que crescem na rua,
longe da escola, em bairros sem equipamentos de esporte e cultura, próximos
de amigos e parentes que podem estar envolvidos com o crime.
A criança precisa ter muita autoestima e persistência para buscar nesse
horizonte nebuloso um projeto de vida. Sem apoio emocional, sem uma escola
que estimule seu potencial, sem ter o que fazer com seu tempo livre, sem
enxergar uma luz no fim do túnel, ela fica muito mais perto da droga, do
tráfico, do delito, da violência e da gestação na adolescência. É nessa mesma
família, sem pai à vista, de baixa renda, longe da sala de aula, nas periferias,
que pipocam os quase 15% das jovens que são mães na adolescência, taxa
alarmante que resiste a baixar nas regiões mais carentes.
E o que acontece com essa menina que engravida porque enxerga na
maternidade um papel social, uma forma de justificar sua existência no
mundo? Iludidas com a perspectiva de estabilizar um relacionamento (a família
estruturada que não têm?), elas ficam, usualmente, sozinhas, ainda mais
distantes da escola e de seu projeto de vida. O pai da criança some no mundo,
e são elas que arcam com o ônus do filho, sobrecarregando um lar que já vivia
no limite. Segue-se um ciclo que parece não ter fim.
Sem políticas públicas que foquem nessa família mais vulnerável, no apoio
emocional e social para esses jovens, em uma escola mais atraente, em
projetos de vida, em alternativas de lazer, a realidade diária na vida desses
jovens continuará a ser a gravidez na adolescência, a violência e a
criminalidade.
(Jairo Bouer, 11/07/2016. Disponível em: http://epoca.globo.com/colunas-
e-blogs/jairo-bouer/noticia/2016/07/importancia-da-
familiaestruturada.html.)
O tipo textual apresentado tem por característica a apresentação e a defesa
de uma ideia a respeito do tema abordado. Quanto à sua estruturação:
proposição, argumentação e conclusão, é possível afirmar que em sua
conclusão
a) há uma retomada da tese defendida e apresentada proposta de solução
para o problema discutido.
b) é feita uma exposição de opiniões contrárias àquela defendida pelo
desenvolvimento da tese no texto.
c) a tese defendida em todo o texto passa a ser definida de forma clara
através de uma afirmativa bem delimitada.
d) são empregados recursos argumentativos tais como exemplos e fatos
históricos que permitem o desenvolvimento da argumentação textual.
40. (CONSULPLAN / Psicólogo / 2016)
Entre as relevantes justificativas que podem ser apresentadas para a
FDUDFWHUL]DomRGDLQVWLWXLomR³IDPtOLD´LQGLFDGDQRWtWXORGHVWDFD-se, no texto,
a) o resultado de um levantamento feito pelo Ministério Público de São Paulo.
b) a falta de limites específicos cerceando o desenvolvimento de jovens e
adolescentes.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 91 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

c) o fato de cada vez mais menores de 15 anos serem vítimas e estarem


envolvidos em crimes.
d) a deficiente infraestrutura da sociedade para atender às demandas
econômicas e afetivas concomitantemente.
41. (CONSULPLAN / TRF 2ª REGIÃO / ANALISTA / 2017)
Texto para responder à questão.
)LQDOGRURPDQFH³9LGDV6HFDV´TXHQDUUDDIDPtOLDGH)DELDQRPDLVXPD
vez, se retirando para algum outro lugar, em virtude da seca:
Pouco a pouco uma vida nova, ainda confusa, se foi esboçando. Acomodar-
se-iam num sítio pequeno, o que parecia difícil a Fabiano, criado solto no mato.
Cultivariam um pedaço de terra. Mudar-se-iam depois para uma cidade, e os
meninos frequentariam escolas, seriam diferentes deles. Sinhá Vitória
esquentava-se. Fabiano ria, tinha desejo de esfregar as mãos agarradas à boca
do saco e à coronha da espingarda de pederneira.
Não sentia a espingarda, o saco, as pedras miúdas que lhe entravam nas
alpercatas, o cheiro de carniças que empestavam o caminho. As palavras de
Sinhá Vitória encantavam-no.
Iriam para diante, alcançariam uma terra desconhecida. Fabiano estava
contente e acreditava nessa terra, porque não sabia como ela era nem onde
era. Repetia docilmente as palavras de Sinhá Vitória, as palavras que Sinhá
Vitória murmurava porque tinha confiança nele. E andavam para o sul, metidos
naquele sonho. Uma cidade grande, cheia de pessoas fortes. Os meninos em
escolas, aprendendo coisas difíceis e necessárias. Eles dois velhinhos,
acabando-se como uns cachorros, inúteis, acabando-se como Baleia. Que
iriam fazer?
Retardaram-se, temerosos. Chegariam a uma terra desconhecida e
civilizada, ficariam presos nela. E o sertão continuaria a mandar gente para lá.
O sertão mandaria para a cidade homens fortes, brutos, como Fabiano, Sinhá
Vitoria e os dois meninos.
(Vidas Secas, Graciliano Ramos.)
³2 URPDQFH µ9LGDV 6HFDV¶ SXEOLFDGR HP  UHWUDWD D KLVWyULD GH )DELDQR
Sinhá Vitória e seus filhos, que, acompanhados da cachorra Baleia, mudam de
região de tempos em tempos para fugir da seca. Os problemas sociais, a fome,
a miséria e a desigualdade entre segmentos da sociedade são explorados no
romance que mostra a realidade brasileira, como a injustiça social. Do ponto
de vista jurídico, a obra traz uma reflexão sobre a desigualdade de direitos
entre os diversos segmentos da sociedade, além de mostrar como a privação
da palavra por parte dos personagens se contrapõe ao excesso das autoridades
HGDOHL´
Considerando o texto e o comentário anterior, pode-se afirmar que:
a) O comentário apresenta argumentos a fim de validar o posicionamento
assumido pelo enunciador que podem ser também identificados no texto.
b) Os textos apresentam estruturas típicas de uma narrativa, podendo ser
identificadas através do emprego de elementos que lhes são característicos.
c) É possível identificar e comprovar parte do conteúdo da análise da obra

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 92 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

³9LGDV6HFDV´IHLWDQRFRPHQWiULRDWUDYpVGRIUDJPHQWRGDPHVPDWUDQVFULWR
no texto.
d) Embora os textos apresentem-se como gêneros textuais equivalentes, sua
classificação quanto ao tipo textual é diversa tendo em vista a função da
linguagem identificada em cada um deles.
42. (CONSULPLAN / TRF 2ª REGIÃO / ANALISTA / 2017)
Utilizar texto da questão anterior.
(P³(OHVGRLVYHOKLQKRVDFDEDQGR-se como uns cachorros, inúteis, acabando-
VHFRPR%DOHLD´ ƒ† DFRQVWUXomRDSUHVHQWDGDpIHLWDHPSUHJDQGR-se, como
recurso linguístico,
a) a evidência de oposição estabelecida através de uma relação comparativa
entre elementos distintos.
b) uma palavra em sentido figurado, baseando-se em uma comparação
subentendida entre dois termos.
c) o exagero do sentido com o objetivo de conferir ênfase à informação
apresentada, constituindo uma variação de metáfora.
d) uma relação de semelhança entre dois termos atribuindo características
de um a outro por meio de um elemento comparativo explícito.
43. (CONSULPLAN / TRF 2ª REGIÃO / ANALISTA / 2017)

A produção da obra acima, Os Retirantes (1944), foi realizada seis anos depois
da publicação do romance Vidas Secas. Nessa obra, ao abordar a miséria e a
seca claramente vistas através da representação de uma família de retirantes,
Cândido Portinari
a) apresenta uma temática, assim como a descrição dos personagens e do
ambiente, de forma sutil e dinâmica.
b) permite visualizar a degradação da figura humana e o retrato da figura da
morte afugentada pelos personagens.
c) apresenta elementos físicos presentes no cotidiano dos retirantes vítimas
da seca e aspectos relacionados à desigualdade social.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 93 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

d) utiliza a linguagem não verbal com o objetivo de construir uma imagem


cuja ênfase mística se opõe aos fatos da realidade observável.
44. (CONSULPLAN / Engenheiro Seg. Trabalho / 2015)
Recomeço: a vida dos refugiados sírios em São Paulo
Em março deste ano, cinco meses antes da imagem do corpo do menino
Aylan Kurdi, de três anos, estirado nas areias da praia de Bodrum dar um tapa
na cara da humanidade, o Alto Comissário das Nações Unidas para Refugiados,
o português Antônio GuterresFODVVLILFRXDJXHUUDFLYLOGD6tULDFRPR³DSLRU
crise humanitária da nossa era" ± ou pelo menos a mais grave pósǦSegunda
Guerra. Em quatro anos e meio, o conflito insano que destruiu o país árabe
deixou mais de 250.000 mortos e espalhou 4 milhões de refugiados pelo
mundo ± 25% deles menores de idade. Do grupo que arriscou cruzar o
Atlântico rumo às Américas, a maioria desembarcou no Aeroporto
Internacional de Guarulhos, na região metropolitana de São Paulo. No Brasil,
o primeiro destino foi bater à porta da mesquita de Guarulhos, a 10
quilômetros de onde aterrissaram, em busca de abrigo.
Foi esse o caminho percorrido no ano passado por Marah Khamis, de 23
anos, ao lado do marido, dos pais e de três irmãs, que deixaram Damasco
depois que um familiar desenvolveu um câncer em consequência de uma
bomba química. Os bens foram convertidos em passagens aéreas para o Brasil.
Desembarcaram com poucas malas e economias suficientes para algumas
semanas. O único endereço em mente era a mesquita de Guarulhos, onde
foram acolhidos e se juntaram a cerca de 150 conterrâneos que seguiram o
mesmo itinerário ± hoje, o país contabiliza 2.077 refugiados sírios, segundo a
ONU.
Uma tragédia também foi o motivo que trouxe ao Brasil a síria Fateh
Saymeh, de 29 anos, o marido, Mohamed Saymeh, e as duas filhas de cinco
DQRV³0LQKDFDVDH[SORGLXQDPLQKDIUHQWHOHPEUD)DWHKGHIDODFDOPDH
serena ante as memórias da guerra. A indignação fica por conta do marido,
que assumiu uma dura rotina para sustentar a família. Saymeh é funcionário
de um restaurante das 9h às 18h, o que lhe rende 1.000 reais por mês ±
dinheiro que tem como destino o aluguel da casa. Para complementar a renda,
ele trabalha na Feira da Madrugada, no Brás. Embora ainda não consiga se
comunicar em português, ele já aprendeu a pronunciar as únicas palavras que
definem sua realidade ± HDGHPLOKDUHVGHEUDVLOHLURV³0XLWRFDQVDGR
(Disponível em: http://veja.abril.com.br/noticia/brasil/recomeco ǦaǦvidaǦdosǦrefugiadosǦsiriosǦ
emǦsaoǦpaulo. Acesso em: setembro de 2015.)

Apesar da composição textual em que o enunciador se oculta, o enunciado


apresenta, em alguns momentos, um ponto de vista. Tal afirmativa é
comprovada através do trecho destacado em:
D  ³3DUD FRPSOHPHQWDU D UHQGD HOH WUDEDOKD QD )eira da Madrugada, no
Brás." (3º§)
E ³>@DPDLRULDGHVHPEDUFRXQR$HURSRUWR,QWHUQDFLRQDOGH*XDUXOKRVQD
região metropolitana de São Paulo." (1º§)
F ³>@HVHMXQWDUDPDFHUFDGHFRQWHUUkQHRVTXHVHJXLUDPRPHVPR
itinerário ± hoje, o país contabiliza 2.077 refugiados sírios, segundo a ONU."
(2º§)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 94 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

G ³(PTXDWURDQRVHPHLRRFRQIOLWRLQVDQRTXHGHVWUXLXRSDtViUDEHGHL[RX
mais de 250.000 mortos e espalhou 4 milhões de refugiados pelo mundo [...]"
(1º§)..
45. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)
Internet e as novas mídias: contribuições para a
proteção do meio ambiente no ciberespaço
A sociedade passou por profundas transformações em que a realidade
socioeconômica modificou-se com rapidez junto ao desenvolvimento
incessante das economias de massas. Os mecanismos de produção
desenvolveram-se de tal forma a adequarem-se às necessidades e vontades
humanas. Contudo, o homem não mediu as possíveis consequências que tal
desenvolvimento pudesse causar de modo a provocar o desequilíbrio ao meio
ambiente e a própria ameaça à vida humana.
Desse modo, a preocupação com o meio ambiente é questionada, sendo
centro de tomada de decisões, diante da grave problemática que ameaça
romper com o equilíbrio ecológico do Planeta. E não apenas nos tradicionais
meios de comunicação, tais como jornais impressos, rádio, televisão, revistas,
dentre outros, como também nos espaços virtuais de interatividade, por meio
das novas mídias, as quais representam novos meios de comunicação, tem-se
o debate sobre a problemática ambiental.
O capitalismo foi reestruturado e a partir das transformações científicas e
tecnológicas deu-se origem a um novo estabelecimento social, em que por
meio de redes e da cultura da virtualidade, configura-se a chamada sociedade
informacional, na qual a comunicação e a informação constituem-se
ferramentas essenciais da Era Digital.
As novas mídias, por meio da utilização da Internet, estão sendo
consideradas como novos instrumentos de proteção do meio ambiente, na
medida em que proporcionam a expansão da informação ambiental, de
práticas sustentáveis, de reivindicações e ensejo de decisões em prol do meio
ambiente.
No ciberespaço, devido à conectividade em tempo real, é possível
promover debates de inúmeras questões como a construção da hidrelétrica de
Belo Monte, o Novo Código Florestal, Barra Grande, dentre outras, as quais
ensejam por tomada de decisões políticas, jurídicas e sociais. [...]
Vislumbra-se que a Internet é um meio que aproxima pessoas e
distâncias, sendo utilizada por um número ilimitado de pessoas, a custo
razoável e em tempo real. De fato, a Internet proporciona benefícios, pois,
além de promover a circulação de informações, a curto espaço de tempo,
muitos debates virtuais produzem manifestações sociais. Assim sendo, tem-
se a democratização das informações através dos espaços virtuais, como
blogs, websites, redes sociais, jornais virtuais, sites especializados, sites
oficiais, dentre outros, de modo a expandir conhecimentos, promover
discussões e, por vezes, influenciando nas tomadas de decisões dos
governantes e na proliferação de movimentos sociais. Desse modo, os
cidadãos acabam participando e exercendo a cidadania de forma democrática
no ciberespaço. [...]
Faz-se necessária a execução de ações concretas em prol do meio

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 95 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

ambiente, com adaptação e intermédio do novo padrão de democracia


participativa fomentado pelas novas mídias, a fim de enfrentar a gestão dos
riscos ambientais, dentre outras questões socioambientais. Ainda, são
necessárias discussões aprofundadas sobre a complexidade ambiental,
agregando a interdisciplinaridade para escolhas sustentáveis e na difusão do
conhecimento. E, embora haja inúmeros desafios a percorrer com a utilização
das tecnologias de comunicação e informaomR QRYDV7,&¶V HQWHQGH-se que
a atuação das novas mídias é de suma importância, pois possibilita a expansão
da informação, a práxis ambiental, o debate e as aspirações dos cidadãos,
contribuindo, dessa forma, para a proteção do meio ambiente.

De acordo com as informações e ideias acerca do assunto tratado no texto,


marque V para as afirmativas verdadeiras e F para as falsas.
( ) O meio virtual tornou-se um espaço que propicia não só a participação do
cidadão em questões de relevância social, mas também o exercício efetivo da
cidadania advinda de tal prática.
( ) Em uma sociedade de característica predominantemente informacional, é
notório que a comunicação atua como um dos elementos transformadores de
ideias e estruturas anteriores que preconizavam um sistema inconsequente.
( ) As transformações vistas na sociedade refletem o crescimento econômico
desordenado na medida em que as preocupações se voltam para os interesses
capitalistas através dos meios mais diversos de comunicação, entre eles, os
virtuais.
A sequência está correta em
a) V, V, F.
b) F, F, F.
c) V, F, F.
d) V, V, V.
46. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)
No desenvolvimento textual, é notório que o emprego de conectivos e
operadores argumentativos contribui para a eficácia da argumentação, deste
modo, a sua ampla compreensão se faz necessária. Nesta perspectiva, em
³>@HQWHQGH-se que a atuação das novas mídias é de suma
importância, pois possibilita a expansão da informação, a práxis
ambiental, o debate e as aspirações dos cidadãos>@´ ž† SRGH-se
afirmar acerca do termo destacado que
a) articula, em um enunciado, tese e argumento estabelecendo uma ligação
semântica em que há uma relação de explicação.
b) relaciona o argumento que o antecede ao que o sucede, tornando-os
equivalentes quanto à ênfase que lhes é atribuída.
c) orienta para uma conclusão implícita em relação à informação antecedente
de modo que sua função é finalizar o ponto de vista exposto.
d) indica uma pressuposição em relação ao assunto antes de sua enunciação,
evidenciando sua importância no desenvolvimento da argumentação.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 96 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

47. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)


Faz-se necessária a execução de ações concretas em prol do meio
ambiente, com adaptação e intermédio do novo padrão de democracia
participativa fomentado pelas novas mídias, a fim de enfrentar a gestão dos
riscos ambientais, dentre outras questões socioambientais. Ainda, são
necessárias discussões aprofundadas sobre a complexidade ambiental,
agregando a interdisciplinaridade para escolhas sustentáveis e na difusão do
conhecimento. E, embora haja inúmeros desafios a percorrer com a utilização
daVWHFQRORJLDVGHFRPXQLFDomRHLQIRUPDomR QRYDV7,&¶V HQWHQGH-se que
a atuação das novas mídias é de suma importância, pois possibilita a expansão
da informação, a práxis ambiental, o debate e as aspirações dos cidadãos,
contribuindo, dessa forma, para a proteção do meio ambiente.
O último parágrafo do texto, principalmente,
a) apresenta a simples reordenação de argumentos já elaborados ao longo
do texto através da retomada de elementos utilizados durante o seu
desenvolvimento.
b) expressa a realidade atual da situação apresentada ao longo do texto
propondo a conscientização, através de políticas públicas, do cidadão sobre
essa realidade.
c) pressupõe que os direitos do cidadão são garantidos pelo Estado de modo
que a execução de ações em favor do meio ambiente depende, de forma
exclusiva, de tal garantia.
d) propõe o desempenho de um conjunto de práticas cidadãs cujo objetivo é
atender às questões apresentadas de modo real e transformador..
48. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)
Mentes livres
Atualmente, já está muito claro que nossas experiências mentais estão
sempre criando estruturas cerebrais que facilitam a resposta rápida a futuras
demandas semelhantes. O tema mais importante, no entanto, não é que as
estruturas se ampliem sempre, é a liberdade natural da mente, que opera
além das estruturas.
Um motorista não é seu carro, nem por onde circula. Ele tem a liberdade
de deixar o carro e seguir por outros meios e também de repensar seus
trajetos. Ainda assim, se as estradas ficarem bloqueadas ou o carro quebrar,
ele terá dificuldade em andar a pé e usará o tempo arrumando o carro ou
colocando a estrada em condições de uso. Só ao final de um tempo ele
conseguirá ultrapassar as fixações estruturais internas e refazer suas opções.
Em verdade, a liberdade do motorista é tal que nem mesmo motorista ele
é. Ele é um ser livre. A prática espiritual profunda conduz a essa liberdade,
naturalmente presente. As fixações são o carma. As experiências comuns no
mundo, eventos maiores e menores, vão se consolidando como trajetos e
redes neurais internas e estruturas cármicas que balizam a operação da
mente, estruturando recursos limitados como se fossem as únicas opções,
ainda que, essencialmente, a mente siga livre.
As estruturas grosseiras como os espaços das cidades, as ruas físicas, e em
um sentido mais amplo tudo o que aciona nossos sentidos físicos, surgem

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 97 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

também como resultado das atividades mentais repetitivas, assim como a


circulação da energia interna, que é o aspecto sutil. Um automobilista precisa
de uma transformação interna e externa complexa para se tornar um ciclista;
não é fácil. Já o tripulante do sofá tem dificuldade em incluir exercícios, novos
hábitos de alimentação e mudanças na autoimagem ± os desafios são
idênticos.
Nossos melhores pensamentos constroem mundos melhores e também
cérebros melhores. Já os pensamentos aflitivos constroem mundos piores e
cérebros com estruturas que conduzem à aflição e à doença.
Tanto os aspectos grosseiros como os sutis flutuam; é visível. A única
expressão incessantemente presente e disponível é a liberdade natural
silenciosa dentro de nós mesmos. É dessa natureza que surge a energia que,
livre de condicionamentos, cria novos caminhos neurais e novas configurações
de mundo. Os mestres de sabedoria apontam-na como sempre disponível,
mesmo durante experiências como a doença e a morte. É dessa região
inabalável que irradiam sua sabedoria, compaixão e destemor.
(SAMTEN, Padma ± 5HYLVWD³9LGDVLPSOHV´± agosto 2014 ± Ed. Abril.)

De acordo com o texto é correto afirmar que


a) o motorista, ainda que incipiente em sua função, é passível de sobrepor-
se ao carma que condiciona as ações da sua mente.
b) seu teor, por ser eminentemente exotérico, foi produzido para um limitado
círculo de pensadores, embora veiculado em mídia.
c) a suposta liberdade silenciosa que existiria dentro de cada um de nós não
é capaz de superar as estruturas cármicas que balizam a operação da mente.
d) o surgimento e ampliação constante de estruturas do cérebro não são a
parte mais importante do processo e, sim, a condição da mente em
descondicionar-se desse processo.
49. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)
Depreende-se do texto que
a) o homem jamais se liberta do carma de que sua alma se reveste
b) o condicionamento impede o homem de criar novas estruturas de mundo.
c) o homem pode conseguir ser livre se obedecer às determinações cármicas
e se deixar fluir.
d) a criação dos espaços e tudo o que coloca em ação nossos sentidos não
são frutos de atividades mentais.
50. (CONSULPLAN / TRF 2ª REGIÃO / TÉCNICO / 2017)
Por sua estrutura e características, o texto em análise deve ser classificado
como
a) injuntivo.
b) narrativo.
c) descritivo.
d) dissertativo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 98 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

51. (CONSULPLAN / Engenheiro Seg. Trabalho / 2015)


O rápido e significativo crescimento das cidades brasileiras, nas últimas seis
décadas, ocasionou três fenômenos de grande relevância:
‡WUDQVLomRGHXPSDtVSUHGRPLQDQWHPHQWHUXUDOSDUDRSDWDPDUDWXDORQGH
aproximadamente 80% da população passa a residir em áreas urbanas;
‡WULSOLFDomRGDSRSXODomRDROongo deste mesmo período;
‡FUHVFLPHQWRGDIURWDGHYHtFXORVDSDUWLUGRGHVHQYROYLPHQWRLQGXVWULDOFRP
foco na indústria automobilística.
A consideração da inter-relação existente entre cidades sustentáveis, redes
de transporte de qualidade, eficiência energética, respeito ao meio ambiente
e renda da população, impõe-se como questão indiscutível, exigindo atuação
e colaboração entre os diferentes setores de governo e ação integrada nos três
níveis de poder, sob pena de não alcançar a desejada inclusão social com
qualidade de vida nas cidades.
A experiência mundial aponta para a importância dos sistemas sobre trilhos
como uma solução eficiente para estruturação das redes de transporte urbano
nas médias e grandes cidades. O setor metroferroviário é capaz de
proporcionar impactos muito relevantes e positivos sobre os aspectos
anteriormente mencionados. Ao mesmo tempo, exige vultosos investimentos
para sua implantação e expansão, tornando imprescindível o apoio da União,
em conjunto com os poderes locais, num planejamento mais amplo e
consistente de priorização de investimentos no setor.
(Disponível em: http://www.cbtu.gov.br/estudos/evol_inst/evolucao.pdf.)

Considerando aspectos e estrutura textuais, é correto afirmar que o texto tem


com principal objetivo
a) argumentar acerca da importância do transporte urbano
³PHWURIHUURYLiULR´
b) discutir acerca dos efeitos causados pelo rápido crescimento das grandes
cidades.
c) diagnosticar atuais condições de transportes urbanos apontando possíveis
soluções.
d) expor informações, de forma objetiva, sobre o transporte urbano
³PHWURIHUURYLiULR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 99 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 08 ± Felipe Luccas Rosas

Gabaritos
1. LETRA D
2. LETRA D
3. CORRETA
4. LETRA C
5. CORRETA
6. CORRETA
7. LETRA B
8. LETRA A
9. LETRA C
10. INCORRETA
11. LETRA C
12. LETRA A
13. CORRETA
14. LETRA D
15. CORRETA
16. LETRA E
17. LETRA B
18. LETRA D
19. CORRETA
20. LETRA C
21. LETRA C
22. LETRA D
23. LETRA C
24. LETRA A
25. LETRA C
26. FFFFF
27. LETRA B
28. CORRETA
29. INCORRETA
30. CORRETA
31. INCORRETA
32. CORRETA
33. LETRA C
34. LETRA A
35. LETRA C
36. LETRA D
37. LETRA C
38. LETRA D
39. LETRA A
40. LETRA A
41. LETRA C
42. LETRA D
43. LETRA C
44. LETRA D
45. LETRA A
46. LETRA A
47. LETRA D
48. LETRA D
49. LETRA B
50. LETRA D
51. LETRA A

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 100 de 100
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Lista de Questões

1. (FGV / DPE-RO / Analista em Redação / 2016)

A charge poderia ser ilustração do seguinte item do conteúdo programático


desta prova:
a) variação linguística;
b) marcas de textualidade;
c) língua falada e língua escrita;
d) redação oficial;
e) o esquema da comunicação linguística.
2. (PREFEITURA DE FORTALEZA / 2016)
Quanto à questão da variação linguística, é incorreto afirmar que:
a) a variação linguística é característica das línguas humanas.
b) a variação linguística acontece em todos os níveis.
c) a variação linguística originou-se na Antiguidade.
d) a variação linguística sempre existiu.
3. (CONSULPLAN / TRE-MG / ANALISTA / 2013)
Artigo VII
Por decreto irrevogável fica estabelecido
o reinado permanente da justiça e da claridade,
e a alegria será uma bandeira generosa
para sempre desfraldada na alma do povo.

Em relação à linguagem utilizada por Thiago de Mello, é correto afirmar que


a) se revela plurissignificativa e requer a interpretação dos elementos

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 48 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

textuais.
b) tem como característica a objetividade, tendo em vista a finalidade de
tal gênero textual.
c) o significado explícito dos elementos do texto permite sua compreensão
imediata e concreta.
d) indica a valorização de falares regionais em oposição ao preconceito
linguístico ainda existente na sociedade.
e) ironiza valores como justiça e alegria ao estabelecer comparações com
elementos como reinado e bandeira.
4. (CESPE / FUB / 2015)
Texto III
1 A língua que falamos, seja qual for (português,
inglês...), não é uma, são várias. Tanto que um dos mais
eminentes gramáticos brasileiros, Evanildo Bechara, disse a
UHVSHLWR³7RGRVWHPRVGHVHUSROLJORWDVHPQRVVDSUySULD
OtQJXD´4XDOTXHUXPVDEHTXHQmRVHGHYHIDODUHPXPD
reunião de trabalho como se falaria em uma mesa de bar. A
7 língua varia com, no mínimo, quatro parâmetros básicos: no
tempo (daí o português medieval, renascentista, do século XIX,
dos anos 1940, de hoje em dia); no espaço (português lusitano,
10 brasileiro e mais: um português carioca, paulista, sulista,
nordestino); segundo a escolaridade do falante (que resulta em
duas variedades de língua: a escolarizada e a não escolarizada)
13 e finalmente varia segundo a situação de comunicação, isto é,
o local em que estamos, a pessoa com quem falamos e o motivo
GDQRVVDFRPXQLFDomRȸHQHVVHFDVRKiSHORPHQRVGXDV
16 variedades de fala: formal e informal.
A língua é como a roupa que vestimos: há um traje
para cada ocasião. Há situações em que se deve usar traje
19 social, outras em que o mais adequado é o casual, sem falar nas
situações em que se usa maiô ou mesmo nada, quando se toma
banho. Trata-se de normas indumentárias que pressupõem um
XVR³QRUPDO´1mRpSURLELGRLUjSUDLDGHWHUQRPDVQmRp
normal, pois causa estranheza.
A língua funciona do mesmo modo: há uma norma
25 para entrevistas de emprego, audiências judiciais; e outra para
a comunicação em compras no supermercado. A norma culta é

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 49 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

o padrão de linguagem que se deve usar em situações formais.


28 A questão é a seguinte: devemos usar a norma culta em
todas as situações? Evidentemente que não, sob pena de
SDUHFHUPRVSHGDQWHV'L]HU³QyVI{UDPRV´HPYH]GH³DJHQWH
WLQKDLGR´HPXPDFRQYHUVDGHERWHTXLPpFRPRLUGHWHUQRj
praia. E quanto a corrigir quem fala errado? É claro que os pais
devem ensinar seus filhos a se expressar corretamente, e o
34 professor deve corrigir o aluno, mas será que temos o direito de
DGYHUWLUREDOFRQLVWDTXHQRVFREUD³GRLVUHDO´SHORFDIH]LQKR"

De acordo com o texto acima, julgue o seguinte item.

Depreende-se do texto que a língua falada não é uma, mas são várias
porque, a depender da situação, o falante pode se expressar com maior ou
menor formalidade.
5. (FGV / MPE-RJ / Analista Processual / 2016)
Texto 2 ± Violência e favelas

O crescimento dos índices de violência e a dramática transformação do


crime manifestados nas grandes metrópoles são alarmantes, sobretudo, na
cidade do Rio de Janeiro, sendo as favelas as mais afetadas nesse processo.
³$YLROrQFLDHVWiRcúmulo do absurdo. É geral, não é? É geral, não tem,
não está distinguindo raça, cor, dinheiro, com dinheiro, sem dinheiro, tá de
pessoa para pessoa, não interessa se eu te conheço ou se eu não te conheço.
Me irritou na rua eu te dou um tiro. É assim mesmo que está, e é irritante,
o ser humano está em um estado de nervos que ele não está mais se
controlando, aí junta a falta de dinheiro, junta falta de tudo, e quem tem
mais tá querendo mais, e quem tem menos tá querendo alguma coisa e vai
descontar em cima de quem tem mais, e tá uma rivalidade, uma violência
TXH QmR WHP PDLV WDPDQKR Wi XPD FRLVD LQVXSRUWiYHO´ PRUDGRUD GD
Rocinha)
A recente escalada da violência no país está relacionada ao processo de
globalização que se verifica, inclusive, ao nível das redes de criminalidade.
A comunicação entre as redes internacionais ligadas ao crime organizado são
realizadas para negociar armas e drogas. Por outro lado, verifica-se hoje,
com as CPIs (Comissão Parlamentar de Inquérito) instaladas, ligações entre
atores presentes em instituições estatais e redes do narcotráfico.
Nesse contexto, as camadas populares e seus bairros/favelas são
crescentemente objeto de estigmatização, percebidos como causa da
desordem social o que contribui para aprofundar a segregação nesses
espaços. No outro polo, verifica-se um crescimento da autossegregação,
especialmente por parte das elites que se encastelam nos enclaves
fortificados na tentativa de se proteger da violência.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 50 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

0DULD GH )iWLPD &DEUDO 0DUTXHV *RPHV 6FULSWD 1RYD  ³$ YLROrQFLD
está o cúmulo do absurdo. É geral, não é? É geral, não tem, não está
distinguindo raça, cor, dinheiro, com dinheiro, sem dinheiro, tá de pessoa
para pessoa, não interessa se eu te conheço ou se eu não te conheço. Me
LUULWRXQDUXDHXWHGRXXPWLUR´

A fala da moradora da Rocinha mostra certas características distintas da


variedade padrão de linguagem; a única característica que NÃO está
comprovada pelo exemplo dado é:
a) segmentoVGHVFRQH[RV³QmRWHP´
E IRUPDVUHGX]LGDV³WiGHSHVVRDSDUDSHVVRD´
F H[SOLFDo}HVGHVQHFHVViULDV³FRPGLQKHLURVHPGLQKHLUR´
G PLVWXUDGHWUDWDPHQWR³VHHXWHFRQKHoRRXVHHXQmRWHFRQKHoR´
H HUURVJUDPDWLFDLV³PHLUULWRXQDUXD´
6. (FGV / MPE-RJ / Técnico Processual / 2016)
O segmento abaixo que mostra exemplo de linguagem coloquial é:
D  ³$ LQIRUPDomR GH VD~GH DSUHVHQWDGD QD ,QWHUQHW GHYH VHU H[DWD
atualizada, de fácil entendimento, em linguagem objetiva e cientificamente
IXQGDPHQWDGD´
E  ³'D PHVPD IRUPD SURGXWRV H VHUYLoRV GHYHP VHU DSUHVHQWDGRV H
descritos com exatidão e clarezD´
F  ³'LFDV H DFRQVHOKDPHQWRV HP VD~GH GHYHP VHU SUHVWDGRV SRU
profissionais qualificados, com base em estudos, pesquisas, protocolos,
FRQVHQVRVHSUiWLFDFOtQLFD´
G ³'HYHHVWDUYLVtYHODGDWDGDSXEOLFDomRRXGDUHYLVmRGDLQIRUPDomR
para que o XVXiULRWHQKDFHUWH]DGDDWXDOLGDGHGRVLWH´
H  ³2V VLWHV GHYHP FLWDU WRGDV DV IRQWHV XWLOL]DGDV SDUD DV LQIRUPDo}HV
critério de seleção de conteúdo e política editorial do site, com destaque para
QRPHHFRQWDWRFRPRVUHVSRQViYHLV´
7. (FGV / TJ-PI / OFICIAL DE JUSTIÇA / 2016)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 51 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

A linguagem verbal empregada na charge mostra:


a) desvios da norma culta;
b) traços de regionalismo;
c) marcas de linguagem coloquial;
d) sinais de linguagem formal;
e) aspectos de uma linguagem arcaica.
8. (FCC / Prof. de Língua Portuguesa / SEDU-ES /2016)
Embora tivesse vindo ao mundo no dia 16 de Novembro de 1922, os meus
documentos oficiais referem que nasci dois dias depois, a 18: foi graças a
esta pequena fraude que a família escapou ao pagamento da multa por falta
de declaração do nascimento no prazo legal.

No texto acima, verifica-VH TXH R HPSUHJR GD SUHSRVLomR HP ³D ´ p
indicativo da variedade linguística
a) histórica, que se refere à dinamicidade da língua, que muda
permanentemente com os seus falantes.
b) social, que depende do contexto de comunicação, de quem são os
interlocutores e seus objetivos.
c) relativa à faixa etária: crianças, jovens, adultos e velhos podem ter um
vocabulário diverso.
d) geográfica, pois se refere ao uso da mesma língua em diferentes países.
e) de registro, relacionada ao maior grau de informalidade entre os
interlocutores.
9. (FGV / TJ-PI / OFICIAL DE JUSTIÇA / 2016)

$IDODGDIXQFLRQiULD³2.6HQKRU9RXHVWDUDQRWDQGRRVHXSUREOHPDSDUD
estar agendando a visita de um técnico" mostra uma marca típica desse
modo de falar, que é:
a) a presença marcante de estrangeirismos;

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 52 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

b) o emprego de uma linguagem demasiadamente erudita;


c) o mau uso do gerúndio;
d) a completa falta de objetividade na mensagem;
e) a ausência de tratamento individualizado.
10. (FGV / Prefeitura de Niterói / 2016)

A linguagem da charge deve ser classificada como:


a) formal, pois não apresenta desvios gramaticais;
b) informal, pois emprega termos de gíria;
c) regional, já que mostra marcas de certa região do país;
d) jargão profissional, visto que contém expressões típicas de políticos;
e) erudita, já que inclui termos e construções rebuscadas.
11. (FGV / Prefeitura de Niterói / 2016)

Por tratar-se de uma charge humorística é comum a presença da linguagem


coloquial que, nas falas da charge, se manifesta:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 53 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

D QRHPSUHJRGDJtULD³LGLRWD´
b) na utilização de um nome no diminutivo;
c) no emprego do tratamento você;
d) na ausência de resposta sim/não de Miguelito;
H QRHPSUHJRGH³Dt´FRPRFRQMXQomR
12. (SAEP-PR / Matriz de Referência / 2016)
A literatura da era digital
A internet tem sido um veículo de extrema importância para a divulgação
dos escritores das novas gerações, assim como dos autores de épocas em
que os únicos meios de acesso à leitura eram o livro e os jornais. Hoje, com
todo o advento da tecnologia, os leitores de diversas faixas etárias e de
qualquer parte do mundo podem acessar e fazer o download gratuito de uma
infinidade de livros [...]. Pesquisas recentes indicam que o número de obras
literárias de poesia e ficção tem crescido consideravelmente nos últimos
anos. Vários escritores têm preferido publicar seus textos ou livros
virtualmente a ter que enfrentar os critérios e a seleção, muitas vezes
injusta, das editoras. Portanto, a internet tem se tomado um espaço
facilitador que acaba por redimensionar a literatura em todo o mundo. Nos
Estados Unidos, por exemplo, até escritores consagrados disponibilizam seus
textos na internet, pois têm consciência de que a acessibilidade dos leitores
ao mundo virtual é muito grande, apesar de o mercado editorial americano
ser também um monstruoso veículo de divulgação da literatura. Nos países
da Europa, apesar da enorme quantidade de livrarias e bibliotecas e de todas
as leis de incentivo à publicação que barateiam o preço dos livros, os
escritores não hesitam em publicar suas obras pela web, porque sabem que
lá também estão os seus leitores. [...]
Nesse texto, o uso de palavras como "web", "download", "internet" são típicas
da linguagem
b) coloquial. formal. jornalística. técnica.
13. (FGV / Prefeitura de Cuiabá / Condutor / 2016)
A novela
Considerar a telenovela um produto cultural alienante é um tremendo
preconceito da universidade. Quem acha que novela aliena está na verdade
chamando o povo de débil mental. Bobagem imaginar que alguém é induzido
a pensar que a vida é um mar de rosas só por causa de um enredo
açucarado. A telenovela brasileira é um produto cultural de alta qualidade
técnica, e algumas delas são verdadeiras obras de arte.
Ela é educativa no sentido de levantar certas discussões para um público
relativamente pouco informado. Na década de 70, os autores faziam isso de
maneira mais sutil. Nos dias atuais, sem censura, as discussões podem ser
mais abertas.
Entre as palavras escritas no texto 2, aquela que é bastante informal ou
popular é
D ³SURGXWRE ³WHOHQRYHODF ³EREDJHPG ³VXWLO H ³HQUHGR

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 54 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

14. (FGV / DPE-RO / Analista em Redação / 2016)


Indique a frase em que a utilização do pronome pessoal é típica da linguagem
coloquial:
a) Foi-se deitar às sete horas da noite;
b) Encontrou elas na saída do shopping;
c) Ele estava descrevendo-se pior do que era;
d) Ele se estava descrevendo pior do que era;
e) Ele e ela se distanciaram do grupo.
15. (FGV / DPO-RR / Analista em Redação / 2016)
³$ JHQWH QmR VDEH EHP SRU RQGH YDL SRUTXH WHP PXLWRV REVWiFXORV QR
caminho; para mim decidir, só entre eu e você, tenho que consultar minha
mãe, já que ela conhece tudo SRUDTXL´
Nesse segmento de texto há uma série de marcas de uma variedade
linguística popular: a apreciação inadequada sobre um dos componentes do
texto é:
D HPSUHJRGH³DJHQWH´HPOXJDUGH³QyV´
E HPSUHJRGRYHUER³WHU´HPOXJDUGH³KDYHU´
F HPSUHJRGH³PLP´HPOXJDUGH³HX´HP³SDUDPLPGHFLGLU´
G HPSUHJRGH³HX´HPOXJDUGHPLPHP³HQWUHHXHYRFr´
H HPSUHJRGH³FRQKHFHWXGR´HPOXJDUGH³FRQKHFHGHWXGR´
16. ( FGV / TJ-RJ / ANALISTA JUDICIÁRIO / 2016)
TEXTO 2
Estamos no trânsito de São Paulo, ano 2030. E não é preciso apertar os
cintos: nosso carro agora trafega sozinho pelas ruas, salvo de acidentes,
graças a um sistema que o mantém em sincronia com os demais veículos lá
fora. O volante, item de uso opcional, inclina-se de um lado para outro como
se fosse manuseado por um fantasma. Mas ninguém liga pra ele - até porque
o carro do futuro está cheio de novidades bem mais legais. Em vez dos
tradicionais quatro assentos, o que temos agora é uma verdadeira sala de
estar, com poltronas reclináveis, mesa no centro e telas de LED. As velhas
carrocerias de aço foram substituídas por redomas translúcidas, com
visibilidade total para o ambiente externo. Se você preferir, é possível torná-
la opaca e transformar o carro em um ambiente privado, quase como um
quarto ambulante. Como o sistema de navegação é autônomo, basta
informar ao computador aonde você quer ir e ele faz o resto. Resta passar o
tempo da forma que lhe der na telha: lendo, trabalhando, assistindo ao seu
seriado preferido ou até dormindo. A viagem é agradável e silenciosa.
O segmento do texto 2 que mostra variação culta de linguagem, sem traços
de informalidade ou oralidade é:
D ³PDQWpPHPVLQFURQLDFRPRVGHPDLVYHtFXORVOiIRUD´
E ³RTXHWHPRVDJRUDpXPDYHUGDGHLUDVDODGHHVWDU´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 55 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

F ³0DVQLQJXpPOLJDSUDHOH´
G ³HVWiFKHLRGHQRYLGDGHVEHPPDLVOHJDLV´
H ³DVVLVWLQGRDRVHXVHULDGRSUHIHULGR´
17. (FGV / SEDUC-AM / PROFESSOR DE PORTUGUÊS / 2014)
Assinale a opção que indica a característica que marca a língua escrita e não
a língua falada.
a) O receptor está ausente, o que impede o progressivo refinamento do
enunciado diante de dificuldades.
b) O referente também envolve a situação, provocando ausência de alusões
claras a esse referente.
c) As conexões entre as frases é menos explícita, com presença de
conectores como então, aí etc ==c0834==

d) As repetições são frequentes, assim como as omissões, esquecimentos,


desvios etc.
e) Vocabulário mais reduzido.
18. ( Cesgranrio / CEFET-RJ / Revisor de Textos / 2014)

O diálogo do Texto IV se dá entre uma entrevistadora e um informante jovem


de nível superior.
Na sua reescritura, com base na norma-padrão, em que fossem retiradas as
marcas de oralidade, pode ser mantida apenas a seguinte palavra ou
expressão:
a) bem (L. 5)
b) ah: : (L. 5)
c) né? (L. 6)
d) é que (L. 7)
e) em torno de (L. 7-8)
19. (FGV / FUNARTE / CONTADOR / 2014)
Brasileiro, Homem do Amanhã
(Paulo Mendes Campos)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 56 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Há em nosso povo duas constantes que nos induzem a sustentar que


o Brasil é o único país brasileiro de todo o mundo. Brasileiro até demais.
Colunas da brasilidade, as duas colunas são: a capacidade de dar um jeito;
a capacidade de adiar.
A primeira é ainda escassamente conhecida, e nada compreendida,
no Exterior; a segunda, no entanto, já anda bastante divulgada lá fora, sem
que, direta ou sistematicamente, o corpo diplomático contribua para isso.
Aquilo que Oscar Wilde e Mark Twain diziam apenas por humorismo
(nunca se fazer amanhã aquilo que se pode fazer depois de amanhã), não é
no Brasil uma deliberada norma de conduta, uma diretriz fundamental. Não,
é mais, é bem mais forte do que qualquer princípio da vontade: é um instinto
inelutável, uma força espontânea da estranha e surpreendente raça
brasileira.
Para o brasileiro, os atos fundamentais da existência são:
nascimento, reprodução, procrastinação e morte (esta última, se possível,
também adiada).
Adiamos em virtude dum verdadeiro e inevitável estímulo inibitório,
do mesmo modo que protegemos os olhos com a mão ao surgir na nossa
frente um foco luminoso intenso. A coisa deu em reflexo condicionado:
proposto qualquer problema a um brasileiro, ele reage de pronto com as
palavras: logo à tarde, só à noite; amanhã; segunda-feira; depois do
Carnaval; no ano que vem.
Adiamos tudo: o bem e o mal, o bom e o mau, que não se confundem,
mas tantas vezes se desemparelham. Adiamos o trabalho, o encontro, o
almoço, o telefonema, o dentista, o dentista nos adia, a conversa séria, o
pagamento do imposto de renda, as férias, a reforma agrária, o seguro de
vida, o exame médico, a visita de pêsames, o conserto do automóvel, o
concerto de Beethoven, o túnel para Niterói, a festa de aniversário da
criança, as relações com a China, tudo. Até o amor. Só a morte e a
promissória são mais ou menos pontuais entre nós. Mesmo assim, há
remédio para a promissória: o adiamento bi ou trimestral da reforma, uma
instituição sacrossanta no Brasil.
Quanto à morte não devem ser esquecidos dois poemas típicos do
Romantismo: na Canção do Exílio, Gonçalves Dias roga a Deus não permitir
que morra sem que volte para lá, isto é, para cá. Já Álvares de Azevedo tem
DTXHOH IDPRVR SRHPD FXMR UHIUmR p VLQWRPDWLFDPHQWH EUDVLOHLUR ³6H HX
PRUUHVVHDPDQKm´&RPRVHvê, nem os românticos aceitavam morrer hoje,
postulando a Deus prazos mais confortáveis.
Sim, adiamos por força dum incoercível destino nacional, do mesmo
modo que, por obra do fado, o francês poupa dinheiro, o inglês confia no
Times, o português adora bacalhau, o alemão trabalha com um furor
disciplinado, o espanhol se excita com a morte, o japonês esconde o
pensamento, o americano escolhe sempre a gravata mais colorida.
O brasileiro adia, logo existe.
A divulgação dessa nossa capacidade autóctone para a incessante
delonga transpõe as fronteiras e o Atlântico. A verdade é que já está nos
manuais. Ainda há pouco, lendo um livro francês sobre o Brasil, incluído

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 57 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

numa coleção quase didática de viagens, encontrei no fim do volume


algumas informações essenciais sobre nós e sobre a nossa terra. Entre
poucos endereços de embaixadas e consulados, estatísticas, indicações
culinárias, o autor intercalou o seguinte tópico:
Palavras
Hier: ontem
AXMRXUG¶KXLKRMH
Demain: amanhã
$~QLFDSDODYUDLPSRUWDQWHp³DPDQKm´
Ora, este francês astuto agarrou-nos pela perna. O resto eu adio para
a semana que vem.

A linguagem coloquial aparece seguidas vezes no texto. O segmento que a


exemplifica é:
D  ³$ GLYXOJDomR GHVVD QRVVD FDSDFLGDGH DXWyFWRQH SDUD D LQFHVVDQWH
GHORQJDWUDQVS}HDVIURQWHLUDVHR$WOkQWLFR´
E ³$LQGDKiSRXFR OHQGRXPOLYURIUDQFrVVREUHR%UDVLO LQFOXtGRQXPD
coleção quase didática de viagens, encontrei no fim do volume algumas
LQIRUPDo}HVHVVHQFLDLVVREUHQyVHVREUHDQRVVDWHUUD´
F ³2UDHVWHIUDQFrVDVWXWRDJDUURX-nos pela perna. O resto eu adio para
DVHPDQDTXHYHP´
G ³$SULPHLUDpDLQGDHVFDVVDPHQWHFRQKHFLGDHQDGDFRPSUHHQGLGD, no
Exterior; a segunda, no entanto, já anda bastante divulgada lá fora, sem
TXHGLUHWDRXVLVWHPDWLFDPHQWHRFRUSRGLSORPiWLFRFRQWULEXDSDUDLVVR´
H  ³4XDQWR j PRUWH QmR GHYHP VHU HVTXHFLGRV GRLV SRHPDV WtSLFRV GR
Romantismo: na Canção do Exílio, Gonçalves Dias roga a Deus não permitir
TXHPRUUDVHPTXHYROWHSDUDOiLVWRpSDUDFi´
20. (CESPE / BACEN / TÉCNICO / 2013)

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 58 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Em relação ao texto apresentado acima, julgue os itens seguintes.


(P ³35(6(17( 35$ *5(*2´ R HPSUHJR GD IRUPD SUHSRVLWLYD ³SUD´ p
inadequado, dado o grau de formalidade do texto.
21. (FGV / FUNDAÇÃO PRÓ-SANGUE / 2013)
Até 73% dos erros cometidos em hospitais no país são evitáveis
Até 73% dos erros que acontecem dentro de hospitais brasileiros, como
medicações trocadas ou operação de membros errados, poderiam ser
evitados.
É o que apontam estudos da Fiocruz apresentados no QualiHosp
(congresso de qualidade em serviços de saúde) e que ajudaram o Ministério
da Saúde a criar novas normas de segurança hospitalar que passam a valer
a partir de 2014.
As pesquisas, feitas em dois hospitais públicos do Rio, encontraram uma
incidência média de 8,4% de eventos adversos, semelhante aos índices
internacionais.
No Brasil, no entanto, é alto o índice de problemas evitáveis: de 66,7%
a 73%. Em outros países, a incidência variou de 27% (França) a 51%
(Austrália). Em números absolutos, isso significa que, em 2008, dos 11,1
milhões de internados no SUS, 563 mil foram vítimas de erros evitáveis.
Para Walter Mendes, pesquisador da Fiocruz e consultor do comitê do
programa de segurança do paciente, embora haja limitações metodológicas
ao extrapolar os resultados para o resto do país, os estudos indicam a
magnitude do problema.
"É um quadro barra pesada. Nos países desenvolvidos, existem políticas
de segurança bem consolidadas. Aqui estamos acordando com um pouco de
atraso", diz ele.

A linguagem do pesquisador pode ser caracterizada como


a) formal
b) coloquial
c) regional
d) erudita
e) técnica

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 59 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

22. (FCC / CAIXA ECONÔMICA / ENGENHEIRO / 2013)

O autor refere- se no texto a três línguas, cuja variação se deve, sobretudo,


a) à classe social do falante, já que esta é marcada pela maior ou menor
facilidade de acesso do indivíduo aos bens culturais.
b) à disposição de espírito e ao humor de cada um de nós, que variam de
modo aleatório ao longo das diferentes etapas de nossa vida.
c) aos mecanismos linguísticos próprios da linguagem verbal, que nada têm
a ver com as intenções ou necessidades circunstanciais do usuário.
d) à diversidade das situações de linguagem, que o autor vê marcadas na
sucessão dos diferentes períodos do dia.
e) ao maior ou menor índice de formalidade com que as pessoas as
empregam, cumprindo ou descumprindo as normas gramaticais.
23. ( Cesgranrio / CEFET RJ / Assistente de Alunos / 2014)
Escrever é fácil?

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 60 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Para estimular crianças e jovens a escrever, há quem diga que escrever é


fácil: basta pôr no papel o que está na cabeça. Na maioria das vezes,
porém,este estímulo é deveras desestimulante.
Há boas explicações para o desestímulo: se apessoa não consegue escrever,
convencê-la de que escrever é fácil na verdade a convence apenas dasua
própria incompetência, a convence apenas de que ela nunca vai conseguir
escrever direito; não se escreve pondo no papel o que está na cabeça, sob
pena de ninguém entender nada; quem escreveprofissionalmente nunca
acha que escrever é fácil, nem mesmo quando escreve há muito tempo ² a
não ser que já escreva mecanicamente, apenas repetindo frases e fórmulas.
Via de regra, nosso pensamento é caótico: funciona para alimentar nossas
decisões cotidianas, mas não funciona se for expresso, em voz alta ou por
escrito, tal qual se encontra na cabeça. Para entender o nosso próprio
pensamento, precisamos expressá-lo para outra pessoa. Ao fazê-lo,
organizamos o pensamentosegundo um código comum e então, finalmente,
o entendemos, isto é, nos entendemos. Não à toa ojagunço Riobaldo,
personagem do escritor GuimarãesRosa, dizia: professor é aquele que de
repente aprende.
Todo professor conhece este segredo: você entende melhor o seu assunto
depois de dar sua aula sobre ele, e não antes. Ao falar sobre o meu tema,
tentando explicá-lo a quem o conhece pouco, aumento exponencialmente a
minha compreensão a respeito. Motivado pelas expressões de dúvida eaté
de estupor dos alunos, refino minhas explicações e, ao fazê-lo, entendo bem
melhor o que queria dizer. Costumo dizer que, passados tantos anos
deprofissão, gosto muito de dar aula, principalmente porque ensinar ainda é
o melhor método de estudar e compreender.
Ora, do mesmo jeito que ensino me dirigindo a um grupo de alunos que não
conheço, pelo menos no começo dos meus cursos, quem escreve o faz para
ser lido por leitores que ele potencialmente não conhece e que também não
o conhecem. Mesmo ao escrever um diário secreto, faço-o imaginando um
leitor futuro: ou eu mesmo daqui a alguns anos, ou quem sabe a
posteridade. Logo, preciso do outro e do leitor para entender a mim mesmo
e, em última análise, para ser e saber quem sou.
Exatamente porque esta relação com o outro, aluno ou leitor, é tão
fundamental, todo professor sente um frio na espinha quando encontra uma
nova turma, não importa há quantos anos exerça o magistério. Pela mesma
UD]mRWRGRHVFULWRUILFD³HQURODQGR´DWpFomeçar um texto novo, arrumando
a escrivaninha ou vagando pela internet, não importa quantos livros já tenha
publicado. Pela mesmíssima razão, todo aluno não quer que ninguém leia
sua redação enquanto a escreve ou faz questão de colocá-la debaixo da pilha
de redações na mesa do professor, não importa se suas notas são boas ou
não na matéria.
Escrever definitivamente não é fácil, porque nos expõe no momento mesmo
de fazê-lo. [...] Quem escreve sente de repente todas as suas hesitações,
lacunas e omissões, percebendo como o seu próprio pensamento é
incompleto e o quanto ainda precisapensar. Quem escreve de repente
entende o quanto a sua própria pessoa é incompleta e fraturada, o quanto
ainda precisa se refazer, se inventar, enfim: se reescrever.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 61 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Ao longo do texto, há marcas de linguagem que indicam uma aproximação,


uma espécie de diálogo, que o autor estabelece com aqueles que estão lendo
seu texto.
Um trecho que contém uma dessas marcas de linguagem é:
D ³1DPDLRULDGDVYH]HVSRUpPHVWHHVWtPXORpGHYHUDVGHVHVWLPXODQWH´
(L. 2-3)
E ³$RID]r-ORRUJDQL]DPRVRSHQVDPHQWRVHJXQGRXPFyGLJRFRPXP´ /
14-15)
F ³7RGRSURIHVVRUFRQKHFHHVWHVHJUHGR´ /19)
G ³$RIDODUVREUHRPHXWHPDWHQWDQGRH[SOLFi-OR´ /0-21)
H ³GRPHVPRMHLWRTXHHQVLQRPHGLULJLQGRDXPJUXSRGHDOXQRV´ /27)
24. (CESPE / Analista da Câmara dos Deputados / 2012)

No último período do excerto apresentado, ao referir-se à influência dos


escritores na manutenção da denominada norma padrão, Machado de Assis
revela-se preconceituoso, dado que postula que os textos literários sejam
modelos de correção linguística e que aprimorem não só a linguagem, mas
também a razão do povo.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 62 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

25. (CESPE / Analista da Câmara dos Deputados / 2012)

Julgue os itens subsequentes, relativos ao texto acima.


De acordo com o texto, em uma análise científica de construções linguísticas,
deve ser considerada a adequação à situação em que tais construções foram
empregadas.
26. (CESPE / Analista da Câmara dos Deputados / 2012)
Utilizar texto da questão acima.
Infere-se do texto que seu autor é linguista e, como tal, defende que os
gramáticos, em vez de formularem regras, assumam atitude científica, ou
seja, descrevam e expliquem todas as construções linguísticas, visto que,
segundo o autor, todas são legítimas, como sintetiza no último período do
texto.
27. (FGV / Analista de Gestão / Compesa / 2016)
$VVLQDOHDIUDVHHPTXHDH[SUHVVmR³a gente´ não exemplifica a variante
coloquial de linguagem.
D ³Hipótese é uma coisa que não é, mas a gente faz de conta que é, para
ver como seria se ela fosse´
b) ³e XPD JUDQGH REUD DUTXLWHW{QLFD H a gente que passa por lá fica
LPSUHVVLRQDGDFRPDJUDQGH]DGDREUD´
c) ³8PFDGiYHUpRSURGXWRILQDO A gente é apenas a matéria-prLPD´
d) ³$PRUWHLPSHGH a gente GHYLYHUQmRGHPRUUHU´
e) ³1mR Ki QDGD QRYR VRE R VRO PDV Ki PXLWDV FRLVDV YHOKDV TXH a
gente QmRFRQKHFH´
28. (IDECAN / Agente Legislativo / Câm. de Aracruz / 2016)
Amor de passarinho
Desde que mandei colocar na minha janela uns vasos de gerânio, eles
começaram a aparecer. Dependurei ali um bebedouro, desses para beija-
flor, mas são de outra espécie os que aparecem todas as manhãs e se fartam
de água açucarada, na maior algazarra. Pude observar então que um deles

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 63 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

só vem quando os demais já se foram.


Vem todas as manhãs. Sei que é ele e não outro por um pormenor que o
distingue dos demais: só tem uma perna. Não é todo dia que costuma
aparecer mais de um passarinho com uma perna só.
[...]
Ao pousar, equilibra-se sem dificuldade na única perna, batendo as asas e
deixando à mostra, em lugar da outra, apenas um cotozinho. É de se ver as
suas passarinhices no peitoril da janela, ou a saltitar de galho em galho,
entre os gerânios, como se estivesse fazendo bonito para mim. Às vezes se
atreve a passar voando pelo meu nariz e vai-se embora pela outra janela.
³e GH VH YHU DV VXDV passarinhices QR SHLWRULO GD MDQHOD´ ž†  A palavra
³SDVVDULQKLFHV´GHYHVHUGHVLJQDGDFRPR
a) dialeto. b) idiotismo. c) neologismo. d) regionalismo.

29. (IDECAN / UFPB / Administrador / 2016)


³Vivemos num mundo com acesso a todo tipo de informação de
diversas maneiras."
Acerca das estruturas linguísticas do trecho destacado, analise e assinale
a afirmativa correta.
Sabendo-VHTXHRWHUPR³QXPVHWUDWDGHXPDFRQWUDomRVXDVXEVWLWXLomR
SRU³DXPHVWDULDFRUUHWDHDGHTXDGDGHDFRUGRFRPDQRUPDSDGUmRGD
língua, possuindo um aspecto erudito da linguagem.
30. (IDECAN / UFPB / Administrador / 2016)
³4XHPQmRVHFRPXQLFDVHWUXPELFD
Esta frase é do Chacrinha, um dos mais famosos apresentadores da
televisão brasileira, falecido em 1988. Só que não! A frase, na verdade, é de
3pULFOHV GR $PDUDO TXH D ³GHX SDUD TXH &KDFULQKD D XVDVVH HP VHXV
programas na TV. Mas hoje, enquanto Chacrinha se eternizou como
personagem integrante da história da TV brasileira, Péricles ± uma das
maiores referências do rádio carioca e autor de novelas radiofônicas, além
de forte atuação como redator de TV em diversos canais ± que faleceu em
1975, é pouco conhecido do grande público.
Essa confusão exemplifica a relação que temos hoje com a informação
e a comunicação. Vivemos uma era de alta tecnologia da informação. Mas
informação e comunicação não significam necessariamente a mesma coisa.
Vivemos num mundo com acesso a todo tipo de informação de diversas
maneiras. Só que excesso de informação também pode gerar ruído ± em
FRPXQLFDomR ³UXtGR p TXDOTXHU HOHPHQWR TXH LQWHUIHUH QR SURFHVVR GH
transmissão de uma mensagem de um emissor para um receptor.
Não basta haver a capacidade de informar se não houver o desejo de se
comunicar. Ou o desejo de compreender e ser compreendido pelo
interlocutor. Para esse processo de troca de ideias funcionar, saber escrever
corretamente é condição necessária, mas não suficiente. O que vemos hoje
com alguma frequência (especialmente em redes sociais) são pessoas
querendo impor suas ideias, mas sem querer compreender ideias diferentes.
Ou mesmo modos diferentes de se expressar. [...]

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 64 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

O emprego da expressão de carátHU FRORTXLDO ³6y TXH QmR


representa
a) a expressão da identidade de um grupo específico, público-alvo do texto
em análise.
b) a ocorrência de um grau de formalismo característico de uma linguagem
não fragmentária.
c) uma exemplificação de parte da argumentação expressa no último
parágrafo do texto transcrito.
d) uma inadequação linguística proposital do autor do texto cujo objetivo é
despertar o interesse do leitor pelo assunto discutido.
31. (IDECAN / Detran-RO / Agente / 2014)
Quanto ao nível de formalismo da linguagem, assinale o trecho do
texto que apresenta características de uma linguagem coloquial.
D ³'H]HQDVGHDSOLFDWLYRVGHFHOXODU>@´
E ³>@DQRYDRQGDGHVROXo}HVPyYHLV>@´
F ³>...] solicitam e oferecem FDURQDVDGHVFRQKHFLGRV´
G ³>@FRQYHUVDPSRUWHOHIRQHSDUDFRPELQDURSRQWRGHHQFRQWUR´
H ³$VXJHVWmRGHSUHoRHTXLYDOHDGRSUHoRTXHVHULDFREUDGR>@´
32. (IDECAN / Contador / Coren-MA / 2013)
³«HVWDYDPGH olho em todas as nossas ações, prontos para criticar nossas
DWLWXGHVHIHUUDUFRPQRVVDIHOLFLGDGH´
O excerto anterior contém um exemplo de linguagem :
a) regional. b) denotativa c) pejorativa. d) coloquial. e) padrão.
33. (IDECAN / Banestes / Técnico / 2012)
Diploma garantido
Muitos pais têm contratado planos de previdência para os filhos menores de
idade. A diferença é que, ao fazer isso, não estão pensando em investir na
aposentadoria dos rebentos, mas sim em oferecer condições para que, ao
atingir a maioridade, eles tenham dinheiro para arcar com despesas
relacionadas à educação, como uma boa faculdade, um curso de
especialização ou um intercâmbio no exterior.
Segundo dados da Federação Nacional de Previdência Privada Vida
(FenaPrevi), entidade que reúne empresas do setor, os planos de previdência
para menores arrecadaram só no ano passado, 1,7 bilhão de reais ± 24% a
mais do que em 2010.
Falta de disciplina para fazer os depósitos e saques não programados
SUHMXGLFDP TXHP TXHU SRXSDU SDUD R IXWXUR ³$ FRQWULEXLomR GHYH VHU
encarada como uma despesa da casa, assim como as contas de água e luz",
diz Carolina Wanderley, consultora sênior de previdência privada da empresa
GH LQYHVWLPHQWRV 0HUFHU 2X VHMD QmR VH GHYH ³SXODU R LQYHVWLPHQWR QD
previdência em meses de dinheiro curto, muito menos usar o montante
reservado nela para cobrir despesas acima do normal.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 65 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

Para contornar imprevistos desse gênero, os especialistas recomendam pedir


ao banco que as mensalidades sejam postas em débito automático ou
cobradas via boleto e manter um segundo investimento ± como uma
poupança ± GHVWLQDGRD³DSDJDULQFrQGLRV

Apesar de possuir uma linguagem predominantemente formal, o texto


apresenta o registro de variante linguística coloquial em
D  ³0XLWRV SDLV WrP FRQWUDWDGR SODQRV GH SUHYLGrQFLD para os filhos
PHQRUHVGHLGDGH´
E  ³ FRPR XPD ERD IDFXOGDGH XP FXUVR GH HVSHFLDOL]DomR RX XP
LQWHUFkPELRQRH[WHULRU´
F  ³ VDTXHV QmR SURJUDPDGRV SUHMXGLFDP TXHP TXHU SRXSDU SDUD R
IXWXUR´
G  ³ QmR VH GHYH µSXODU¶ R LQYHVWLPHQWR QD Srevidência em meses de
GLQKHLURFXUWR´
H  ³ SHGLU DR EDQFR TXH DV PHQVDOLGDGHV VHMDP SRVWDV HP GpELWR
DXWRPiWLFR´
34. (IDECAN / Administrador / Funtelpa / 2010)
³5HODFLRQDPHQWRHPUHGHVVRFLDLVQmRpFRPRFDPSDQKDTXHWHPFRPHoR
e fim. É um trabalho que não possui prazo para terminar, o que é muito
positivo ± assim espera-se, visto que ainda não sabemos como será o
comportamento dos hoje candidatos, amanhã eleitoV´
No parágrafo anterior verifica-se o emprego de:
a) Linguagem padrão.
b) Linguagem conotativa.
c) Linguagem técnico-científica.
d) Linguagem conotativa em um texto com características jornalísticas.
e) Linguagem denotativa em um texto didático científico..
35. (CS / UFG / Técnico / 2017)
1R HQXQFLDGR ³2QGH HVWi YRFr 0HODQLH" 6HP WL HQVDQGHoR´ UHJLVWUD-se
variação linguística na
a) expressão pronominal da segunda pessoa.
b) forma do verbo estar no presente do indicativo.
c) prosódia e na entonação das frases utilizadas.
d) construção sintática das orações empregadas..
36. (Prefeitura de Cruzeiro / Professor / 2017)
As variações linguísticas ocorrem principalmente nos âmbitos geográficos,
temporais e sociais.
Defina variações históricas:
a) São variações que ocorrem de acordo com o local onde vivem os

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 66 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

falantes, sofrendo sua influência. Este tipo de variação ocorre porque


diferentes regiões têm diferentes culturas, com diferentes hábitos, modos e
tradições, estabelecendo assim diferentes estruturas linguísticas.
b) São variações que ocorrem de acordo com os hábitos e cultura de
diferentes grupos sociais. Este tipo de variação ocorre porque diferentes
grupos sociais possuem diferentes conhecimentos, modos de atuação e
sistemas de comunicação.
c) São variações que ocorrem de acordo com o contexto ou situação em
que decorre o processo comunicativo. Há momentos em que é utilizado um
registro formal e outros em que é utilizado um registro informal.
d) São variações que ocorrem de acordo com as diferentes épocas vividas
pelos falantes, sendo possível distinguir o português arcaico do português
moderno, bem como diversas palavras que ficam em desuso..
37. (IPREV / CONTADOR / 2017)

O cômico presente no texto é causado pelo uso da linguagem:


a) culta.
b) formal.
c) regional.
d) expressiva.
e) denotativa.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 67 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

38. (IPREV / CONTADOR / 2017)

A linguagem do Texto 2 tipifica a variação


a) diacrônica.
b) diastrática
c) diafásica.
d) diatópica.
39. (IPREV / CONTADOR / 2017)
Em ³p SRVVtYHO ID]HU XVR GDV PHGLFDo}HV numa forma de evitar
FRPSOLFDo}HV´ o termo grifado apresenta a linguagem _______ que pode
ser substituída por _______ sem prejuízo do sentido. As lacunas podem ser
preenchidas por:
D IRUPDOH³QXPDIRUPDDHYLWDU´
E FRORTXLDOH³GHIRUPDDHYLWDU´
F UHJLRQDOH³HPIRUPDGHHYLWDU´
G FXOWDH³XPDIRUPDDHYLWDU´
H FKXODH³HPIRUPDDHYLWDU´
40. (FGV / Alerj / Procurador / 2017)
Entre as frases abaixo ± todas de Luis Fernando Verissimo -, aquela em que
há exemplo da variante coloquial da linguagem é:
D ³7HPRVTXHFRQILDUQRDPDQKm$QmRVHUTXHGHVFXEUDPDOJXPDFRLVD
FRQWUDHOHGXUDQWHDQRLWH´
E ³6HPSUH TXHRXoRIDODUHP µLQFRQVFLHQWHFROHWLYR¶ SHQVRQXP{Qibus

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 68 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 09 ± Felipe Luccas Rosas

GHVJRYHUQDGR´
F  ³1RYH HQWUH GH] FDULRFDV QD SUDLD HP KRUD GH H[SHGLHQWH VmR
SDXOLVWDV´
G ³6HHXSXGHVVHHVFROKHUXPRXWURFDUURSDUDFRPSUDUHPSUHJDYDPHX
GLQKHLURQXPYHtFXORDOHPmR´
H  ³$ VRYLQLFH GHOH p OHQGiULD /HYRX QDGDGHLUDV TXDndo visitou Veneza,
SDUDQmRJDVWDUFRPWi[L´

Gabaritos

1. LETRA A
2. LETRA C
3. LETRA A
4. CORRETA
5. LETRA D
6. LETRA C
7. LETRA B
8. LETRA D
9. LETRA C
10. LETRA A
11. LETRA E
12. LETRA D
13. LETRA C
14. LETRA B
15. LETRA E
16. LETRA E
17. LETRA A
18. LETRA E
19. LETRA C
20. INCORRETA
21. LETRA B
22. LETRA D
23. LETRA B
24. INCORRETA
25. CORRETA
26. INCORRETA
27. LETRA B
28. LETRA C
29. INCORRETA
30. LETRA A
31. LETRA B
32. LETRA D
33. LETRA D
34. LETRA A
35. LETRA A
36. LETRA D
37. LETRA C
38. LETRA D
39. LETRA B
40. LETRA D

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br 69 de 69


08242255628 - LIVIA GOMES DE MORAIS
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

Lista das questões comentadas

1. (CONSULPLAN / CEFSS / ASSISTENTE TÉC. / 2017)


A alternativa cujas palavras, retiradas do texto, mostram o mesmo tipo de
processo de formação é:
a) folhagem ± elegante
b) passarinho ± invisível
c) gagueira ± mangueira
d) irreverência ± caprichoso.
2. (FUNECE-UECE / METROFOR-CE / 2017)
$SUHVHQWDP R PHVPR SURFHVVR GH IRUPDomR GH ³LPSRWHQWH´ DV VHJXLQWHV
palavras:
a) desgraças, incapaz , inquieto.
b) insolente, descobrir, destacar.
c) indiferente, desamar, importar.
d) debater, desabafo, insolente.
3. (FUNECE-UECE / PREF. AMONTADA-CE / TÉCNICO / 2016)
Assinale a opção em que as duas palavras foram formadas pelo mesmo
processo de derivação.
a) brasileiro, razoavelmente
b) desconhecimento, amorosos
c) incrédulo, alvíssimo
d) desaproveitada, essencialmente
4. (SUSEPE-RS / AGENTE PENINTENCIÁRIO / 2017)
Assinale a alternativa que apresenta um vocábulo rizotônico.
a) Permites.
b) Escreverá.
c) Fingimento.
d) Correria.
e) Partirá.
5. (COSEAC / UFF / 2017)
$SDODYUD³DUFR-tULV´pIRUPDGDSHORSURFHVVRGHFRPSRVLomRSRUMXVWDSRVLomR
assim como:
a) sapateiro.
b) minúscula.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 60 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

c) simplicidade.
d) girassol.
e) superfaturar.
6. (COSEAC / UFF / 2017)
³,VVRSRUTXHRVGRLVHYROXtUDPFDoDQGRURHGRUHVHQWmRFRQVHJXHPFDSWDURV
sinais hiperagudos TXHRVUDWLQKRVHPLWHPSDUDVHFRPXQLFDU´
Sobre a palavra destacada, analise a afirmativa a seguir: É formada por um
prefixo.
7. (FGV / Alerj / Especialista Legislativo / 2017)
O vocábulo abaixo que é formado pelo processo de parassíntese é:
a) pré-história;
b) inconstitucional;
c) perigosíssimo;
d) embarque;
e) desalmado.
8. (FGV / Alerj / Especialista Legislativo / 2017)
Em todas as frases abaixo há estrangeirismos; indique o item em que se afirma
corretamente algo sobre o estrangeirismo sublinhado:
D  ³2 currículo IRL HQWUHJXH j VHFUHWiULD GR FROpJLR´  DGDSWDomR JUiILFD GD
forma latina curriculum;
E  ³2 álibi apreseQWDGR DR MXL] IRL R VXILFLHQWH SDUD LQRFHQWDU R DFXVDGR´ 
utilização da forma latina original;
F ³2xampu HUDYHQGLGRSHODPHWDGHGRSUHoR´WUDGXomRGDIRUPDLQJOHVD
shampoo;
G ³$VDXODVGHmarketing HUDPDVPDLVLQWHUHVVDQWHV´DGHTXDomRJUiILFD de
palavra inglesa;
H ³2VHQFRQWURVGRVDGROHVFHQWHVHUDPVHPSUHQRPHVPRpoint GDSUDLD´
tradução de palavra portuguesa..
9. (COSEAC / UFF / 2017)
A palavra ³UHSLQWDQGR´traz em seu início o prefixo ³UH-´que nos dá a noção de
algo que se repete. Então, ³UHSLQWDQGR´significa ³SLQWDURXWUDYH]´A palavra
abaixo formada com esse mesmo prefixo, com ideia de repetição, é:
a) retrato.
b) reabro.
c) respirar.
d) remotos.
e) recendentes.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 61 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

10. (FGV / Oficial de Chancelaria / MRE / 2016)


Um dos processos conhecidos de formação de palavras em Português é a
chamada ³GHULYDomR LPSUySULD´ marcada pela criação de uma nova palavra
pela modificação de sua classe original. Tal processo aparece em:
D ³6LPQRFRPHoRHUDRSp´
E ³6HHVWiSURYDGRSRUdescobertas arqueológicas, que há sete mil anos estes
EUDVLVMiHUDPKDELWDGRV´
F ³SHQVDLQHVWDVOHJL}HVHOHJL}HVGHSpVTXHSDOPLOKDUDPQRVVRWHUULWyULR´
G ³(SHQVDLQHVWHVSDVVRVSULPHLURVHPGHVWLQRVPDFKDGRVGHSHGUDDEULQGR
as iniciais pLFDGDVQDIORUHVWD´
H ³(QRVSpVGRVTXHVXELDPjVURFKDVGLVWDQWHV´
11. (IDECAN / Prof. Língua Portuguesa / SEARH-RN / 2016)
Quanto à formação de palavras, em português há cinco processos principais,
dentre eles a derivação e composição. Em ³3HTXHQR UHEXOiço: mas era
indubitável Oi HVWDYD HOD H PDLV PDJUD H YHUGH QmR SRGHULD VHU´ o termo
destacado é formado por meio de acréscimo de afixo cujo sentido equivale ao
visto em todos os vocábulos da alternativa:
a) insolar, inscrever, inativo.
b) indelicado, inserir e infixo.
c) influir, incrustar e incriminar.
d) imprestável, imberbe e indispensável
12. (FGV / Ag. Fazendário / Prefeitura de Niterói-RJ / 2015)
Entre os substantivos abaixo, aquele que NÃO é formado a partir de verbo é:
a) Constituição;
b) pressão;
c)inclusão;
d)redução;
e)população.
13. (FGV / NUCEPE / AGENTE PENITENCIÁRIO / 2017)
Assinale a opção na qual os segmentos que estão destacados nas palavras dos
dois trechos equivalem, quanto ao significado, àquele em destaque em: A
violência é, de fato, algo indelével da experiência humana...
a) ... eles são intrínsecos ao homem...; ... as de criação de indivíduos
VRFLDOPHQWH³DGHVWUDGRV´
b) ... uma impossibilidade de normatização ...; ... mas sim questionar todo
exagero e intolerância destinados a ela, ...
c) ... mas sim questionar todo exagero e intolerância destinados a ela, ...;
...eles são intrínsecos ao homem ...
d) ... a partir do controle e da repressão dos impulsos internos...; ...

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 62 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

uma impossibilidade de normatização ...


e) ... mas sim questionar todo exagero e intolerância destinados a ela, ...; ...
a partir do controle e da repressão dos impulsos internos ...
14. (FGV / Fiscal de Posturas / Prefeitura de Niterói-RJ / 2015)
Entre os pares de palavras abaixo, aquelas que são formadas por processos de
formação diferentes são:
a) publicidade / consumidores;
b) desejo / inveja;
c) avareza / poupança;
d) descalcificar / inúmeros;
e) preguiça / passeio.
15. (IBFC / MGS / 2017)
Considere o fragmento transcrito abaixo para responder a questão seguinte.
³2MRUQDOHLURODUJDVXDEDQFDQDDYHQLGD6XPDUpHYHPDRSUpGLRDYLVDU-me
que o jornal chegou. Os vizinhos de cima silenciam GHSRLVGDVGH]GDQRLWH³
2 VXIL[R ³-HLUR´ SUHVHQWH HP ³MRUQDOHLUR´ WHP um significado. Assinale a
alternativa em que esse sufixo tenha um valor DIFERENTE do que se observa
HP³MRUQDOHLUR´
a) pedreiro.
b) açougueiro.
c) engenheiro.
d) formigueiro.
16. (MPE-RS / SECRETÁRIO DE DILIGÊNCIAS / 2017)
Assinale a alternativa que preenche corretamente as lacunas dos enunciados
abaixo, na ordem em que aparecem.
1. As palavras polidez e delicadeza contêm sufixos que formam substantivos
a partir de ........ .
2. As palavras comportamento e civilização contêm sufixos que formam
substantivos a partir de ........ .
3. As palavras sentimentalidade e racionalismo contêm sufixos que
formam substantivos a partir de ........ .
a) adjetivos ± substantivos ± adjetivos
b) substantivos ± verbos ± substantivos
c) adjetivos ± verbos ± adjetivos
d) substantivos ± adjetivos ± verbos
e) verbos ± adjetivos ± verbos
17. (FGV / Contador / Prefeitura de Niterói-RJ / 2015)
São vocábulos que exemplificam o processo de formação de palavras

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 63 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

denominado derivação sufixal:


a) desacelerar / economia;
b) mundial / emergente;
c) investimento / ilustre;
d) vítima / transição;
e) paisagem / econômica.
18. (IDECAN / Assistente Operação / PRODEB / 2015)
³HVVDpXPDUHDOLGDGHEXUUDHPpreconceito LGLRWDPDVQmRIDOHFLGR´O
vocábulo sublinhado tem como processo de formação de palavras denominado:
a) Derivação sufixal.
b) Derivação prefixal.
c) Derivação regressiva.
d) Derivação parassintética.
19. (IBFC / MGS / 2017)
Em relação à formação lexical da palavra ensolarado é correto dizer:
a) é um caso de parassintetismo;
b) é uma derivada prefixal e sufixal;
c) é uma derivada regressiva;
d) é um caso de derivação imprópria;
e) é uma onomatopeia.
20. (UFRPE / ADMINISTRADOR / 2016)
No fragmento ³GHPDQHLUDLUUHPHGLiYHO´RSUHIL[RTXHFRQVWDHPµLUUHPHGLiYHO¶
tem o mesmo sentido dos prefixos que aparecem na série:
a) irromper; irrupção.
b) irrecuperável; irrevogável.
c) inflamável; invalidez.
d) ingestão; imersão.
e) injeção; inundação.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 64 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

21. (CESPE / Diplomata / Instituto Rio Branco / 2015)

Julgue (C ou E) o item seguinte, relativos ao poema de Manoel de Barros.


As palavras ³LQFRQH[R´ Y  e ³DEVXUGD´ Y  foram formadas pelo mesmo
processo de derivação, que resulta em mudança de categoria gramatical de um
vocábulo, sem que haja alteração morfológica.
22. (UNITINS / ASSISTENTE ADMINISTRATIVO / 2016)
Isolada de um contexto, a palavra movimento é um substantivo. Quando
ocorre em uma frase, pode ter significados, logo, classificações gramaticais
diferentes. Derivadas da palavra movimento, temos:
³movimentação, movimentado, movimentar´4XDQWRDRSURFHVVRPyUILFR
para a formação das palavras destacadas, podemos dizer que:
a) o sufixo ±ção forma um adjetivo, o sufixo ±ado forma um advérbio, o sufixo
±ar forma um adjetivo.
b) o sufixo ±ção forma um advérbio, o sufixo ±ado forma um substantivo, o
sufixo ±ar forma um verbo.
c) o sufixo ±ção forma outro substantivo, o sufixo ±ado forma um adjetivo, o
sufixo ±ar forma um verbo.
d) o sufixo ±ção forma um substantivo, o sufixo ±ado forma um verbo, o sufixo
± ar forma um advérbio.
e) o sufixo ±ção forma um substantivo, o sufixo ±ado forma um verbo, o sufixo
±ar forma um adjetivo.
23. (IF-TO / ASSISTENTE LABORATÓRIO / 2016)
Analise o prefixo IN da palavra intolerante e assinale a alternativa correta
quanto ao seu significado.
a) Movimento para fora.
b) Sentido de mudança.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 65 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

c) Movimento para trás.


d) Ideia de separação.
e) Negação.
24. (FGV / Analista de Defensoria Pública / DPE-RO / 2015)
Entre as palavras abaixo, aquela que mostra uma formação distinta das demais
é:
a) promoção;
b) proteção;
c) internação;
d) população;
e) prevenção.
25. (CONSULPLAN ± Agente de Administração HOB/2015)
³(VHIRUPRVGLIHUHQWHVTXHPVDEHDTXLHDOLXPDmedicaçãozinha DMXGD´O
vocábulo sublinhado tem como processo de formação de palavras denominado
a) derivação sufixal.
b) derivação regressiva.
c) derivação parassintética.
d) composição por justaposição.
26. (FGV / Analista Judiciário / TJ-RJ / 2014)
³$863DFDEDGHGLYXOJDUHVWXGRDGYHUWLQGRTXHDSROXLomRHP6mR3DXORPDWD
R GREUR GR TXH R WUkQVLWR´ QHVVH WUHFKR GR WH[WR  R VHJPHQWR ³DFDED GH
GLYXOJDUHVWXGR´SRGHULDVHUVXEVWLWXtGRSRUXPWHUPR menos extenso, com a
DMXGDGHXPSUHIL[RRXVXIL[R³HVWXGRUHFpP-GLYXOJDGR´ $IUDVHDEDL[RHP
que esse mesmo processo foi feito de forma INADEQUADA é:
a) Os estudos estão sendo lidos de novo / relidos;
b) A passeata carregava uma faixa contrária ao transporte público /
antitransporte público;
c) Os automóveis foram valorizados acima do normal / hipervalorizados;
d) As autoridades precisam fazer análises de si mesmas / retroanálises;
e) O Congresso votou um projeto a favor de carros elétricos / pró-carros
elétricos.
27. (FGV / Fiscal de Serv. Públicos / 2014)
A palavra que apresenta um processo de formação diferente dos demais é:
a) cachorrinho;
b) descarga;
c) bombeiro;
d) sofrimento;

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 66 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

e) sanitário.
28. (FGV / Inspetor de Alunos / Pref. Osasco-SP / 2014)
Assinale a opção que indica as etapas pelas quais passou o vocábulo
³JOREDOL]DomR´QDVXDIRUPDomR
a) globo / global / globalizar / globalização.
b) globo / global / globaliza / globalizar / globalização.
c) globo / globalizar / globalização.
d) globo / glóbulo / globalizar / globalização.
e) globo / global / glóbulo / globalizar / globalização.
29. (FGV / Atendente / Pref. Osasco-SP / 2014)
³2 IHQ{PHQR GD YLROrQFLD H GD FULPLQDOLGDGH p H[WUHPDPHQWH FRPSOH[R
multifacetado e dinâmico, exigindo uma abordagem integrada, PXOWLVVHWRULDO´
RHOHPHQWR³PXOWL´HP³PXOWLIDFHWDGR´H³PXOWLVVHWRULDO´WHPYDORUGH
a) qualidade e quantidade;
b) quantidade e variedade;
c) variedade e desproporcionalidade;
d) desproporcionalidade e tempo;
e) tempo e qualidade.
30. (IDECAN / Agente de Trãnsito / DETRAN-RO / 2014)
Analise a palavra destacada em "A testa escondida pelos cabelos em
desalinho.", e assinale a afirmativa INCORRETA.
a) Eliminando o prefixo dessa palavra, chega-se à palavra que lhe deu origem.
b) Os prefixos das palavras "desalinho" e "descrever" têm o mesmo valor
semântico.
c) As palavras "desalinho" e "descrever" são formadas pelo processo de
derivação prefixal
d) Nessa palavra ocorre o mesmo processo de formação que em "descrever" -
"[...] não sabem descrever o que viram."
e) As palavras "desalinho" e "descrever" formam-se pelo mesmo processo, mas
seus prefixos agregam a elas diferentes valores semânticos.
31. (CONSULPLAN / Ass. Manutenção Elétrica / CBTU / 2014)
Do ponto de vista morfológico, a palavra ³OLEHUWiULD´é formada por
a) composição, visto que apresenta dois radicais seguidos de um sufixo.
b) justaposição, porque a palavra não perde som no processo de formação.
c) aglutinação, visto que, se juntar dois radicais diferentes, a palavra perde
alguns sons
d) derivação, porque forma-se com o acréscimo de um sufixo, que altera
parcialmente o significado do radical.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 67 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

32. (CONSULPLAN / Téc. Segurança do Trabalho / CBTU / 2014)


A palavra ³LQYHQFLGRV´foi formada pelo processo de
a) derivação prefixal.
b) composição prefixal.
c) derivação prefixal e sufixal.
d) composição sufixal e prefixal.
33. (UFRPE-ADMINISTRADOR/2016)
³3RLVFDGDOHPEUD1d$EUDVLOHLUDFRUUHVSRQGHjPHPyULDGRPXQGR´
³&ULDWXUDVTXHDILQDGDVFRPDWRUS(=$HDVLQTXLHWXGHVGRVHXWHPSR´
São sinônimos, respectivamente, dos sufixos em destaque nos vocábulos acima
os sufixos empregados na formação das palavras:
a) traição e banalidade.
b) advertência e mortuárias.
c) fumegante e alojamento.
d) sordidez e inquietudes.
e) alegria e brasileira.
34. (CESGRANRIO / Petrobras / 2014)
A palavra ³SLFDUHWDoR´é formada por:
a) aglutinação
b) justaposição
c) parassíntese
d) derivação sufixal
e) derivação prefixal
35. (CONSULPLAN / Téc. Contabilidade / MAPA / 2014)
Assinale a alternativa em que todas as palavras foram formadas por derivação
sufixal.
a) Constituição ± região ± mineração.
b) Manifestações ± oposição ± produtores.
c) Reservatório ± relações ± descendentes.
d) Anarquismo ± parlamentaristas ± poderes.
36. (FGV / Contador / FUNARTE / 2014)
No título dado à crônica ± Brasileiro, homem do amanhã ± a palavra sublinhada
está empregada fora de sua classe gramatical (derivação imprópria). A frase
em que ocorre o mesmo tipo de derivação é:
D ³$GLDPRVWXGRREHPHRPDORERPHRPDXTXHQmRse confundem, mas
WDQWDVYH]HVVHGHVHPSDUHOKDP´

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 68 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

E  ³$GLDPRV R WUDEDOKR R HQFRQWUR R DOPRoR R WHOHIRQHPD R GHQWLVWD R


dentista nos adia, a conversa séria, o pagamento do imposto de renda, as férias,
a reforma agrária, o seguro de vida, o exame médico, a visita de pêsames, o
conserto do automóvel, o concerto de Beethoven, o túnel para Niterói, a festa
GHDQLYHUViULRGDFULDQoDDVUHODo}HVFRPD&KLQDWXGR´
F ³$WpRDPRU6yDPRUWHHDSURPLVVyULDVmRPDLVRXPHQRVSRQWXDLVHQWUH
QyV´
G ³0HVPRDVVLPKiUHPpGLRSDUDDSURPLVVyULDRDGLDPHQWRELRXWULPHVWUDO
GDUHIRUPDXPDLQVWLWXLomRVDFURVVDQWDQR%UDVLO´
H  ³(QWUH HQGHUHoRV GH HPEDL[DGDV H FRQVXODGRV HVWDWtVWLFDV LQGLFDo}HV
FXOLQiULDVRDXWRULQWHUFDORXRVHJXLQWHWySLFR´
37. (IBFC / MGS / 2016)
Considerado a estrutura das palavras abaixo, percebe-se que em todas elas os
prefixos aproximam-se quanto ao valor semântico, EXCETO em uma. Assinale-
a.
D ³LPSUySULDV´
E ³GHVQtYHLV´
F ³FRDELWDPRV´
G ³LUUHJXODUHV´
38. (FGV / Editor de Textos / AL-MT / 2013)
Muitas palavras são formadas com a ajuda de sufixos, dando origem a uma
palavra de uma classe diferente da classe da palavra primitiva.
Assinale a alternativa em que as palavras dadas não seguiram a mesma
estratégia de formação.
a) liberação / produção
b) legalização / prescrição
c) aparentemente / teoricamente
d) totalidade / profundidade
e) mágica / médica
39. (FGV / AUX. ADM. / FUNDAÇÂO PRÓ-SANGUE / 2013)
O vocábulo ³4XDOL+RVS´foi formado por:
D GHULYDomRVXIL[DOFRPR³KRVSLWDODU´
E SDUDVVtQWHVHFRPR³DQRLWHFHU´
F MXVWDSRVLomRFRPR³SDVVDWHPSR´
G DJOXWLQDomRFRPR³SODQDOWR´
e) abreviação, como BNDES.
40. (FGV / Assistente de Trânsito / DETRAN-MA / 2013)
As alternativas a seguir apresentam vocábulos que possuem a mesma

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 69 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

formação, à exceção de uma. Assinale-a.


a) comunicação / educação.
b) conscientização / mobilização.
c) utilização / preocupação.
d) reeducação / população.
e) fiscalização / notificação.
41. (FCC / Assistente Adm. Júnior / Metrô-SP / 2014)
Examine o texto abaixo e responda a questão.

A Casa Aymoré, CNPJ no 123.456.789/00001-01, por intermédio de seu


representante legal José da Silva e Souza, portador da carteira de identidade
Qží66363HGR&3)Qž-01, declara, sob as penas da
lei, que possui sistema de gerenciamento de demandas compatível com o que
foi estipulado no anexo 6 do edital em epígrafe.

São Paulo, 23 de janeiro de 2011.

José da Silva e Souza


Procurador da Casa Aymoré

A sigla SSP/SP refere-se a


a) ServLoR6RFLDOGH3RUWDELOLGDGHí6mR3DXOR
E 6HFUHWDULDGD6HJXUDQoD3~EOLFDí6mR3DXOR
F 6HWRUGH6HUYLoRVGD3URFXUDGRULDí6HomR3DXOLVWD
G 6LVWHPDGH6HUYLoRVH3URGXWRVí6HWRU3ULPiULR
H 6HUYLoRGH6LQDOL]DomRH3URWRFRORí6XEGLVWULWR3DWULDUFa.
42. (CESGRANRIO / Ag. Pesquisas por Telefone / IBGE / 2014)
³0DVKiXPDWHQGrQFLDTXHVHFRQWUDS}HDLVVRDGRPLQLPDOLVPR± também
FRQKHFLGRFRPR³FRQVXPRPtQLPR´RX³VLPSOLFLGDGHYROXQWiULD´´

O verbo contrapor, presente no texto na forma verbal contrapõe, dá origem ao


substantivo derivado contraposição, grafado com ç.

Os dois verbos que formam substantivos derivados grafados com ç são:


a) ascender, considerar.
b) confirmar, progredir.
c) conceder, admitir.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 70 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

d) transmitir, polarizar.
e) valorizar, aceitar.
43. (IDECAN / Agente Administrativo / COREN-MA / 2013)
"O gasto com celular já havia aumentado..." Quanto ao processo de formação
de palavras, a palavra à "gasto" à constitui exemplo de derivação
a) sufixal.
b) prefixal.
c) imprópria.
d) regressiva.
e) parassindética.
44. (FGV / Policial legislativo Federal / Senado Federal / 2012)
Assinale a palavra que NÃO tenha sido formada peio mesmo processo que as
demais.
a) formação
b) operárias
c) democracias
d) redondezas
e) inibitórias
45. (FCM / IF SUDESTE-MG / 2016)
No trecho: ³(Dtvamos HQWUDUHPRXWUDiUHDTXHpDOXWDSHORSRGHU´o verbo
em negrito apresenta a seguinte classificação desinencial (número-pessoal e
modo-temporal)
a) 1ª pessoa do plural ± presente do indicativo.
b) 3ª pessoa do plural ± presente do subjuntivo.
c) 1ª pessoa do plural ± pretérito perfeito do indicativo.
d) 3ª pessoa do plural ± pretérito imperfeito do indicativo.
e) 1ª pessoa do plural ± pretérito imperfeito do subjuntivo.
46. (CESPE / Analista de Correios / Letras / 2011)
Julgue os itens seguintes, com relação à estrutura e formação de palavras da
língua portuguesa.
No processo de formação dos vocábulos ³LQWHJUDomR´ ³LPSXOVLRQD´,
³LQGHIHFWLYHOPHQWH´ H ³LPSUXGrQFLDV´, identifica-se o prefixo in-, que neles
expressa a noção de mudança de estado.
47. (NUCEPE / Prefeitura Teresina / 2016)
Na palavra cafezinho temos os seguintes elementos mórficos
a) radical, vogal temática e sufixo.
b) radical, consoante de ligação e sufixo.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 71 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

c) radical e sufixo.
d) radical e vogal temática.
e) radical e consoante de ligação.
48. (FUNRIO / PREF. TRINDADE / AUXILIAR / 2016)
Em pré-disposição, o prefixo pré tem o seguinte significado:
a) negação
b) duplicação
c) proximidade
d) anterioridade
e) inferioridade.
49. (CESPE / Analista de Correios / Letras / 2011)
Julgue os itens seguintes, com relação à estrutura e formação de palavras da
língua portuguesa.

Os vocábulos ³UHVSRQVDELOLGDGH´³DOWHUQkQFLD´³VXFHVVmR´ H³HIHWLYLGDGH´são


exemplos de substantivos derivados de verbos abstratos e indicam resultado de
ação.
50. (FUNRIO / PREF. TANGUÁ / MOTORISTA / 2016)
a cultura da impunidade é perigosa.
2SUHIL[R³LP´SRGHLQGLFDUQHJDomRFRPRQDSDODYUDLPSXQLGDGHTXHVLJQLILFD
ausência de punição. O prefixo da seguinte palavra também indica negação:
a) transformação
b) desrespeito
c) prevenção
d) diálogo.
51. (FAURGS / TJ-RS / MÉDICO / 2016)
Assinale a alternativa em que a palavra extraída do texto NÃO apresenta, em
sua formação, processo de derivação prefixal.
a) reequilíbrio
b) realmente
c) readquiria
d) reavaliado
e) reanimar
52. (CESPE / Agente de Correios / Carteiro / 2011)
$SDODYUD³WUHP-EDOD´pFRPSRVWDSRUMXVWDSRVLomRWDOTXDORYRFiEXOR
a) governança.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 72 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

b) ilimitado.
c) passatempo.
d) superprodução.
e) faturamento.
53. (CONSULPLAN / Prof. Português / 2010)
A alternativa em que todas as palavras são formadas pelo processo de derivação
é:
a) televisão, filme
b) emparelhado, debate
c) reinventado, biografia
d) naturalidade, ouro
e) verdade, pós-amor
54. (IDECAN / Administrador / FUNTELPA / 2010)
Assinale a alternativa em que o processo de formação de palavras está
indevidamente caracterizado:
a) Desinteresse: derivação prefixal.
b) Eleitores-usuários: composição por aglutinação.
c) Deslealdade: derivação prefixal e sufixal.
d) Busca: derivação regressiva.
e) Simplesmente: derivação sufixal.
55. (FGV / Fiscal de Rendas / SEFAZ-RJ / 2009)
Com relação aos processos de formação de palavras, analise as afirmativas a
seguir:

I. estruturador, civilizacional e renováveis são adjetivos formados por derivação


sufixal.
II. hominização, dilapidação e autodestruição são substantivos formados por
composição e derivação.
III. autodestruição, contrapartida e responsabilidade são substantivos formados
por composição.

Assinale:
a) se somente a afirmativa I estiver correta.
b) se somente a afirmativa II estiver correta.
c) se somente a afirmativa III estiver correta.
d) se somente as afirmativas I e II estiverem corretas.
e) se todas as afirmativas estiverem corretas.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 73 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

56. (CONSULPLAN / Analista de Informática / SDS-SC / 2008)


A alternativa em que todas as palavras são formadas pelo mesmo processo de
formação é:

a) responsabilidade, musicalidade, defeituoso


b) cativeiro, incorruptíveis, desfazer
c) deslealdade, colunista, incrível
d) anoitecer, festeiro, infeliz
e) reeducação, dignidade, enriquecer
57. (IOBV / Pref. Chapecó / engenheiro / 2016)
³,QIHOL]PHQWHDVFKHLDVGHFDVWLJDUDPGHIRUPDVHYHUD R9DOHGR,WDMDt´
Na frase acima (elaborada para fins de concurso) temos o caso da expressão
³,QIHOL]PHQWH´ $ SDODYUD SRGH VHU DVVLP GHFRPSRVWD LQ  IHOL]  PHQWH
Aponte qual a função da partícula in dentro do processo de estruturação das
palavras.
a) Radical.
b) Sufixo.
c) Prefixo.
d) Interfixo.
58. (FCC / Técnico em Regulação / ANS / 2007)
Considere a aproximação dos verbos ligam e desligam . Observa-se a mesma
relação na formação das palavras transcritas abaixo, EXCETO no par:
a) possível - impossível
b) nível - desnível
c) criatividade - incrível
d) adaptar - desadaptar
e) fácil - difícil
59. (FGV / MPE-RJ / TÉCNICO / 2016)
Os vocábulos abaixo foram retirados dos dois textos desta prova; aquele cujo
elemento sublinhado tem valor corretamente indicado é:
a) autorregulamentação / verdadeiro;
b) indireto / dentro de;
c) transformação / tempo;
d) diagnóstico / através de;
e) supermicroscópio / preço.

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 74 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

60. (FGV / Consultor de Orçamento / Senado Federal / 2008)


Assinale a alternativa em que a palavra indicada não tenha sido formada pelo
mesmo processo que internacional .
a) desrespeito
b) inequívoca
c) democracia
d) imediato
e) inexistente
61. (CESPE / Diplomata / Instituto Rio Branco / 2006)
³2UHJLPHGHGHPRcracia sem povo é absurdo, sem deixar de ser igualmente
SHUQLFLRVR´
Julgue o item a seguir, acerca do fragmento de texto acima, de Manuel Bonfim,
escrito em 1903.
A própria origem e formação da palavra democracia reforça o argumento
desenvolvido pelo autor no último período do texto.
62. (FCM / Pref. Barbacena / Agente Administrativo / 2016)
No trecho: ³2 FRPSRUWDPHQWR LQIDQWLOL]DGR GH PXLWRV YHtFXORV DWUDYpV GDV
mídias sociais, por exemplo, demonstra imaturidade e desestruturação de
SHQVDPHQWR´os vocábulos grifados são formados por prefixação e sufixação.
Em ambos os vocábulos, o prefixo indica um valor semântico de
a) negação.
b) contraposição.
c) movimento para trás.
d) movimento para baixo.
63. (FUNCAB / EMSERH / AUX. ADMINISTRATIVO / 2016)
O elemento destacado em ANTIbiótico significa:
a) repetição.
b) embaixo de.
c) movimento para trás.
d) movimento para dentro.
e) oposição.
64. (CESPE / Diplomata / Instituto Rio Branco / 2006)
Julgue os itens subsequentes.
As palavras ³LUUHVSRQVDELOLGDGH´e ³UHVVHQWLPHQWR´são, ambas, derivadas dos
processos de formação de palavras por prefixação e por sufixação.
65. (CESPE / SEDF / PROFESSOR / 2017)
Com referência às ideias e aos aspectos linguísticos do texto precedente, julgue

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 75 de 76
PORTUGUÊS ± CÂMARA DE BH
Aula 10 ± Felipe Luccas Rosas

o próximo item.
Dois processos morfológicos atuam na formação do advérbio ³LQIHOL]PHQWH´
Dadas as propriedades dos afixos presentes, verifica-se uma ambiguidade
estrutural referente à ordem de ocorrência desses processos: pode-se
primeiramente adicionar o prefixo in- ao adjetivo feliz, e, depois o sufixo ±
mente, ou, ao contrário, pode-se adicionar primeiro o sufixo e, depois, o prefixo.

Gabaritos

1. LETRA C 23. LETRA E 45. LETRA A


2. LETRA A 24. LETRA D 46. INCORRETA
3. LETRA A 25. LETRA A 47. LETRA B
4. LETRA A 26. LETRA D 48. LETRA D
5. LETRA D 27. LETRA B 49. INCORRETA
6. CORRETA 28. LETRA A 50. LETRA B
7. LETRA E 29. LETRA B 51. LETRA B
8. LETRA A 30. LETRA B 52. LETRA C
9. LETRA B 31. LETRA D 53. LETRA B
10. LETRA B 32. LETRA C 54. LETRA B
11. LETRA D 33. LETRA A 55. LETRA A
12. LETRA E 34. LETRA D 56. LETRA A
13. LETRA B 35. LETRA B 57. LETRA C
14. LETRA E 36. LETRA A 58. LETRA C
15. LETRA D 37. LETRA C 59. LETRA D
16. LETRA C 38. LETRA E 60. LETRA C
17. LETRA B 39. LETRA D 61. CORRETA
18. LETRA B 40. LETRA D 62. LETRA A
19. LETRA A 41. LETRA B 63. LETRA E
20. LETRA B 42. LETRA E 64. CORRETA
21. INCORRETA 43. LETRA D 65. INCORRETA
22. LETRA C 44. LETRA C

Prof. Felipe Luccas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 76 de 76
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

c) cacofonia e adjetivação.
d) adjetivação e aliteração.
e) cacofonia e aliteração.
Comentários:
Em ³Hla tinha´ temos cacofonia, um mau som. Em ³5RPeu perdeu´, temos rima,
que constitui o vício de linguagem chamado Eco. Gabarito letra B.
48. (CESPE / Instituto Rio Branco / 2005)
Há redundância em "os resquícios deixados pela guerra", o que permite a
alteração para os resquícios da guerra..
Comentários:
Exato. Bastaria resquícios da guerra  SRLV ³UHVTXtFLR´ p VHPSUH DOJR TXH p
deixado. Questão correta.
49. (CESPE / Instituto Rio Branco / 2006)
Julgue (C ou E) os itens abaixo, com base no padrão gramatical e estilístico da
modalidade escrita da língua portuguesa culta.
O pesquisador cumpriu suas metas rigorosamente dentro do prazo e do
orçamento e, portanto, honrou uma vez mais sua própria autobiografia.
Comentários:
Ocorreu o vício de redundância. 6HpDXWRELRJUDILDMiHVWiFODURTXHp³SUySULD´
pois ³DXWR´VLJQLILFD³GHVLPHVPR´Questão incorreta.
50. (CESPE / Instituto Rio Branco / 2007)
Julgue a adequação da reescritura abaixo:
"Frente à tradição hindu que há 2.500 anos divide a sociedade indiana" / Em
face da tradição hindu, que dividiu há 2.500 anos atrás, a sociedade
indiana.
Comentários:
Há 2.500 anos atrás configura um pleonasmo, pois o verbo haver já indica tempo
GHFRUULGRVHQGRGHVQHFHVViULRHVFUHYHU³DWUiV´4XHVWmRLQFRUUHWD

Lista de questões

1. (CESPE / PC ES / Aux. de Perícia Médico-Legal / 2011)


No dia 3 de julho de 1950, a Coreia do Norte atacou e tomou Seul, a capital
do Sul. Começava ali uma guerra que opunha os povos de um país dividido,
com os Estados Unidos da América de um lado e a China e a União das
Repúblicas Socialistas Soviéticas do outro. O conflito durou cerca de três anos
e terminou com o país ainda dividido ao meio. O saldo? Três milhões e meio
de mortos.
Em relação às ideias e à estrutura linguística do texto acima, julgue os itens a

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 39 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

seguir.
Na linha 5, o emprego da interrogação é um recurso estilístico e retórico que
confere ênfase à informação subsequente.
2. (Cespe/ TCE PA - Auditor / 2016)
As garras do Leão estão mais afiadas. A partir deste ano, os bancos terão de
informar à Receita Federal qualquer movimentação financeira mensal acima
de R$ 2.000 feita por pessoas físicas. No caso das empresas, o valor será de
R$ 6.000.
No que se refere às ideias e às estruturas linguísticas do texto, julgue o
próximo item.
1D SULPHLUD RUDomR GR WH[WR R WHUPR ³/HmR´ IRL HPSUHJDGR GH IRUPD
simbólica, para denotar a força política exercida pelo Estado sobre a nação
brasileira.
3. (Cespe/ FUB / 2015)

Julgue o item a seguir, relativo à tipologia e aos aspectos linguísticos do texto


acima.
A correção gramatical e os sentidos do texto seriam mantidos, caso se
VXEVWLWXtVVHDH[SUHVVmR³SHVRGHRXUR´ O  TXHWHPQDWXUH]DPHWDIyULFD
por muita importância ou muito valor.
4. (Cespe/ Câmara dos Deputados- Agente Policial / 2014)
A democracia já não se reduz a uma esperança, não é mais uma questão, não
é apenas um direito, não é somente o apanágio de uma cidade ilustrada como
Atenas, ou de um grande povo como o romano: é mais, é tudo nas sociedades
modernas. De mera previsão, converteu-se em fato; de opinião controversa,
transformou-se em realidade viva; deixou de ser puro direito para ser direito
e força; passou de simples fenômeno local a lei universal e onipotente.
Enquanto alguns discutem ainda se ela deve ser, já ela é. Como o crescer
silencioso, mas incessante, do fluxo do oceano, sobe e espraia-se calada, mas
continuamente. Cada onda que se aproxima, e recua depois, estende os limites
do poderoso elemento. Os espíritos que não veem muito deixam-se dormir,
entretanto, recostados indolentemente à margem que as águas não tardarão
em invadir, porque a enchente cresce linha a linha sem que a percebam, e,
como a onda retrocede sempre, parece-lhes que, retrocedendo, perdeu todo
o terreno vencido. Embora alguma onda mais impetuosa, como que os

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 40 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

advertindo, jogue de longe sobre eles a espuma.


Riem dela, porque a veem retrair-se logo após; persuadidos de que têm
subjugado o oceano quando mandam pelos seus serviçais antepor-lhe a
cautela de algum quebra-mar que dure pela vida de uma ou duas gerações.
Cuidam ter desse modo segurado a sua casa e o futuro dos filhos. Mas o frágil
anteparo, minado pela ação imperceptível das águas, esboroa-se um bom dia,
malogrando-lhes os cálculos, quando
não mais que isso...
Rui Barbosa. Obras completas de Rui Barbosa. Vol. I (1865-1871), tomo I, p. 19-20.
Internet: <www.casaruibarbosa.gov.br> (com adaptações).

Julgue o item abaixo, relativo às ideias e a aspectos linguísticos do texto acima.


Utilizando-se de metáforas, o autor constrói texto argumentativo em que a
democracia é retratada como o oceano e suas ondas, e os que nela não creem,
UHSUHVHQWDGRVFRPRRV³HVStULWRVTXHQmRYHHPPXLWR´ / 
5. (Cespe / TJ-RJ / Analista / 2008)
Considere:
,³DEULQGRjIORUGRURVWRGRLVJUDQGHVROKRVD]XLV´.
,,³YDSRURVDHLGHDOFRPRXPDFULDomRGH6KDNHVSHDUH´
,,,³$VXDIDODGHYHVHUXPPXUP~ULRGHKDUSDHyOLD´.
Julgue o item a seguir:
Há linguagem figurada em todos os trechos acima.
6. (INAZ PA / Auxiliar Administrativo / 2016)
1R WUHFKR ³H PXLWDV YH]HV VDtD Mi OHYDQGR QD PmR XP GRV SULPHLURV
exemplares rodados, o jornal ainda quentinho da máquina, como pão saído do
IRUQR´DILJXUDGHOLQJXDJHPSUHVHQWHp
a) metonímia
b) perífrase
c) hipérbole
d) antítese
e) comparação.
7. (Cespe/ Instituto Rio Branco / 2015)
1
O subúrbio de S. Geraldo, no ano de 192..., já
misturava ao cheiro de estrebaria algum progresso. Quanto
mais fábricas se abriam nos arredores, mais o subúrbio se
4
erguia em vida própria, sem que os habitantes pudessem dizer
que transformação os atingia. Os movimentos já se haviam
congestionado e não se poderia atravessar uma rua sem
7
desviar-se de uma carroça que os cavalos vagarosos puxavam,
enquanto um automóvel impaciente buzinava atrás lançando

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 41 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

fumaça. Mesmo os crepúsculos eram agora enfumaçados e


10 sanguinolentos. De manhã, entre os caminhões que pediam
passagem para a nova usina, transportando madeira e ferro, as
cestas de peixe se espalhavam pela calçada, vindas, através da
13
noite, de centros maiores. Dos sobrados desciam mulheres
despenteadas com panelas, os peixes eram pesados quase na
mão, enquanto os vendedores em mangas de camisa gritavam
16
os preços. E quando, sobre o alegre movimento da manhã,
soprava o vento fresco e perturbador, dir-se-ia que a população
inteira se preparava para um embarque.
Clarice Lispector. A cidade sitiada. Rio de Janeiro: Rocco, 1998, p. 15-6

Com referência às ideias e às estruturas do texto acima, julgue (C ou E) o item


que se segue.
2V VHJPHQWRV ³XP DXWRPyYHO LPSDFLHQWH EX]LQDYD´ L  H ³HQWUH RV
FDPLQK}HVTXHSHGLDPSDVVDJHP´ L. 10 e 11) expressam a mesma figura de
linguagem.
8. (Cespe/ Câmara dos Deputados- Agente Policial / 2014)
O cão de companhia é assim: um carente que supre a carência do dono. É
como um casamento: quando um não comparece, está na hora de discutir a
relação. É o que ele está fazendo.

A partir das ideias e das estruturas linguísticas do texto acima, julgue o item.
É possível identificar um procedimento figurativo relacionado à personificação
do cãozinho.
9. (INAZ PA / Enfermagem/ 2016)
O leão, o burro e a raposa.
O leão, o burro e a raposa saíram juntos para caçar. Pegaram muitas
presas, e o leão ordenou ao burro que dividisse a caça entre os três. O burro
partiu o bolo todo em três partes iguais. Essa divisão não agradou nem um
pouco ao leão! Irado, ele devorou o burro.
Então, o leão mandou que a raposa dividisse de novo a caça. A raposa,
prudente, juntou quase toda a caça num mesmo bolo e lhe entregou, ficando
somente com um pouquinho.
± Como você é inteligente, raposa! ± Admirou-se o leão, satisfeito. ± Quem
foi que a ensinou a dividir tão bem assim? E a raposa respondeu apenas: ± O
burro.
TOLSTÓI, Liev. Fábulas. Tradução e adaptação de Tatiana Mariz e Ana Sofia Mariz. São
Paulo: Companhia das Letrinhas, 2009. p. 34-37.

(P³± Como você é inteligente, raposa! ± Admirou-VHROHmRVDWLVIHLWR´RFRUUH


uma figura de pensamento:

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 42 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

a) Ironia b) Onomatopeia c) Pleonasmo d) Prosopopeia e) Metáfora.


10. (CESPE / PC-ES / Aux. de Perícia Médico-Legal / 2011)
Os antigos tinham desta língua de cultura ± que não é toda a realidade de uma
língua- perfeita noção de onde ela poderia ser aprendida. Hoje o que se
pratica?
Ainda com base no texto, julgue o item a seguir, acerca de tipologia textual e
de funções e figuras de linguagem.
2WHUPR³DQWLJRVGHVLJQDXPDPHWRQtPLD
11. (UEM / Técnico / 2017)
Na expressão "eles dão de mil a zero", há uma figura de linguagem chamada
a) hipérbole. b) paradoxo. c) catacrese. d) onomatopeia. e) metomínia.
12. (CESPE / BANCO DO BRASIL / ESCRITURÁRIO / 2009)
Não é preciso muito esforço para notar de que é feito o cotidiano de um
indivíduo brasileiro socioeconomicamente privilegiado. Os assuntos da vida
privada são, de longe, os que dominam qualquer outro tipo de preocupação.
No entanto, o cuidado excessivo com o bem-estar não apenas realimenta a
cultura do alheamento como reduplica-se em irresponsabilidade para consigo.
$ UHGH GH DWHQGLPHQWR DRV ³IDPLQWRV GH IHOLFLGDGH´ WRUQRX-se um negócio
rendoso, e os usuários, para mantê-la, exigem mais exploração dos que já são
superexplorados.
Quem vive permanentemente na infelicidade não pode olhar o outro como
alguém com quem possa ou deva preocupar-se. O sentimento íntimo de quem
padece é de que o mundo lhe deve alguma coisa, e não de que ele deva
TXDOTXHU FRLVD DR PXQGR 2 ³FRPpUFLR GH IHOLFLGDGH´ p RUTXHVWUDGR GH WDO
modo que o sentimento de deficiência, escassez ou privação pede sempre mais
dinheiro e mais atenção para consigo, como meio de evitar a presença
avassaladora das frustrações emocionais.
Jurandir Freire. A ética democrática e seus inimigos ± o lado privado da violência
pública. In: Ari Roitman (Org). O desafio ético, 2000, p. 83-4 (com adaptações
As aspas utilizadas nas linhas 6 e 12 servem para realçar o uso metafórico ou
figurado da linguagem, conferindo-lhe também, pelo exagero, um valor de
ironia.
13. (Quadrix / SEDF / Professor / 2017)
O que o poeta quer dizer
no discurso não cabe
e se o diz é pra saber
o que ainda não sabe.

Uma fruta uma flor


um odor que relume...
Como dizer o sabor,
seu clarão seu perfume?

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 43 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

Acerca do poema acima e de seus aspectos linguísticos, julgue o item que se


segue.
Na segunda estrofe do poema, o sujeito-lírico emprega como recurso
expressivo a figura de linguagem denominada sinestesia.
14. (FGV / COMPESA / ANALISTA / 2016)
Assinale a opção que indica o pensamento em que não ocorre uma
estruturação com base numa antítese
a) De nada serve ao homem conquistar a Lua, se acaba por perder a Terra.
b) Modernidade é a tensão entre o efêmero e o eterno.
c) Meios poderosos, mas objetivos confusos: essa é a nossa época.
d) Não foi o mundo que piorou. As coberturas jornalísticas é que melhoraram
muito.
e) Um a um somos todos mortais. Juntos, somos eternos.
15. (FGV / COMPESA / ANALISTA / 2016)
1DIUDVH³9RFrTXHUHVWDUFHUWRRXTXHUVHUIHOL]´"RFRUUH
a) uma antítese paradoxal.
b) uma pergunta retórica.
c) uma ambiguidade intencional.
d) uma falsa oposição.
e) uma ausência de paralelismo.
16. (Cespe / Instituto Rio Branco / 2014)
Essa imagem de mim entre aspas me satisfazia, e não apenas
superficialmente. Eu era a imagem do que não era, e essa imagem do não ser
me cumulava toda: um dos modos mais fortes é ser negativamente. Como eu
QmR VDELD R TXH HUD HQWmR ³QmR VHU´ HUD D PLQKD PDLRU DSUR[LPDomR GD
YHUGDGH SHOR PHQRV HX WLQKD R ODGR DYHVVR HX SHOR PHQRV WLQKD R ³QmR´
tinha o meu oposto. O meu bem eu não sabia qual era, então vivia com algum
pré-IHUYRURTXHHUDRPHX³PDO´
Clarice Lispector. A paixão segundo G. H. Rio de Janeiro:Editora do Autor,
964, p. 30-1 (com adaptações)
$VHQWHQoD³(XHUDDLPDJHPGRTXHQmRHUD´ L.02) expressa um paradoxo
ou oximoro.
17. (CESPE / DIPLOMATA / 2012)
1 Através de grossas portas,
sentem-se luzes acesas,
² e há indagações minuciosas
4
dentro das casas fronteiras:
olhos colados aos vidros,
mulheres e homens à espreita,
7
caras disformes de insônia,

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 44 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

vigiando as ações alheias


Cecília Meireles. Romanceiro da Inconfidência.
Obra poética. Rio de Janeiro: Nova Aguilar, 1977, p. 450-2 (com
adaptações).

Nos dois primeiros versos, o eu lírico alude ao sigilo dos inconfidentes por meio
de paradoxo e sinestesia.
18. (Cespe / TJ-RJ / Analista / 2008)
Nasce o sol, e não dura mais que um dia.
Depois da luz se segue a noite escura,
Em tristes sombras morre a formosura
Em contínuas tristezas a alegria.
Gregório de Matos Guerra. Obra poética de Gregório
de Matos. Rio de Janeiro: Record, 2.ª ed. 1990.

Assinale a opção que apresenta a figura de linguagem predominante no trecho


do poema acima.
a) sinestesia
b) comparação
c) antítese
d) eufemismo
e) hipérbole.
19. (FUNDEP / IFN MG / 2016)
Releia o trecho a seguir.
³µ(VWiHPWRGDVDVSDUWHVHHPQHQKXPD¶>@´
Leia as definições a seguir, retiradas do Aurélio versão 7.0 ± eletrônica, e
assinale aquela pertinente a esse trecho.
D 3DUDGR[R³&RQFHLWRTXHpRXSDUHFHFRQWUiULRDRFRPXPFRQWUDVVHQVR
absurdo, disparDWH´
b) 7DXWRORJLD ³YtFLR GH OLQJXDJHP TXH FRQVLVWH HP GL]HU SRU IRUPDV
GLYHUVDVVHPSUHDPHVPDFRLVD´
F 0HWiIRUD³WURSRTXHFRQVLVWHQDWUDQVIHUrQFLDGHXPDSDODYUDSDUDXP
âmbito semântico que não é o do objeto que ela designa, e que se fundamenta
numa relação de semelhança subentendida entre o sentido próprio e o
ILJXUDGRWUDQVODomR´
G $PELJXLGDGH³TXHVHSRGHWRPDUHPPDLVGHXPVHQWLGRHTXtYRFR´
20. (FCC / TST / Analista Judiciário / 2012) Adaptada
Lista negra
*(jn) Relação de pessoas ou de assuntos vetados RX ³LQGHVHMiYHLV´ HP XP

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 45 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

órgão de imprensa, isto é, proibidos de ser mencionados ou focalizados


favoravelmente no noticiário, por determinação da direção do veículo. Prática
usual de alguns jornais.
(Dines, A. In Carlos Alberto Rabaça/Gustavo Guimarães Barbosa. Dicionário de
comunicação. 2.ed. rev. E atualizada. Rio de Janeiro: Elsevier, 2001, 10ª
reimpressão. p.436)

Com base no fragmento acima, julgue o item a seguir:


É aceitável entender-VH³LQGHVHMiYHLV´FRPRIRUPDGHHXIHPLsmo.
21. (Consulplan / TJ-MG / Outorga de Cartório / 2017)
Acerca das figuras de linguagem, recurso estilístico usado para propiciar maior
expressividade ao texto literário, assinale a alternativa correta:
a) Antítese: consiste na aproximação de termos iguais, sendo enfatizada essa
relação de sinonímia.
b) Hipérbole: trata-se de minimizar uma ideia com a finalidade suavizar o
discurso.
c) Ironia: é a figura que apresenta um termo em sentido oposto ao usual,
obtendo-se, com isso, efeito crítico ou humorístico.
d) Prosopopeia ou personificação: consiste em atribuir a seres animados
predicativos que são próprios de seres inanimados.
22. (FGV / DETRAN-RN / Assessor Técnico)
Há um exemplo de prosopopeia em:
D ³&RPRHXLQYHMRRVTXHQmRHVTXHFHUDPDFRUGDVSULPHLUDVFDOoDVTXH
YHVWLUDP´
E ³(DQWHVVHMDROYLGRTXHFRQIXVmRH[SOLFR-PH´
F ³2VULRVDVPRQWDQKDVDVLJUHMDVTXHQmRYLQDVIROKDVOLGDV´
G ³1mRQmRDPLQKDPHPyULDQmRpERD´
e) ³ HRVFODULQVVROWDPDVQRWDVTXHGRUPLDPQRPHWDO HWXGRPDUFKD
FRPXPDDOPDLPSUHYLVWD´.
23. (FGV / ALERJ / Especialista Legislativo / 2017)
Texto 4 - PRIVAÇÕES
Verissimo, O Globo, 20/10/2016
³'XUDQWHDQRVR%UDVLOVRIUHXDSULYDomRGR)UDQN6LQDWUD3DVVDYDDQR
passava ano, e o Frank Sinatra não vinha. Nossa maior angústia era com o
tempo: se demorasse muito para vir, o Frank Sinatra, quando viesse, não seria
mais o mesmo. Poderia não ter mais a grande voz, ou ser uma múmia de si
mesmo. Por que o Frank Sinatra não vinha ao Brasil enquanto era tempo? E,
finalmente, o Frank Sinatra veio ao Brasil. E a espera, concordaram todos,
tinha valido a pena. Sinatra cantou no Rio Palace para endinheirados e no
Maracanã para uma multidão. Sua voz era a mesma dos bons tempos, apenas
envelhecida em tonéis de carvalho como um bom Bourbon. O Brasil agradeceu
D6LQDWUDFRPRPDLRUS~EOLFRGHVXDFDUUHLUD(ILFRXIHOL]´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 46 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

No texto 4 está presente o seguLQWHVHJPHQWR³3RGHULDQmRWHUPDLVDJUDQGH


YR]RXVHUXPDP~PLDGHVLPHVPR´
Nesse segmento exemplifica-se a seguinte figura de linguagem:
a) antítese;
b) metáfora;
c) metonímia;
d) pleonasmo;
e) paradoxo..
24. (FGV / ALERJ / Especialista Legislativo / 2017)
No período inicial do texto 1 - O cristianismo impregna, com maior ou menor
evidência, a vida cotidiana, os valores e as opções estéticas até mesmo dos
que o ignoram. ± ocorre um exemplo de linguagem figurada, denominada
antítese, estruturada na oposição semântica maior/menor.
Os vocábulos abaixo que também serviriam para estruturar uma antítese são:
a) Às vezes ganha destaque ou relevância no noticiário.
b) Entender os debates mais recentes ou anacrônicos...
c) ...eventuais alusões a um suposto conhecimenbto prévio ou previsto.
d) ...as práticas humanitárias ou filantrópicas...
e) ..que nos dirigimos a eminentes ou desprestigiados especialistas...
25. (FGV / DETRAN-RN / Assessor Técnico)
Assinale a passagem do texto que apresenta a figura de linguagem
denominada de prosopopeia.
a) Preciso me livrar dessas baratas!
b) Fez uma espécie de manto da cortina da sala para cobrir sua nudez.
c) Todas as baratas são iguais, mas uma mulher precisa realçar a sua
personalidade.
d) (...) porque os hábitos morrem devagar.
e) O marido ia morrer ± não que ele fizesse falta.
26. (Cespe / STJ / Analista / 2015)
No período pré-romano da história ocidental, a sanção tinha fundamento
religioso e pretensão de satisfação da divindade ofendida pela conduta do
ofensor. Nesse período, surgiu a chamada Lei do Talião, do latim Lex Talionis
² Lex significando lei e Talionis, tal qual ou igual. É de onde se 13 extraiu a
Pi[LPD³2OKRSRUROKRGHQWHSRUGHQWH´HQFRQWUDGD
inclusive, na Bíblia.
Acerca das estruturas linguísticas do texto Evolução histórica da
responsabilidade civil e efetivação dos direitos humanos, julgue o item a
seguir.
Na linha 4DYtUJXODTXHVHVHJXHDRYRFiEXOR³Talionis´UHSUHVHQta a elipse
GDIRUPDYHUEDO³VLJQLILFDQGR´

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 47 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

27. (Cespe / TRE-RJ / Técnico Judiciário / 2012)


Sempre se soube que um dos principais entraves ao crescimento do Brasil é o
gargalo educacional. Novas pesquisas, porém, revelam que o problema é
muito mais grave do que se supunha. A mais recente, elaborada pelo Instituto
Paulo Montenegro e pela ONG Ação Educativa, mostrou que 38% dos
estudantes do ensino superior no país simplesmente ³QmR GRPLQDP
KDELOLGDGHVEiVLFDVGHOHLWXUDHHVFULWD´
(P ³$ PDLV UHFHQWH´ RFRUUe elipse da palavra pesquisa, que pode ser
VXEHQWHQGLGDDSDUWLUGRDQWHFHGHQWH³SHVTXLVDV´.
28. (CESPE / Secretaria de Educação-ES / Professor / 2010)
Julgue o item subsequente.
2FRUUHHOLSVHRX]HXJPDHP³ROLQJXLVWDVHLQWHUHVVDSHODOtQJXDFRPRHODp
HQmRFRPRGHYHULDVHU´
29. (CESPE / Instituto Rio Branco / 2007)
No trecho "O mais provável é que o latim fosse usado nas relações com as
autoridades romanas; o grego, nas grandes cidades; e o osco, nas regiões
rurais", utiliza-se uma forma de elipse, por meio da qual se evitam repetições.
30. (Consulplan / TRF RJ-ES / Analista / 2017)
1RSHUtRGR³O preconceito, é em muitos de nós que ele existe´IRLXWLOL]DGRR
recurso semântico da figura de linguagem, que consiste no emprego de um
sentido figurado que surge de uma intenção ou da necessidade de expressão
de forma criativa, inovadora. Assinale a alternativa correspondente à figura
utilizada no trecho e sua definição correta.
a) Hipérbato que consiste na repetição de palavras e sons.
b) Apóstrofe que consiste na interpelação direta às pessoas ou coisas
personificadas.
c) Anacoluto que consiste na interrupção do plano sintático com que se inicia
uma frase, alterando-lhe a sequência do processo lógico.
d) Silepse que consiste em fazer a concordância de palavras ou expressões
agradáveis em substituição às que têm sentido grosseiro ou desagradável..
31. (IF / CE / Tecnólogo / 2016)
Na frase: ³$ 0LQKD YL]LQKD RXYL GL]HU TXH WHYH XP DFLGHQWH´,
encontramos a seguinte figura de linguagem:
a) Metonímia. b) Anacoluto. c) Catacrese. d) Hipérbato. e) Silepse.
32. (CESPE / DIPLOMATA / 2012)
Estou tão perdida. Mas é assim mesmo que se vive: perdida no tempo e no
espaço.
Morro de medo de comparecer diante de um Juiz. Emeretíssimo, dá licença de
eu fumar? Dou, sim senhora, eu mesmo fumo cachimbo. Obrigada, Vossa
Eminência. Trato bem o Juiz, Juiz é Brasília. Mas não vou abrir processo contra
Brasília. Ela não me ofendeu. (...)
Eu sei morrer. Morri desde pequena. E dói, mas a gente finge que não dói.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 48 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

Estou com tanta saudade de Deus.


E agora vou morrer um pouquinho. Estou tão precisada.
Sim. Aceito, my Lord. Sob protesto.
Mas Brasília é esplendor.
Estou assustadíssima.

No período ³0DVpDVVLPPHVPRTXHVHYLYHSHUGLGDQRWHPSRHQRHVSDoR´,
o particípio do verbo perder, empregado em estrutura de indeterminação do
sujeito da oração, poderia, conforme regra de concordância nominal, estar na
forma masculina, regra da qual, no entanto, a obra literária prescinde, dada a
liberdade que preside a criação artística.
33. (AOCP / EBSERH / 2017)
Dentre as alternativas a seguir, qual apresenta uma figura de estilo presente
HP³>@VyGHSHQVDUHPVHVHQWDUHPPHLRDJHQWHTXHDRFRQWUiULRGHODV
HVWmRDFRPSDQKDGDV´"
a) Sinestesia.
b) Silepse de número.
c) Silepse de gênero.
d) Eufemismo.
e) Prosopopeia.
34. (Cespe / Instituto Rio Branco / 2012)
1R SHUtRGR ³4XH 'HPyFULWR QmR ULVVH HX R SURYR´ R YHUER SURYDU
complementa-se com uma estrutura em forma de objeto direto pleonástico,
com uma oração servindo de referente para um pronome.
35. (Cespe / TRT-RJ / ANALISTA / 2008)
Julgue o item a seguir.
O texto, em que foi empregada uma linguagem simples, de fácil compreensão,
apresenta um termo típico da linguagem coloquial no trecho 'Esse primeiro
trimestre, como dizem meus filhos, bombou' ...
36. (Cespe / Instituto Rio Branco / 2005)
Ao menos uma vez na vida, todos os autores tiveram ou terão de ser Luís de
Camões, mesmo se não escreveram as redondilhas entre fidalgos da corte e
censores do Santo Ofício, entre os amores de antanho e as desilusões da
velhice prematura, entre a dor de escrever e a alegria de ter escrito, foi a este
homem doente que regressa pobre da Índia, aonde muitos só iam para
enriquecer, foi a este soldado cego de um olho e golpeado na alma, foi a este
sedutor sem fortuna que não voltará nunca mais a perturbar os sentidos
das damas do paço, que eu pus a viver no palco da peça de teatro chamada:
Que Farei com Este Livro?, em cujo final ecoa uma outra pergunta, aquela que
importa verdadeiramente, aquela que nunca saberemos se alguma vez
chegará a ter UHVSRVWDVXILFLHQWH³4XHIDUHLFRPHVWHOLYUR"´
José Saramago. Discurso proferido por ocasião do recebimento do Prêmio Nobel de

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 49 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

Literatura. Estocolmo, 1998 (com adaptações).

2WUHFKR³TXHQmR voltará nunca mais a perturbar os sentidos das damas do


SDoR´ caracteriza-se pelo emprego dos recursos da redundância e do
eufemismo.
37. (Fadesp / Engenheiro Civil / 2017)
1RVHQXQFLDGRV³0DVRSUHVHQWHQHVVDYHORFLGDGHpXPSUHWpULWRFRQWtQXR´
H³QRVVRPXQGRLQWHUQRILFRXDRFHDQRVGHQyV´RFRUUHUHVSHFWLYDPHQWH
a) ironia e catacrese.
b) antítese e hipérbole.
c) metonímia e metáfora.
d) eufemismo e prosopopeia.
38. (Funece / METROFOR-CE / 2017)
Assinale a opção em que a figura de linguagem está corretamente identificada.
a) ³ FXLGDU GR PXQGR e vigiar o mundo, e gritar os seus brados... que
ninguém escuta e chorar... as desgraças previsíveis e carpir junto com os
GHPDLV´² Polissíndeto.
b) ³2LQTXLHWRcoração que ama e se assusta e se acha responsável pelo céu
HSHODWHUUDRLQVROHQWHFRUDomRQmRGHL[D´² Ironia.
c) ³QmR TXH R mundo lhe agradeça nem saiba sequer que esse estúpido
FRUDomRH[LVWH´² Perífrase.
d) ³RPLVWHULRVRVHQWLPHQWRGHIUDWHUQLGDGHTXHQmRDFKDQHQKXPDChina
GHPDVLDGRORQJH´² Catacrese..
39. (IBFC / Advogado / EBSERH / 2017)
Meu irmão, tino sério, responsabilidades. Ele, a camisa; eu, o avesso. Meio
burguês, metido a sensato. Noivo...
No trecho ³(OHDFDPLVDHXRDYHVVR´, foi empregado um recurso coesivo
que confere expressividade ao texto. Trata-se da:
a) elipse. b) anáfora. c) catáfora. d) repetição. e) sinonímia.
40. (MS Concursos / Agente Fiscal de Posturas / 2017)
Figuras de linguagem, também chamadas figuras de estilo, são recursos
especiais de que se vale quem fala ou escreve, para comunicar à expressão
mais força e colorido, intensidade e beleza. Sendo assim, assinale a alternativa
onde temos uma figura de linguagem chamada metáfora:
a) O rei dos animais foi generoso.(= leão).
b) As derrotas e as desilusões são amargas.
c) Foi o que vi com os meus próprios olhos.
d) Chorou rios de lágrimas. .

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 50 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

41. (Cespe / TRE-PI / Analista / 2017)

A respeito da representação dos sons e ruídos, no segundo quadrinho, julgue


o item a seguir.
O autor utiliza o recurso denominado onomatopeia, ao empregar caracteres
alfabéticos para representar os referidos sons e ruídos.
42. (COPEVE / UFAL / Administrador / 2014)
Senhas
Adriana Calcanhoto
Eu não gosto do bom gosto
Eu não gosto de bom senso
Eu não gosto dos bons modos
Não gosto
[...]
Eu gosto dos que têm fome
Dos que morrem de vontade
Dos que secam de desejo
Dos que ardem
[...]
Disponível em: <https://www.letras.mus.br/adriana-calcanhotto/66697/>. Acesso em: 26 jul. 2016.

O fragmento da canção estrutura-se pelo recurso da repetição de uma mesma


expressão no início dos versos. Esse recurso é chamado de
a) polissíndeto. b) anacoluto. c) aliteração. d) assíndeto. e) anáfora.
43. (FEPESE / PROCURADOR / 2016)
Julgue o item a seguir.
+iDSUHVHQoDGHSDU{QLPRVQDIUDVH³2FXPSULPHQWRIRLGDGRDRUDSD]TXH
WLQKDRFRPSULPHQWRH[DWRGDTXHODVSDUDJHQV´
44. (CESPE / SEE Alagoas / Professor / 2013)
Quinze anos depois, o trabalho mudou. As pessoas foram trabalhar em
fábricas, com ferramentas mecânicas. Elas trabalhavam em grandes grupos,

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 51 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

mas sozinhas em suas máquinas. Todos faziam a mesma coisa e ao mesmo


tempo, durante todo o dia. Eles não podiam conversar.
Na RUDomR ³(ODV WUDEDOKDYDP HP JUDQGHV JUXSRV PDV VR]LQKDV HP VXDV
PiTXLQDV´ KiXPDDPELJXLGDGHHVWUXWXUDOTXHSRGHVHULQWHUSUHWDGDFRPR
contradição.
45. (CESPE / TRE-MT / ANALISTA / 2010)
...Os processos psicológicos especificamente humanos se formam e se
desenvolvem em função das condições sociais da vida...
Na linha 1, para evitar-se a redundância do uso do pronome "se", pode-se
retirar o primeiro deles, antes de "formam", deixando-o apenas subentendido.
46. (CESPE / Instituto Rio Branco / 2005)
O autor XWLOL]D RV VHJXLQWHV HVWUDQJHLULVPRV ³WHUUDWHQHQWHV´ ³VWDWXV TXR´
³SULYp´ ³EXQNHU EODX´ H ³ILFWDV´ TXH GHYHULDP WHU VLGR REULJDWRULDPHQWH
escritos em itálico.
47. (FEPESE / PROCURADOR / 2016)
Julgue o item a seguir.
$IUDVH³2SHUVRQDJHPLQWHUYLXQDIDODGRFRPSDQKHLUR´DSUHVHQWDXPYtFLR
de linguagem.
48. (FCC / TJ-RJ / ANALISTA / 2012)
Entre as muitas preocupações que o redator tem para a construção do texto
radiofônico, existem duas que resultam em distorções sonoras indesejáveis.
Não se concebe, por exemplo, que a notícia radiofônica contenha frases com
³HODWLQKD´RX³5RPHXSHUGHX´(VVDVFRQVWUXo}HVLQGHVHMiYHLVFRUUHVSRQGHP
respectivamente, a
a) aliteração e rima.
b) cacofonia e rima.
c) cacofonia e adjetivação.
d) adjetivação e aliteração.
e) cacofonia e aliteração.
49. (CESPE / Instituto Rio Branco / 2005)
Há redundância em "os resquícios deixados pela guerra", o que permite a
alteração para os resquícios da guerra..
50. (CESPE / Instituto Rio Branco / 2006)
Julgue (C ou E) os itens abaixo, com base no padrão gramatical e estilístico da
modalidade escrita da língua portuguesa culta.
O pesquisador cumpriu suas metas rigorosamente dentro do prazo e do
orçamento e, portanto, honrou uma vez mais sua própria autobiografia.

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 52 de 53
PORTUGUÊS ± CÂMARA DE BH
Felipe Luccas Rosas

Gabaritos

1. CORRETA
2. INCORRETA
3. CORRETA
4. CORRETA
5. CORRETA
6. LETRA E
7. CORRETA
8. CORRETA
9. LETRA D
10. CORRETA
11. LETRA A
12. CORRETA
13. CORRETA
14. LETRA C
15. LETRA D
16. CORRETA
17. CORRETA
18. LETRA C
19. LETRA A
20. CORRETA
21. LETRA C
22. LETRA E
23. LETRA B
24. LETRA E
25. LETRA D
26. CORRETA
27. CORRETA
28. CORRETA
29. CORRETA
30. LETRA C
31. LETRA B
32. CORRETA
33. LETRA B
34. CORRETA
35. CORRETA
36. CORRETA
37. LETRA B
38. LETRA A
39. LETRA A
40. LETRA B
41. CORRETA
42. LETRA E
43. CORRETA
44. CORRETA
45. INCORRETA
46. INCORRETA
47. CORRETA
48. LETRA B
49. CORRETA
50. INCORRETA

Prof. Felipe Luccas Rosas www.estrategiaconcursos.com.br


08242255628 - LIVIA GOMES DE MORAIS 53 de 53
+01!"#"$%& '&()*+ +&,-&./&&
2&34&'&561786&90::2;& <;2;&

’“”•–—–˜“™˜—–˜—š—›–’“”•–—œ˜•–ž“Ÿ – ¬–”š“”•–¢“£˜•­–£•–”£˜—šœ®¯—–“– ³œ


“¤
“¤˜´“¤–š“–“¢—ª£¢”•–¤¯—–
—­ž”š•¤–“£¢—£˜•£š—–œ¡•–
¡•¢•£š—–•¤–”š“”•¤–¢“£˜•”¤–š“– £•–¢— £¢­
œ ¤
¯ — –
°–•–˜“¤“›
–±—– ¥•¦¨•¤“–µ““¤¢”˜œ•–
¢•š•–¥•¦§•¨— –©œ“– š “¤“£ ž—­ž”¡“ £˜— –°–
— –
˜²¥”
¢—– “© œ”ž•­“£˜“¶›–³œ“¤˜´“¤–š“–
¨“©œ“£˜“¡“£˜“–žª¡–£—–¤“œ– ¨•¤ •­
› ”
£¨“ª£¢”•–“™”§“¡–œ¡•–š“šœ®¯—–
”£«¢”—› ·•¤“•š•–“¡–¥“¤¤œ¥—¤˜—¤›–

= 983>8?82
@A 2


82235
B-CDE28<12EF
GHIJKILHMNOHNIPHQRHSOROIJHJHLHJKNROTNULVHLWJVJXJHQRNHNYYJVIOMNHZQJH[MNOHNSPR\HUJYYJH
]^_^`abcd_^edfg^ehe`ddijk`filmenfi`nfkfe`^fief`c`ffkde^d`fo
jfgenf`ge`e^fp_ f`c`fojgekqiidi]dkmedikf_ d^_dr^edsnfotduef
fm`gdidiifk^dsviow_dgr_ f`c`foi`^_m]dfj]ddiig`^hdggdda
B97x7D2E&6& 6;DE7yz7E{&
|fkfe`g}g^fdc`gdjf]dsnfa~mjgiinf  ^etfg_dsnfiiek^d]jdgdf`c`fa
diig`^hdgmk^fe^i`df_^`jdg`f lmtf^^`ffmgi`g^erftd`f^ikm`^fdm_
me^hgif_efgjfii^p^]^dia
B+:E6;:6yD2E&<87y7€<{&
b cd_^edfgjdgdtgdi^djdg` f`c`fo_didkgike`dm_ jfmkfdimdjgjg^d
fj^e^nfofj^e^nfi`dlmenftf^c`geddj]fdm`fgadg_d^]qdiididt^g_d`^hdi
i`}_ _pm`^gm_dfj^e^nflmenfi`}ef`c`fo_dii`}edkfeik^‚ek^dkf]`^hdo
jfgigm_ k]^kq‚fmieifkf_m_ lmfkde^d`fjfiidkf_jdg`^]qdga
B(<yDE2ƒ7„6E&<&D6CD<…&
GHIJKILHLVO†OTNSHUO‡H[ˆ\HJHLHIJKILH‰NVNWVNYJNULHUNHNYYJVIOMNHJVVNUNHUO‡H[Š‹LHˆ\HLQH[Œ\H
Ždgd^itdgsdgiidkfe`gd^snfodpdekdmidg}_m^`dijd]dhgdi f`c`fotdg}m_d
jdg}tgdi _m^`fi_]qde`o_dikf_ m_ hfk}pm]fkgmk^d]lm tdg}fie`^f t^kdg
^ehgifdff`c`fa
B!2yz6y:72E&<&D6x2…&
b cd_^edfgkg^dm_ddiig`^hdlmdjdge`_e`ig]dk^feddf`_do_ditd]d
 fm`gfdiime`fog_f`d_e` kfgg]d`faf_meffitd`fiodlm]if^i`_di
jf_ d` igdt^eio_dief`c`f enf itd]fmfirmefoifjg^_^gf‘e`nf
qfmhtmrdfm`derek^d_e`fdf`_da

12345789
8 3¸ º5
¹ »ºº¼¼½8
º¹¾¿2¾À 8

ÁÂÁ 3 2
þÄÅÆÇȾ 3
ÉǾ 535
ÆÅÊÃÁÈ2 
+01!"#"$%& '&()*+ +&,-&./&&
2&34&'&561786&90::2;& <;2;&
=3
>82?@87


ABCDBEFGCHIBJGCKLMHN DBKJGOFN HCPGJQHCKHFJQEREQHSTGUBNHQUPJFPHK
BN VEPWPFGXN REYQFPGZ[HHQVQGU BN QVQGKJTG \YO]ENBIHCBJFLECHFCZ
^GEUNKPGN GGNWJFGHCQUPJFPHCNGCQEHHCHDBFPGN GPBFHGFJQEREQHE
GC JBJPFHGCK RHEH CHXE C RN FJOGENHS_C VRIWPFQHC GB FNRIWPFQHCK U
`abbcdefghbijghklemnkmhkbhnejiokbhpqebnrebhoehsitnem`menkuvawx
yBzFEGDBCNREIFHN CBQVQGNHEPHJGRHIHLEHC{P\HLKLEXGCPHEEzHGC
CJQFGGRFJHQFLGKHOFENHS_CPHQz]EFPHCZ|HSHECBNGCNJQHFCJDBHJQGI}K
GBKC JTG OGEPGNREGNQEGQNRGHCBHREGLHKCPELHGIHG PHH
RHEYzEHOG CBHFFHREFJPFRHIZ ~CCHCCTG RFCQHCDB ILHETG LGP} HCLJHEG
NFCQUEFGBN QVQGZ
IFHN HC QUPJFPHC  CJLGILFNJQG  RHEYzEHOGC FJQEGBQ]EFGC  
CJLGILFNJQGK RGFC HDBIHC CQEBQBEHC CTG NBFQG OEDBJQC  CFJHIF€HN
OGEQNJQDBBN QVQGUFCCEQHQFLGZFHN CNREGCQWQBIGCHCOGJQCGC
QVQGCHCREGLHCKCTGzEHJCRFCQHCCGXEHOFJHIFHICZ
‚2?35ƒ 8338 >35
1234832789
8 3

>8„ 8@8
…5† ‡ˆ7‰1Š‹Œ
38 32Ž2
3‹…‘’
“JHIFCHCREGRGCFS_CGQVQGN EIHSTG”QFRGIGzFHz}JEGQVQBHI•
Z“|YXBIHUBNH–FRGIGzFHQVQBHIJTGBN z}JEGQVQG—
˜Z™z}JEGQVQBHIOYXBIHREQJP”QFRGIGzFHJHEEHQFLH—
Z™š}JEGHQFRGIGzFHQVQBHICOFJN FzBHINJQ
›ZyTG PHEHPQEWCQFPHC DB OFJN HOYXBIH•GC HJFNHFC DB OHIHN  BNH
IFJzBHzN EBFQH
“CCFJHIHHIQEJHQFLHPGEEQH•
Hœ˜
XœK˜
Pœ˜›
œ“RJHC˜
œ–GHCCQTGPGEEQHC 
5† ‡žƒ‰=3 23‹7
9>8Œ2
 3‹…Ÿ’
“CCFJHIHHIQEJHQFLH
32285
Hœ GFCPBECGFEQGKGJHEEHGEEREGB€JHWJQzEHHOHIHHCRECGJHzJC
GBFJQEIGPBQGECZšEHINJQCCHOHIHUFJQEGB€FHRGEQEHLCCTGZ
Xœ  G FCPBECG FJFEQGK G JHEEHGE VREFN FJFEQHNJQ H OHIH H
RECGJHzNZ™ JHEEHGEOBJPFGJHPGNGQCQNBJ\HHBFQFLHRHCCHRHEHG
IFQGEGDBGBLFBHRECGJHzNZ
12345789
8 3¡¢£ £5
¤ £¥¥¦£¢8
§¨§©ª2«ª
8

¬§ 3²°§
­®¯°±§ 2¯®³¬ª
3535
± 2 
+01!"#"$%& '&()*+ +&,-&./&&
2&34&'&561786&90::2;& <;2;&
=>? @A=BCAD@E@CFD G@HC I CABGFJEF JK@AFBCJDA@A=BCADA@CFD
@E@CFDL
>?@A=BCAD@E@CFDMCJGKEFJNCAEFJHCODAGD=BPQDR=GJCJF@HDA
DB@=E@>SB@E@=JK SBK AFTK@F@EDJKEAJMKL
U5V W7XYZ[\ ]243Z^_`Ua

b
cDK CGJPQDJDA=DEAF@FB@EFAG@EMBdAF@=DAMCTe@=DAJF@CJJ=@KJfJAA@EJGJ
Je@CKJF@HJ=DCCFJL
ghijklminiopiqrqpstuivtmluiwqijqrjuixmllmjkyuzi{|i}oqimslq~qxjmiopmi~q}oxvkmi
vluxut€kvmiwqim‚ƒq~„…
†5V W‡1ˆ‰ŠZ123332‹8Œ 
Z^_`Ža
b‘’“”••’‘b”–—”‘‘˜b•”™b–š›”‘’œb–™›˜b•”–˜b˜‘˜bž™”b˜b›™Ÿ”‘b•”b˜‘”••” b
¡›”¢b–’••’b”–£‘”£¤›œb›’–•¢”™‘œb•¥bŸ˜›”–£’b–¦’b’§”‘b        b˜‘˜b’b¨˜–£˜‘ b
©’—ªb£˜›«¤›b¤b•”›‘”b«”›¬­¢–§˜œb®˜‘›¢–˜œb–”›bž™”b•”¨˜b˜”–˜•b˜‘˜b
«‘¢–—˜‘b—’›b˜b¯¢˜“ b©’™b        œb§¢°b¡––”b”–±™²˜–§’b˜•b›¦’•b–™›b˜–’b§”b
‘˜£’ b³”b‘””–£”œb§´b™›b•™•¢‘’b—™‘£’b”b™›b•˜Ÿ£¢£’b¨™­”–¢Ÿµb™›b›’›”–£’œb
›’–•¢”™‘b¶’ŸŸ˜–§”‘ b·¢‘˜b§˜b²”Ÿ˜§”¢‘˜b™›b‘’—˜›«’Ÿ”b—”¢‘˜–§’b˜b›˜¸¦b”b
•”˜‘˜b™›˜b“˜£¢˜b–™›b‘˜£’b§”b•’«‘”›”•˜µb’b•”–’‘b§¢••”bž™”b•”™b˜¢b›’‘’™b
–˜b¡Ÿ”›˜–˜¹bº–£‘”²˜¬›”b’b‘˜£¢–’b—’«”‘£’b—’›b™›b˜”Ÿb§”b¦’µb¤b™›˜b
‘”—”¢£˜b§˜b›¢–˜b˜­¥b˜Ÿ•˜—¢˜–˜œb”Ÿ”b­˜¢b²’•£˜‘ b        b”›b§¢‘”¸¦’b»b•˜Ÿ˜œb’–§”b
˜b¼¢–’—˜b«‘¢–—˜b›˜¢•b™›˜b­”°b—’›b˜b¯¢˜“ b¶”–‘¢b½”˜™‘”²˜‘§b“”—˜b’b¢˜–’b”b
•”b‘”“™²¢˜b–™›b«˜–”¢‘’ b¡¢–§˜b‘’—™‘’b‘’£”Ÿ˜‘b’b˜§”™•œb˜Ÿ¢•˜–§’b’b¢˜–’b”b
£”—”–§’b”Ÿ’²¢’•b˜’b•”™b§”•¢²–b˜‘£b§¤—’œbž™˜–§’b”•—™£’b’b‘™¾§’b§˜b—˜­”b–˜b
“”—˜§™‘˜b”b­”¨’b˜b›˜¸˜–”£˜b²¢‘˜‘b•’°¢–˜ b¯˜‘˜Ÿ¢•˜§’b§”“‘’–£”b§˜b’‘£˜b’‘b
’–§”b”–£‘˜‘´b›”™b¢‘›¦’b˜Ÿ”›¦’œb‘”˜••’b–˜b›”›¥‘¢˜b˜•b¢§”¢˜•b›˜¢•b
“˜–£˜•¢’•˜•bž™”b“¢°b§”Ÿ”œb§”•§”bž™”b•’™«”b§˜b•™˜b”±¢•£ª–—¢˜ b¿”—’‘§’bž™˜–£˜•b
­”°”•b•’–”¢b—’›b”Ÿ”œb˜b—˜§˜b•’–’b—’›b™›˜b—˜‘˜b§¢“”‘”–£”œb—˜‘˜•bž™”b”‘˜›b
£‘˜–•“¢²™‘˜§˜•b”Ÿ’b˜ž™´‘¢’b§’b•’–’œb•”‘”•bž™”b˜bŸ™°b§˜b›˜–¦b§”•­˜–”—¢˜œb
§™‘˜–£”b’•b˜–’•b”›bž™”b˜–•¢”¢b’‘b”•£”b”–—’–£‘’ bºb˜²’‘˜b¨´b–¦’bž™”‘’bž™”b˜b
’‘£˜b•”b˜«‘˜œb’‘b›¢›b˜ž™”Ÿ˜b›˜¸˜–”£˜b’§”‘¢˜b²¢‘˜‘b”‘”£™˜›”–£” b¯‘”“¢‘’b
—’–£¢–™˜‘b˜b­”‘b›”™b¢‘›¦’b”›b•’–’•œb—’›b•™˜b—˜‘˜b˜¢–§˜b•”›b˜—˜«˜›”–£’ b
¯”–•’bž™”b­ª¬Ÿ’b˜••¢›b»bž™”¢›˜¬‘’™˜œb—’›b”±—”••¢­˜b–¢£¢§”°œb•”‘´b—’›’b­”‘b
”•—˜–—˜‘˜§˜b–™›˜b£”Ÿ˜b§”b—¢–”›˜b˜b”‘•’–˜²”›b§”b™›b‘’›˜–—”bž™”b”™b­¢–˜b
˜§¢­¢–˜–§’b“¢’b˜b“¢’b»b›”§¢§˜bž™”bŸ¢˜ bÀ”b™§”••”œb”™b”§¢‘¢˜b˜’b›”™b¢‘›¦’b
ž™”b›”b”•”‘˜••”bŸ´b“’‘˜œb˜‘˜b•”‘b§”b–’­’b’b­™Ÿ£’b–’£™‘–’bž™”b˜”–˜•b”–£‘”­¢ b
¼˜•b˜b’‘£˜b‘˜–²”œb˜b›˜¸˜–”£˜b§”•“˜°b•”™b²¢‘’œb”b’bž™”b£”–’b§¢˜–£”b§”b›¢›b
–¦’b’§”b•”‘b›”™b¢‘›¦’b˜Ÿ”›¦’ bÁb™›b’›”›b§˜b›¢–˜b¢§˜§”œb—’›b˜b”Ÿ”b
«‘˜–—˜b›”¢’b”•—˜›˜§˜œb’b–˜‘¢°b˜§™–—’b§”b¶”–‘¢b”b™›˜b—˜Ÿ­¾—¢”b‘”—’—” bÁb
•¢–—”‘˜›”–£”b™›b£¢’b«˜–˜Ÿœb§”••”•bž™”b˜b›”›¥‘¢˜b–¦’b“¢±˜œbž™”b–¦’b
12345789
8 3ÂÃÄ Ä5
Å ÄÆÆÇÄÃ8