Você está na página 1de 129

i

Miguel Augusto Golono

Variantes moleculares do vrus influenza

So Paulo
2004

ii

Miguel Augusto Golono

Variantes moleculares do vrus influenza

So Paulo
2004

iii

Miguel Augusto Golono

Variantes moleculares do vrus influenza

Dissertao
apresentada
ao
Instituto de Biocincias da
Universidade de So Paulo, para a
obteno de Ttulo de Mestre em
Cincias,
na
rea
de
Biologia/Gentica.
Orientador: Prof. Dr Willy Beak.
So Paulo
2004

iv

Golono, Miguel
Variantes moleculares do vrus
influenza
129 pginas
Dissertao (Mestrado) - Instituto de
Biocincias da Universidade de So Paulo.
Departamento de Biologia/Gentica.
1. Influenza 2. Hemaglutinina 3.

Drift
I. Universidade de So Paulo. Instituto de
Biocincias. Departamento de
Biologia/Gentica.

Comisso Julgadora:
________________________

_______________________

Prof(a). Dr(a).

Prof(a). Dr(a).

________________________

_______________________

Prof(a). Dr(a).

Prof(a). Dr(a).

______________________
Prof. Dr. Willy beak
Orientador

Dedico esta dissertaao aos meus pais:


Edson Domingos Golono e Vera Lcia da
Silva Golono
A minha esposa: Iris Melina Politi Soza
E as minhas filhas: Amarillyz e Izabella
Politi Golono

vi

"Arrebentaram a porta. Derrubaram a porta.


Chegaram ao lugar luminoso
onde a verdade esplendia os seus fogos.
Era dividida em duas metades
diferentes uma da outra.
Chegou-se a discutir qual a metade mais bela.
Nenhuma das duas era perfeitamente bela.
E era preciso optar. Cada um optou
conforme seu capricho, sua iluso, sua miopia."
Carlos Drummond de Andrade.

vii

Agradecimentos
Agradeo meu orientador Prof. Dr. Willy Beak pela confiana em mim
depositada e por seu esforo dedicado a esta dissertao.
Ao Prof. Dr. Edison Luiz Durigon do Laboratrio de Virologia do ICB USP, por abrir as portas de seu laboratrio assim como propiciado os meios
para a concluso desta dissertao.
Ao Mrio Gustavo Mayer por toda ajuda na metodologia e no
delineamento a este projeto.
A Dra. Maria Luiza Beak, pelo incentivo e ajuda para o trmino deste
trabalho de mestrado.
A Danielle Bruna Leal de Oliveira, por ter dedicado seu tempo para
meu treinamento em seqenciamento e para as anlises de seqncias.
Ao Dr. Marcelo Genofre Vallada, pela seleo dos pacintes e coleta
das amostras no Instituto da Criana da FMUSP.
Ao Alexandre Pereira pelo acompanhamento deste trabalho.
A Dra Viviane Botosso por todas as sugestes dadas para a concluso
deste trabalho.
A Dra Rita de Cassia Stocco dos Santos por todo apoio e ajuda
dispensada a mim.
A Leonardo Setsuo Kobashi pela ajuda na finalizao do trabalho.
Aos amigos do Laboratrio de Virologia, em especial para Jansen de
Arajo pelo apoio nos experimentos de concluso desta Dissertao.
A Nair Aparecida da Silva Pereira, pelo apoio prestado durante a
execuo deste trabalho e pelo incentivo dado em todos os momentos.

viii

A Antnio Carlos de Freitas tambm pelo apoio e incentivo.


Aos amigos e tambm alunos do laboratrio de gentica: Marcelo M.
Tavares, Luis G. B. Goes, Luciana S. Cabral, Gil R. H. Ribeiro, Rodrigo F.
Ramalho, Guilherme Francisco, Juliana S. Capitanio, Adriana M. Orimoto e
Daniela C. C. Santos.
Em especial a Olga Brunner pelo convvio desde o incio, mesmo antes
de eu ser aluno do curso de mestrado.
Aos fncionrios e tambm amigos do laboratrio de Gentica do
Instituto Butantan; Zenaide L. Silva, Vera L. A. Rodrigues, Tnia R. Berulis,
Ivone S. dos Santos, Laerte P. do Santos, Ronaldo Dias, Helir Serralvo.
Aos funcionrios da Ps-Graduao por toda ajuda dispensada.

ix

ndice

I - Introduo...................................................................................................01
II - Objetivos....................................................................................................18
III - Materiais e Mtodos
1.Amostras.............................................................................................19
2.Extrao de RNA................................................................................19
3. Obteno de cDNAs por transcrio reversa.....................................20
4. Reao em Cadeia pela Polimerase -Nested Multiplex PCR.........21
4.1. Oligonucleotdeos Iniciadores (primers)..............................21
4.2. Reaes.................................................................................23
4.3. Anlise dos Produtos Amplificados......................................25
5. Reaes de Semi-Nested PCR e Nested-PCR".............................25
5.1. Oligonucleotdeos iniciadores..............................................25
5.2. Reaes.................................................................................30
5.3. Anlise dos Produtos Amplificados......................................32
6. Determinao da seqncia de nucleotdeos......................................32
6.1. Purificao dos Produtos de PCR.........................................33
6.2. Reao de determinao de Seqncias de nucleotdeos......33
7. Edio e Anlise das Seqncias Obtidas..........................................35
8. Localizao das diferenas na estrutura da hemaglutinina................35
9. rvore genealgica............................................................................36

IV - Resultados.................................................................................................37
1. Deteco, tipagem e subtipagem das amostras clnicas.....................37
2. Obteno da regio codificadora completa de HA1..........................40
3. Nested e Semi-nested PCR................................................................40
4. Seqncias de aminocidos de HA1 das amostras estudadas:
anlise comparativa das amostras entre si e com as cepas vacinais...42
4.1. Tipo A Subtipo H1N1...........................................................42
4.2. Tipo A Subtipo H3N2...........................................................49
4.3. Tipo B...................................................................................59
4.4. Pesquisa das seqncias de nucleotdeos no "Genbank"......63
4.5. Pesquisa no "Genbank" das seqncias de A H1N1.............64
4.6. Pesquisa no "Genbank" das seqncias de A H3N2.............65
4.7. Pesquisa no "Genbank" das seqncias de vrus do tipo B..66
4.8. rvore Genealgica..............................................................66
V - Discusso...................................................................................................70
VI - Concluso.................................................................................................81
VII - Resumo....................................................................................................82
VIII - Abstract..................................................................................................83
IX - Apndice 1. Dados gerais dos pacientes..................................................84
X - Apndice 2. Distribuio das amostras.....................................................93
XI - Referncias Bibliogrficas........................................................................97
XII - Biografia................................................................................................119

I - Introduo
A gripe uma doena respiratria aguda em seres humanos e
causada pelo vrus da influenza. Anualmente mais de 10% da populao
mundial, cerca de 600 milhes de pessoas so acometidas pelo vrus da
gripe (Gerdil, 2003). Somente nos Estados Unidos, a doena causa cerca
de 110.000 hospitalizaes com 36.000 mortes todos os anos (Thompson
e col., 2003). Idosos com idade igual ou superior a 65 anos constituem o
grupo de maior risco de morte por influenza. Cerca de 90% das mortes
causadas pela gripe ocorre nessa faixa etria (Simonsen, 1999). A doena
afeta tambm a classe economicamente ativa, o que causa queda de
produtividade e, conseqentemente prejuzos financeiros (Akazawa e
col., 2003).
A sintomatologia clssica da doena engloba febre, dores
musculares, tosse, dor de cabea, irritao na garganta e secrees nasais.
Os vrus se multiplicam no epitlio ciliado das vias respiratrias
superiores e inferiores, causando necrose celular e irritao. Os sintomas
podem variar de pessoa para pessoa, dependendo da idade do doente, de
seu estado geral de sade e, do status imunolgico no que se refere a
infeces anteriores, podendo evoluir para complicaes como
pneumonia causada pela propagao viral no epitlio alveolar e/ou
pneumonia bacteriana (WHO Fact Sheet 211, 1999).
A famlia Ortomixoviridae composta de 4 gneros: Influenza
virus A, Influenza virus B, Influenza virus C e Thogotovirus (Pringle,
1996). Os vrus influenza tipo A e B causam um largo espectro de
doenas, incluindo doena respiratria do trato inferior, pneumonia e,
podendo no caso dos vrus influenza tipo A, causar encefalopatia e
encefalite. Por outro lado, infeces associadas ao vrus tipo C so
limitadas ao trato respiratrio superior (Murphy e Webster, 1990,

Nicholson, 1998). Os thogotovirus so ortomixovirus transmitidos por


carrapatos.
Os vrus influenza do tipo A e B quando adaptados a condies
laboratoriais, assumem forma esfrica com dimetros de 80 a 120 nm. No
entanto, as cepas recm isoladas so pleiomrficas, podendo conter
partculas virais filamentosas (Lamb e Choppin, 1983, Roberts e
Compans, 1998). O genoma viral composto por segmentos de RNA de
fita simples e de polaridade negativa (complementar ao RNA
mensageiro). Cada um dos oito segmentos dos vrus influenza tipo A e B
e, os sete segmentos do vrus influenza tipo C esto associados
nucleoprotena NP (Mcgeoch e col., 1976, Desselberger e col., 1980,
Klumpp e col., 1997) e esto associados a um complexo de polimerase
viral (Brown, 2000). Assim, forma-se um complexo ribonucleoprotico
composto por RNA viral (vRNA), NP e polimerase.
Englobando estas oito (ou sete) partculas, h uma matriz protica
constituda por protena M1, a qual envolvida por uma bicamada
lipdica derivada da clula hospedeira durante o processo de brotamento
(Kates e col., 1962, Lamb e Choppin, 1983, Braakman e Anken, 2000).
Duas glicoprotenas de superfcie, codificadas pelo genoma viral,
projetam-se atravs da bicamada lipdica. Dessas, a glicoprotena
hemaglutinina (HA) a mais abundante e, apresenta-se na forma de
basto. J a neuraminidase (NA), presente em menores quantidades,
apresenta-se na forma de cogumelo. Ainda, uma terceira protena,
formadora de canais e denominada de M2, encontra-se inserida na
bicamada lipdica (Zebedee e Lamb, 1988, Park e col., 1998, Mould e
col., 2000).
Quanto capacidade codificadora dos genomas dos vrus
influenza, podemos dizer que os genomas dos vrus do tipo A e B
codificam pelo menos dez protenas, enquanto o genoma do tipo C

codifica nove protenas (Neumann e col., 2000a) (tabela 1).


Tabela 1. Organizao do genoma do vrus da influenza.
Tamanho
*a

Segmento

*b

RNA viral

*b

RNAm

Polipeptdios Codificados
Tipo A

Tipo B

Tipo C

2341

2320

PB2

PB1

*c

P1

2341

2320

PB1

PB2

*c

P2

2233

2210

PA

PA

*c

P3

1778

1756

HA

HA

*d

HE

1565

1539

NP

NP

NP

1413

1391

NA

NA, NB

M1, CM2

1027

M1, BM2

NS1, NS2*e

890

NS1, NS2*e

*f

1004, 314, 275 M1, M2 (M3)


868, 396

NS1, NS2*e

*a - Os segmentos de RNA so numerados de acordo com seus tamanhos decrescentes.


*b - O tamanho dos RNAs mensageiros baseado em seqncias de cepas tipo A, no
entanto pode variar entre os tipos e subtipos, especialmente os segmentos 4, 6 e 8.
*c - As funes detalhadas das protenas que compem a polimerase dos vrus
influenza tipo C, ainda no foram determinadas e so designadas de P1, P2 e P3.
*d Hemaglutinina esterase (HE) compreende as funes de HA e NA.
*e Recentemente, NS2 recebeu o nome de NEP (nuclear export protein). estrutural.
*f Ao vrus influenza tipo C possuem apenas 7 segmentos.

No vrus tipo A, os segmentos 1, 2 e 3 codificam as protenas


PB2, PB1 e PA respectivamente. No vrus tipo B os segmentos 1, 2 e 3
codificam respectivamente as protenas PB1 , PB2 e PA. Estas protenas
compem a polimerase viral, possuem atividade de transcriptase, e esto
intimamente associadas ao RNA genmico do vrus. A estrutura e funo
das polimerases do vrus tipo C ainda no foram totalmente
caracterizadas e, assim, so designadas por P1, P2 e P3 (Yamashita e col.,

1989, Hay, 1998, Crescenzo-Chaigne e col., 1999). No entanto, admite-se


que essas ltimas possuam caractersticas estruturais e funcionais
semelhantes s correlatas dos vrus tipo A e B.
O segmento 4 codifica a hemaglutinina (HA). A HA a
glicoprotena de superfcie viral mais imunognica. O processamento pstraduo de seu precursor biossinttico (Ha0) envolve glicosilao, adio
de cidos graxos e clivagem proteoltica. A clivagem deste precursor
resulta em duas subunidades, HA1 e HA2, as quais permanecem unidas
por ligaes dissulfeto (Wiley e Skehel, 1987, Skehel e Wiley, 2002). A
subunidade HA1, correspondente extremidade N-terminal do precursor,
projeta-se para fora do envelope viral. J a subunidade HA2 permanece
ancorada no interior do envelope viral. Tal processamento proteoltico
essencial para que os vrus tornem-se infectantes (Lamb, 1989, Skehel e
Wiley, 2002). A HA de importncia fundamental na interao da
partcula viral com a clula hospedeira. Esta glicoprotena, pela sua
regio HA1, liga-se ao receptor de cido silico existente na superfcie
celular (Zhirnov e col., 2002). Assim, a HA inicia o processo de infeco
mediando a fuso da partcula viral endocitada com a membrana
endossmica, permitindo o acesso da partcula viral ao citoplasma celular
(Lamb, 1989, Skehel e Wiley, 2002). Contrastando com os vrus
influenza tipo A e B, o segmento 4 do vrus influenza tipo C codifica a
hemaglutinina esterase (HE), uma glicoprotena de superfcie que executa
de forma acoplada as funes de HA e NA. HE reconhece
especificamente apenas um tipo de cido silico modificado, o cido 9O-acetil-N-acetilneuramnico (Rogers e col., 1986, Skehel e Wiley,
2000), o que est relacionado com a menor patogenicidade dos vrus
influenza tipo C.
A nucleoprotena NP codificada pelo segmento 5. A NP
sintetizada em abundncia nas clulas infectadas e transportada para o

ncleo celular. No ncleo, a NP liga-se ao RNA viral e o encapsida,


estabilizando-o e protegendo-o da ao de RNases. (Compans e
Duesberg, 1972; Jennings e col., 1983, Mena e col., 1999). A NP dos
vrus influenza tipo B no relacionada imunologicamente NP dos
vrus influenza tipo A, desempenhando, no entanto, a mesma funo. A
NP uma das protenas utilizadas na diferenciao dos tipos sorolgicos
A, B e C (Lamb, 1989).
A neuraminidase (NA) codificada pelo segmento 6. Na sua
forma madura, a NA um tetrmero com atividade cataltica de quebra de
cido silico em glicoconjugados (Colman, 1998). A NA tem a funo de
facilitar o acesso da partcula viral superfcie das clulas alvo, atravs
da degradao de cido silico do muco extracelular, no estando
envolvida diretamente na fuso da partcula viral com a membrana celular
(Liu e col., 1995). Alm dessa funo, a atividade de NA destri os
receptores de HA na superfcie das clulas hospedeiras, facilitando a
disperso das partculas virais geradas no processo infectivo, impedindoas de serem imobilizadas na superfcie das clulas infectadas (Palese e
Compans, 1976, Yang e col, 1997). Essa glicoprotena est ancorada
bicamada lipdica da clula hospedeira por uma seqncia de resduos
hidrofbicos. A neuraminidase concentra-se em aglomerados na
superfcie viral, contrastando com a distribuio uniforme de HA. No
vrus influenza tipo B, uma glicoprotena adicional codificada pelo
segmento 6. Essa glicoprotena foi denominada NB, sendo codificada por
uma fase de leitura distinta da fase de leitura de NA. NB, assim como
NA, uma protena de membrana, inserida no envelope viral (Betakova e
col., 1996; Brassard e col., 1996). Devido atividade formadora de canal
dessa glicoprotena, atribui-se a ela uma funo anloga da protena M2
(Odagiri e col., 1999, Fischer e col., 2000, Hatta e Kawaoka, 2003).
O segmento nmero 7 dos vrus influenza tipo A codifica as

protenas M1, M2 e potencialmente um peptdeo M3. Estas protenas,


juntamente com a NP, so utilizadas para a tipagem sorolgica dos tipos
virais. M1 faz parte da matriz protica, a qual forma uma camada
eltrondensa logo abaixo do envelope viral e, a protena mais abundante
no vrion (Brown, 2000). J, M2 expressa em abundncia na superfcie
da clula hospedeira, no entanto, detectada em pequenas quantidades no
vrion (Hilleman, 2002). Ainda, um terceiro transcrito foi identificado
com o potencial de codificar um peptdeo constitudo de 9 resduos de
aminocidos (M3), no entanto, ainda no foi possvel a identificao
desse peptdeo em extratos celulares. O segmento 7 dos vrus tipo B
codifica uma protena M1 com semelhana estrutural e funcional
protena M1 dos vrus influenza tipo A. Alm da protena M1, o
segmento 7 dos vrus tipo B codificam um segundo polipeptdio
denominado BM2 (Odagiri e col., 1999). BM2 uma protena de
membrana. Estudos recentes indicam que BM2 uma protena formadora
de canais inicos, e assim como M2, tem a funo de acidificar o interior
dos vrions quando esses se encontram nos endossomos celulares,
enfraquecendo as ligaes entre as protenas virais, tais como M1 e NP, e
favorecendo o "desempacotamento" viral (Paterson e col., 2003, Mould e
col., 2003, Watanabe e col., 2003). O segmento 6 da influenza tipo C
codifica a protena de matriz M1 e uma protena integral de membrana
denominada CM2. Apesar da funo de CM2 no ser conhecida, sua
similaridade estrutural M2 dos vrus tipo A sugere uma funo anloga
(Hongo e col., 1997, Pekosz e Lamb, 1997, Pekosz e Lamb, 1998, Tada e
col., 1998).
Duas protenas no estruturais, NS1 e NS2, so codificadas pelo
segmento 8 (vrus tipo A e B) ou segmento 7 (vrus tipo C).
Recentemente, foi detectada a presena de NS2 em partculas virais, e
com isso NS2 foi elevada categoria de protena estrutural. Diferente da

NS2, a NS1 no incorporada aos vrions e encontrada apenas em


clulas infectadas. Em sua forma madura, NS1 se apresenta como
homodmero, tanto para os vrus tipo A como para os vrus tipo B. No
entanto a ao de NS1 difere entre os dois tipos de vrus. A NS1
produzida pelos vrus influenza tipo A (NS1A) inibidora do
processamento ps-transcricional de RNAm celular, com isso NS1A
impede a sntese de protenas antivirais (Chen e Krug, 2000). Por outro
lado, NS1B que produzida pelos vrus tipo B, atua diretamente na
inibio da protena celular antiviral ISG15 (Chen e col., 1999, Krug e
col., 2003). Aparentemente, NS1 tambm possui a capacidade de
estimular a traduo dos RNAm virais em ambos os tipos virais (Wolff e
col., 1996, Egorov e col.,1998). A NS2 foi rebatizada de NEP ("nuclear
export protein") devido demonstrao de que NS2 (NEP) na realidade
uma protena estrutural. Alm da funo estrutural, NS2 ou NEP tem a
funo de mediar a exportao nuclear dos RNAs do vrion, atuando
como adaptadora entre os complexos ribonucleoproticos virais e a
maquinaria de exportao nuclear da clula (ONeill e col., 1998,
Neumann e Col., 2000, Paragas e col., 2001, Lommer e Lou, 2002).
A influenza transmitida por aerossis. Quando as gotculas
contendo os vrus so inaladas, esses entram em contato com o epitlio do
trato respiratrio, sendo esse o tecido primrio alvo para os vrus
influenza (Lindsay e col.,1970, Nicholson, 1998). A glicoprotena de
superfcie NA uma enzima que age nos cidos silicos do muco
facilitando o acesso do vrus para que haja contato direto com a
membrana celular. As partculas virais, atravs da HA ativada, ligam-se a
receptores de cido silico presentes em glicoprotenas e glicolipdios da
superfcie celular. Aps essa ligao, o vrion endocitado pela clula. O
pH baixo da vescula endoctica induz mudanas conformacionais na HA
facilitando sua insero na membrana vesicular, iniciando a fuso das

membranas viral e vesicular (Isin e col., 2002, Epand e Epand, 2003). Os


nucleocapsdeos virais migram para o ncleo da clula hospedeira e, as
protenas com atividade de polimerase iniciam a transcrio dos RNAs do
vrion (vRNAs) em RNAs mensageiros (mRNAs) (Yewdell e GarcaSastre, 2002).
A sntese de mRNA do vrus influenza iniciada por fragmentos
de RNAs celulares recm sintetizados pela RNA polimerase II da clula
hospedeira, os quais j possuem a modificao cap (m7GPPPNm) nas
suas extremidades 5. A partir desses iniciadores de transcrio, as
cadeias de mRNA so elongadas pela transcriptase viral at que esta
atinja uma regio terminadora composta por uma seqncia de 5 a 7
nucleotdeos de uridina localizada aproximadamente a 16 nucleotdeos da
extremidade 5 do vRNA molde. Nesse ponto da sntese, adicionada
uma cauda de poliadenilato [poli (A)] extremidade 3 do mRNA (Krug,
1981, Chung e col., 1994, Pritlove e col., 1998, Fodor e col., 2000,
Fechter e col., 2003). Participam do processo de transcrio, compondo o
complexo da transcriptase viral, as protenas PB1, PB2 e PA.

polimerase PB2 atua no reconhecimento e quebra das extremidades 5


modificadas dos mRNAs celulares e, portanto inicia o processo de
transcrio (Ulmanem e col., 1981; Braam e col., 1983, Nakagawa e col.,
1995, Perales e Ortn, 1997, Brown e Bailly, 1999, Hiromoto e col.,
2000a). A polimerase PB1 responsvel pelo processo de elongao do
mRNA viral (Lazarev e col., 1999, Perez e Donis, 2001). A funo da
polimerase PA na transcrio primria ainda no conhecida, no entanto
este polipeptdio necessrio para a transcrio e replicao do vRNA
(Nakagawa e col., 1996, Sanz-Ezquerro e col., 1998, Fodor e col., 2003,
Huarte e col., 2003).
Os transcritos produzidos so utilizados na traduo das protenas
virais. No incio da infeco predominam as snteses de NP e NS1,

protenas essas que migram para o ncleo. Acredita-se que o aumento da


concentrao de NP livre dispare a mudana da sntese de mRNA
(transcrio) para a sntese de cRNA e vRNA (replicao) (Skehel, 1972;
Hay e col., 1977; Smith e Hay, 1982; Shapiro e col., 1987, Arrese e
Portela, 1996, Mena e col., 1999, Medcalf e col., 1999).
A replicao feita atravs de um processo de transcrio
alternativo, que resulta na produo de cpias integrais de vRNAs. A
replicao iniciada pela sntese de um RNAs complementares (cRNA),
os quais diferem dos mRNAs pelas ausncias das modificaes 5 cap
metiladas e caudas de poli A 3 (Hay e col.,1977; Hay e col., 1982).
Assim, a primeira etapa na replicao dos vRNAs seria a mudana de
sntese de mRNA para sntese de cRNA. Os requisitos para esta mudana
so: (1) a mudana do processo de iniciao de transcrio, o qual era
dependente de iniciadores 5 "capped", para um processo de iniciao
que no requer iniciadores e; (2)

antiterminao no stio de

poliadenilao, permitindo que a transcrio de cRNA gere uma cpia


completa do vRNA (Pritlove e col., 1998). Acredita-se que NP tenha
papel fundamental na mudana de sntese de mRNA para cRNA, como
descrito acima. Finalizando o processo de replicao,

molculas de

cRNA atuam como molde para a sntese do vRNA genmico (Honda e


col., 2001).
Os vRNAs recm-sintetizados so encapsidados pela NP no
interior do ncleo e, funcionam como moldes para a transcrio de
mRNAs virais da infeco tardia (Biswas e col., 1998, Hoffmann e
Webster, 2000). Os principais produtos de traduo nesta etapa da
infeco so as protenas M1, HA e NA. HA e NA so processadas aps a
traduo no retculo endoplasmtico rugoso e, transportadas para a
superfcie celular apical via complexo de Golgi (Barman e col., 2001). A
entrada da protena M1 no ncleo celular parece estar associada com a

10

migrao de nucleocapsdeos para fora do ncleo, culminando com a


montagem das partculas virais no citoplasma (Martin e Helenius, 1991,
Ali e col., 2000). Pouco se sabe a respeito do processo de montagem dos
vrus da influenza. Acredita-se que nucleocapsdeos envolvidos por uma
cpsula de protena M1 migrem para a face interna da membrana
plasmtica, para onde j foram transportadas as glicoprotenas HA, NA e
M2. Foi proposto que a interao de M1 com os domnios citoplasmticos
dessas 3 glicoprotenas sinalize o processo de brotamento (Elster e col.,
1994, Reinhardt e Wolff, 2000, Hilleman, 2002). A atividade de NA na
superfcie da clula infectada destri o receptor de HA, permitindo que as
partculas virais geradas sejam propagadas e, evitando a adsoro destas
partculas mesma clula (Palese e Compans, 1976, Mitnaul e col., 2000,
Wagner e col., 2000, Plakokefalos e col., 2001). O passo final na
maturao dos vrus a clivagem de HA0 em HA1 e HA2 por proteases
extracelulares do hospedeiro. As duas subunidades geradas, HA1 e HA2,
permanecem ligadas por uma nica ponte dissulfeto (Wiley e Skehel,
1987, Klenk e col., 2002, Zhirnov e col., 2002).
Os vrus influenza tipo A so classificados de acordo com as
propriedades de duas glicoprotenas presentes na superfcie viral, HA e
NA. At o presente momento foram descritos 15 subtipos de HA,
denominados de H1, H2, H3 e assim sucessivamente (Webster e col.,
1997). Estes, diferem entre si pela seqncia polipeptdica de HA1 em no
mnimo 30%, e no possuem sorologia cruzada. Cada subtipo pode ser
composto de variantes semelhantes entre si e, que possuem sorologia
parcialmente cruzada (Webster e col., 1992; Ellis e col., 1997). Dos 15
subtipos de HA descritos at hoje, 6 subtipos (H1, H2, H3, H5, H7 e H9)
foram encontrados em isolados da influenza humana, no entanto,
atualmente os subtipos H1 e H3 so aqueles que esto em circulao na
populao humana (Webster e col., 1997; Subbarao e col., 1998; Peiris e

11

col., 1999; Fouchier e col., 2004). Outros subtipos de HA foram


encontrados em vrus da influenza

de cavalos, porcos e mamferos

aquticos entre outros. Todos os subtipos de HA foram encontrados em


vrus influenza de aves.
Nove subtipos (N1 a N9) foram descritos para neuraminidase. A
influenza A humana e a influenza suna compartilham entre si os subtipos
N1 e N2 e, apesar de outros subtipos de NA terem sido encontrados em
sunos, somente N1 e N2 foram estabelecidos nessa populao. Outros
subtipos so encontrados em cavalos, mamferos aquticos alm de outros
mamferos. Nos vrus da influenza aviria foram encontrados todos os
subtipos de NA (Webster e col., 1997, Webby e Webster 2001). Os
isolados de influenza tipo A so denominados pelos subtipos de HA e NA
que possuem, o local e o ano da coleta [por ex. A/Hong Kong/03/68
(H3N2)]. Os tipos B e C so denominados geralmente pelo local da coleta
e ano (por ex. B/Maryland/59).
As aves aquticas so os reservatrios naturais dos vrus tipo A.
Estudos ecolgicos levaram a hiptese de que todos os vrus da influenza
de mamferos so derivados dos reservatrios avirios (Webster e col.,
1992). Mais recentemente, estudos filogenticos realizados a partir das
seqncias de nucleotdeos dos vrus tipo A de vrios hospedeiros, de
diferentes regies geogrficas, pertencentes a diferentes subtipos deram
suporte a essa teoria (Webster e col., 1992, Capua e Alexander, 2002).
A gripe usualmente ocorre em epidemias com rpida expanso
geogrfica, surgindo em focos e, podendo atingir propores mundiais,
quando so ento denominadas pandemias (Bridges e col., 2003).
Associado s epidemias, h um aumento na taxa de morbidade e
mortalidade. At o momento ocorreram cerca de 10 pandemias nos
ltimos 200 anos, dentre as quais, a pandemia de 1918-20, tambm
denominada gripe espanhola, cujo agente etiolgico foi um vrus tipo A

12

subtipo H1N1. As estimativas iniciais calculavam que mais de 20 milhes


de pessoas foram a bito em conseqncia dessa infeco. No entanto,
devido falta de registros em muitos pases durante a gripe espanhola,
estima-se atualmente que o nmero de mortes foi da ordem de 40 ou 50
milhes de pessoas em todo o mundo (Kuszewski e Brydak, 2000, Potter,
2001). O subtipo H1N1 foi relacionado a cepas de influenza suna, o que
estabeleceu uma ligao entre influenza enzotica e influenza humana
(Reid e col, 2000).
A pandemia de 1957 (gripe asitica), causada pela influenza A
do subtipo H2N2, e a pandemia de 1968 (gripe de Hong - Kong)
causada pela influenza A do subtipo H3N2, mataram juntas mais de 1,5
milhes de pessoas. Essas pandemias causaram danos estimados de 32
bilhes de dlares economia mundial, principalmente pela perda de
produtividade, despesas com medicamentos e internaes (WHO
Influenza Fact Sheet 211, 1999). Existem evidncias de que as pandemias
de 1957 e de 1968 estivessem associadas a vrus da influenza aviria.
J em 1976, um novo subtipo de vrus influenza advindo de
porcos causaram graves quadros clnicos em seres humanos (WHO
Influenza Fact Sheet 211, 1999) e, em 1977 a linhagem H1N1 reapareceu
(gripe Russa), infectando principalmente crianas e jovens, sendo as
pessoas com mais de 50 anos pouco afetadas. Esse subtipo, ainda hoje,
est em circulao causando gripe em seres humanos (Laver e Garman,
2002, Nguyen-Van-Tam e Hampson, 2003).
Em 1997-1998, 18 pessoas foram infectadas com o vrus avirio
tipo A subtipo H5N1, na cidade de Hong Kong, onde 6 pessoas foram a
bito. O vrus H5N1 no provocou uma epidemia ou pandemia devido a
sua incapacidade de se transmitir de uma pessoa a outra (Subbarao e
col.,1998, Hatta e Kawaoka, 2002, Shortridge e col., 2003, Cox e col.,
2003). Em maro de 1999 mais um subtipo relacionado influenza

13

aviria infectou pessoas em Hong Kong. Identificado como sendo do


subtipo H9N2, causou apenas quadros brandos de gripe (Peiris e
col.,1999, Cox e Subbarao 2000). No incio de 2003, na Holanda, o
subtipo viral H7N7, que ainda no havia sido encontrado em infeco de
seres humanos, foi identificado em 89 pessoas e causou, na maioria dos
infectados, um quadro de conjuntivite. No entanto, duas pessoas
desenvolveram um quadro respiratrio com sintomatologia caracterstica
de gripe, e uma foi a bito devido a complicaes pulmonares (Fouchier e
col., 2004). Desde janeiro de 2004, a Tailndia e o Vietnam, esto
vivendo o ressurgimento do subtipo H5N1. At o dia 10 de maro j
haviam sido contabilizados 33 casos de infeco por H5N1 com 22
mortes (www.who.int/csr/disease/influenza/en).
A proteo contra os vrus influenza correlaciona com os nveis
de anticorpos anti-HA e anti-NA. Uma das caractersticas marcantes do
vrus influenza sua extensa e contnua variao antignica,
principalmente no que se refere as glicoprotenas de superfcie viral (HA
e NA). Tal caracterstica assegura a esses vrus seu sucesso
epidemiolgico e, insere a influenza no hall de doenas emergentes ou
reemergentes.
Dois mecanismos principais so responsveis pela mudana
contnua na antigenicidade dos vrus da influenza, e so denominados
shift antignico e drift antignico (Zambon, 1999).
O drift antignico uma alterao antignica gerada por
mutaes puntuais e cumulativas nos genes de HA e NA. O drift
antignico ocorre como parte da evoluo contnua dos vrus da
influenza. Esse processo gera novas linhagens de vrus capazes de escapar
neutralizao por anticorpos gerados contra linhagens que circulavam
anteriormente (Bridges e col., 2003). Epidemias anuais ou bienais
ocorrem durante o perodo intra-pandmico pois um nmero suficiente de

14

indivduos na populao suscetvel linhagem variante gerada (Lin e


col., 1999). A alterao de um nico resduo de aminocido em HA1
pode resultar em alterao estrutural, permitindo ao vrus mutante escapar
neutralizao pelos anticorpos gerados em processos infectivos
anteriores (Knossow e col., 1984, Nakajima e col., 2000). Cinco stios de
maior variabilidade no domnio globular da subunidade HA1 foram
identificados (Wiley e Skehel, 1987). Este stios, designados A, B, C, D e
E correspondem a regies expostas na superfcie de HA1, e prximas ao
stio de ligao ao receptor (Wiley e col., 1981). Variaes nesses
mesmos stios foram identificadas, quando variantes antignicos foram
gerados pelo crescimento de linhagens na presena de anticorpos
monoclonais sabidamente neutralizantes (Wiley e Skehel, 1987, Bush e
col., 1999). Assim, os stios de maior variabilidade correspondem, pelo
menos em parte, s regies de ligao dos anticorpos neutralizantes, o que
poderia explicar o escape dos variantes gerados aos anticorpos produzidos
numa infeco anterior. Estudos correlatos tambm foram realizados com
NA (Webster e col., 1987, Ferguson e col., 2003).
O shift antignico pode ser definido como o aparecimento de
um novo vrus influenza tipo A contendo um novo subtipo de HA ou HA
e NA, os quais so imunologicamente distintos dos vrus influenza
circulantes nas ltimas dcadas. O shift antignico ocorre quando
certos vrus de influenza animal, que normalmente infectam reservatrios
avirios ou sunos e, que no estejam relacionados aos vrus da influenza
que circulam no momento na populao humana, so transmitidos para o
homem. Evidncias sugerem que o aparecimento de linhagens
pandmicas podem ocorrer por dois mecanismos distintos. O primeiro
derivado da natureza segmentada do genoma dos vrus influenza e, referese ao reagrupamento dos segmentos genmicos de vrus influenza
humana e vrus influenza animal, durante a co-infeco de uma mesma

15

clula hospedeira (Cox e Subbarao, 2000). Como exemplos de shift


pode-se citar as pandemias de 1957 e 1968 (Nguyen-Van-Tam e
Hampson, 2003). A pandemia de 1957 foi gerada pela incorporao de
segmentos genmicos avirios que codificam para a HA, NA e PB1 em
vrus da influenza humana circulantes. Em 1968, os segmentos
genmicos de HA e PB1 originrios de aves foram introduzidos em vrus
da influenza humana circulantes. (Kawaoka e col., 1989; Laver e Webster
1973). O segundo mecanismo para o surgimento de linhagens pandmicas
a transmisso direta de uma linhagem animal para o homem (Cox e
Subbarao, 2000). Esse fenmeno foi observado no episdio ocorrido em
Hong-Kong, em 1997. Postula-se que, vrus da influenza aviria do
subtipo H5N1 foram transmitidos de aves migratrias para patos atravs
da contaminao da gua por fezes de aves infectadas. Dos patos os vrus
foram transmitidos para galinhas, as quais posteriormente so
comercializadas nos mercados de Hong-Kong. Durante a transmisso
entre diferentes espcies de aves os vrus agregaram a caracterstica de
serem altamente patognicos para galinhas, sendo, eventualmente,
transmitidos para humanos nos mercados de Hong-Kong (Lavanchy,
1998, Matrosovich e col., 1999, Hiromoto e col., 2000b). Apesar do
subtipo H5N1 ser altamente patognico para galinhas e humanos, nada
causa em patos e gansos (Webster, 1998).
Muitas mortes e internaes causadas pelos vrus da influenza
podem ser evitadas pela vacinao anual, especialmente em pessoas
propensas a complicaes mdicas. Nesse grupo esto as pessoas com
idade acima dos 65 anos, pessoas com doenas crnicas do corao, do
pulmo ou rins, pessoas diabticas, imunodeprimidas e pessoas com
quadros clnicos de anemia severa (WHO Weekly Epidemiological
Record, 2000, Kemble e Greenberg, 2003).
As vacinas de vrus inativados constituem o principal mtodo de

16

preveno da influenza (Palese e Garca-Sastre, 2002). O monitoramento


da antigenicidade dos vrus circulantes a cada ano necessrio para
identificao das linhagens variantes e, posterior escolha das linhagens a
serem utilizadas na composio da vacina (Rota e col., 1992, Gerdil,
2003). A eficcia da vacina em grande parte devida similaridade
antignica entre as linhagens circulantes e as da vacina (Kendal e Cox,
1985, Wood, 2002).
O monitoramento epidemiolgico da gripe uma atividade
mundial que conta atualmente com uma rede de 110 laboratrios, em 80
pases, coordenados pela Organizao Mundial da Sade (OMS). Um
comit da OMS encarrega-se de reunir os dados e recomendar a
composio

da

vacina

para

ano

seguinte

(WHO

Weekly

Epidemiological Record, 2000). A cada ano, a vacina deve conter os vrus


com tendncia a apresentar maior prevalncia. No entanto, a vacina
formulada para o hemisfrio norte nem sempre corresponde a linhagens
de vrus prevalentes em outras regies, fato esse observado em pelo
menos duas localidades do hemisfrio sul, frica do Sul (Besselaar e col.,
1996) e Argentina (Savy e col., 1999). Na frica do Sul, isolados (H3N2)
de 1993 mostraram-se antigenicamente diferentes com relao cepa
vacinal A/Beijing/353/89 recomendada pela Organizao Mundial da
Sade. Os isolados possuem 8 resduos de aminocidos de diferena,
quando comparadas suas seqncias da subunidade de HA1 com a
seqncia de HA1 de A/Beijing/353/89 (Besselaar e col., 1996). Estes
resultados mostram a necessidade da intensificao do monitoramento no
hemisfrio sul, tendo em vista a formulao coerente de uma vacina mais
adequada.
A determinao da seqncia de nucleotdeos dos genes HA e NA
a metodologia mais precisa na associao de determinados resduos de
aminocidos a um drift antignico (Rota e col., 1990, Plotkin e col.,

17

2002, Schweiger e col., 2002). A sensibilidade e especificidade da tcnica


de RT-PCR, e a determinao da seqncia de nucleotdeos dos produtos
amplificados aperfeioaram a anlise molecular das linhagens de vrus da
influenza circulantes, aprimorando a qualidade dos dados disponveis a
serem utilizados na formulao de vacinas (Smith, 2003).
Nosso trabalho est situado no mbito da monitorao de
variantes moleculares de vrus influenza tipo A, subtipos H3N2 e H1N1,
e tipo B em amostras coletadas na cidade de So Paulo, sendo relevante o
monitoramento desses variantes para a escolha das cepas vacinais.

18

II Objetivos
1) Determinar a ocorrncia dos vrus influenza tipo A, subtipos H1N1 e
H3N2, e tipo B em amostras clnicas coletadas durante os anos de
2000 e 2001, atravs da tcnica de Nested Multiplex RT-PCR,
utilizando a regio varivel da hemaglutinina viral (HA1) como base
de investigao.
2) Obteno da seqncia codificadora da regio varivel completa da
hemaglutinina dos isolados de influenza, atravs da tcnica de Nested
Multiplex RT-PCR ou Semi-nested Multiplex RT-PCR.
3) Analisar comparativamente as seqncias de aminocidos obtidas da
regio HA1 da hemaglutinina do vrus influenza tipo A, H1N1 e
H3N2, e tipo B nos anos de 2000 e 2001.
4) Localizao das diferenas detectadas na estrutura da molcula de
hemaglutinina e, verificao da incluso ou no desses pontos em
stios antignicos de alta variabilidade.
5) Analisar comparativamente as seqncias de aminocidos obtidas com
as das cepas vacinais utilizadas no hemisfrio sul por proposta da
OMS para os anos 2000 e 2001.
6) Analisar comparativamente as seqncias de nucleotdeos entre os
variantes isolados, assim como, compar-las a seqncias de
nucleotdeos presentes em bancos de dados. Elaborao de uma rvore
genealgica.

19

III - Materiais e Mtodos


1. Amostras clnicas.
Foram coletadas 148 amostras de esfregaos nasais de pacientes com
quadro clnico gripal, os quais foram atendidos, em sua maioria, no
Pronto Socorro do Instituto da Criana do Hospital das Clnicas da
Universidade de So Paulo, no decorrer dos anos de 2000 e 2001. Desse
total, 91 amostras foram coletadas de pacientes no ano de 2000, sendo 57
amostras coletadas em 2001. Esse material foi colhido durante o perodo
de maior incidncia da doena, que corresponde aos meses de maio a
outubro. Para cada paciente foi feita uma ficha clnica contendo: nmero
da amostra, data da coleta, idade do paciente, doena de base e
observaes (anexo 1).
Aps a coleta, os esfregaos foram imediatamente depositados em
2mL de PBS (0,01 M e pH7,2) estril e, transportados em gelo at o
laboratrio (Johnson, 1990). Quatro alquotas de 250 L foram retiradas
do tubo original, seguindo-se estocagem das alquotas e do material
restante a 80C, at a sua utilizao.
2. Extrao de RNA das amostras clnicas.
Alquotas de 250 L foram descongeladas. A esse volume foram
adicionados 750 L de Trizol LS (Invitrogen Life Technologies),
contendo

20g

glicognio

livre

de

RNases

(Invitrogen

Life

Technologies). A mistura foi homogeneizada, seguindo-se incubao por


5 minutos temperatura ambiente. Foram adicionados 200L de
clorofrmio (Merck) mistura e, aps homogeneizao por inverso do

20

tubo, prosseguiu-se com incubao por 3 minutos a temperatura


ambiente. A mistura foi centrifugada a 12.000 x g por 15 minutos a 4oC.
A fase aquosa foi transferida para outro tubo, e a precipitao do RNA foi
feita temperatura ambiente por 10 minutos aps a adio de 500L de
isopropanol (Merck). O precipitado foi coletado por centrifugao a
12.000 x g por 10 minutos a 4oC. O sobrenadante foi descartado, e o
precipitado foi lavado com 1 mL de etanol 75% (Synth). O RNA seco foi
dissolvido em 20 L de gua livre de RNAses.
3. Obteno de cDNAs por transcrio reversa.
Inicialmente, para a reao de transcrio reversa, 10 L do RNA
extrado de cada alquota de 250L de amostra foram desnaturados a
65oC por 5 minutos na presena de 50 ng de iniciador randmico (50
ng/L, Invitrogen Life Technologies) e 1 L de 10 mM de cada dNTP
(dATP, dGTP, dTTP e dCTP). Aps a desnaturao, a mistura foi
transferida para banho de gelo e, foram adicionados tampo para
transcrio reversa, inibidor de RNase (RNAguard, Amershan Pharmacia
Biotec Inc) e DTT para concentraes finais de 1X (50mM

Tris-HCl,

pH 8,3, 75 mM KCl, 3mM MgCl2), 1U/L e 10 mM respectivamente,


considerando-se um volume final de reao de 20 L. Seguiu-se
incubao a 25oC por 2 minutos e adio de 200 U de transcriptase
reversa Superscript II RNase H- (200 U/L, Invitrogen Life
Technologies). A incubao a 25oC foi prolongada por mais 10 minutos,
seguindo-se aumento de temperatura para 42oC pelo tempo restante da
reao, ou seja, 50 minutos. Finalmente, a enzima foi inativada por calor
a 70oC durante 15 minutos.
Para um lote de reaes um controle negativo foi realizado. Nesse
controle, o mesmo volume de gua substituiu o volume original de RNA.

21

4. Reao em Cadeia pela Polimerase -Nested Multiplex PCR.


Para a deteco, tipagem e subtipagem dos cDNAs de vrus
influenza A H1, A H3 e B foi utilizada a tcnica de Nested Multiplex
PCR previamente estabelecida (Ellis e col., 1997; Ellis e col., 1995 e
Zhang e Evans, 1991), na qual duas rodadas de amplificao so
utilizadas.
4.1. Oligonucleotdeos Iniciadores.
Para cada uma das duas rodadas de amplificao, foram utilizados
3 pares de iniciadores especficos para cada um dos segmentos de RNA
codificante da hemaglutinina dos tipos A H1, A H3 e B (tabela 2 e
figuras 1, 2 e 3). Assim, do total de 6 pares de iniciadores utilizados, 3
pares tem localizao externa e destinam-se primeira rodada de
amplificao, enquanto na segunda rodada de amplificao so utilizados
3 pares de iniciadores internos (tabela 2).

22

Tabela 2. Iniciadores utilizados na reao de Nested Multiplex PCR.


Posio da
Iniciadores*

extremidade Tamanho do
5' do

Produto (pb)

Seqncia (5

3)

iniciador**
Primeira Amplificao
AH1 A

76

AH1 FII

1090

AH3 A

174

AH3 DII

1056

BHA A

154

BHA DII

1053

cagatgcagacacaatatgt
1.015

aaaccggcaatggctccaaa
cagattgaagtgactaatgc

883

gtttctctggtacattccgc
gtgactggtgtgataccact

900

tgttttcacccatattgggc

Segunda Amplificao
AH1 B

96

AH1 EII

1039

AH3 B

348

AH3 CII

938

BHA B

196

BHA CII

962

ataggctaccatgcgaacaa
944

cttagtcctgtaaccatcct
agcaaagctttcagcaactg

591

gcttccatttggagtgatgc
cattttgcaaatctcaaagg

767

tggaggcaatctgcttcacc

O nmero romano II presente no nome dos iniciadores indica que estes so


complementares ao cDNA obtido por transcrio reversa do RNA viral. Os demais
oligonucleotdeos so complementares ao RNA viral.
** Posio da extremidade 5 do iniciador ocupada no cDNA completo (iniciadores
complementares ao RNA viral) ou, a posio onde a extremidade 5 do iniciador se associa
com o cDNA (iniciadores complementares ao cDNA).

23

4.2. Reaes.
A primeira "PCR" foi realizada num volume total de 50 L,
utilizando-se de 2 L de cDNA ou do controle negativo de transcrio
reversa e nas seguintes condies: 20 mM Tris-Cl pH 8,4, 50mM KCl,
1,5 mM MgCl2, 0,2 mM de cada dNTP, 0,1M de iniciador externo
(AH1 A, AH1 FII, AH3 A, AH3 DII, BHA A e BHA DII), 2,5 U de Taq
DNA polimerase (Invitrogen Life Technologies). As condies de
ciclagem utilizadas nessa primeira amplificao encontram-se na tabela 3.
A segunda "PCR" foi realizada partindo-se de 2 L do produto da
primeira amplificao e nas mesmas condies da primeira "PCR",
excetuando-se a concentrao dos iniciadores, a qual foi alterada para 0,5
M de cada um dos iniciadores internos (AH1 B, AH1EII, AH3 B, AH3
CII, BHA B e BHA CII). As condies de ciclagem utilizadas nessa
segunda amplificao encontram-se na tabela 4. Todas as amplificaes
foram realizadas em termociclador "Perkin Elmer Cetus DNA Thermal
Cycler", utilizando-se leo mineral (Sigma) para se impedir evaporao
dos contedos.

24

Tabela 3. Parmetros de ciclagem da primeira "PCR".


Programa de Ciclos da Primeira "PCR"
Temperatura

Tempo em

Nmero de

em oC

Minutos

Ciclos

95

Desnaturao

94

Associao

50

Extenso

72

Manuteno

Etapas

Desnaturao
inicial

35
1

Tabela 4. Parmetros de ciclagem da segunda "PCR".


Programa de Ciclos da Segunda "PCR"
Temperatura

Tempo em

Nmero de

em oC

Minutos

Ciclos

95

Desnaturao

94

Associao

60

Extenso

72

Manuteno

Etapas

Desnaturao
inicial

35
1

25

4.3. Anlise dos Produtos Amplificados


A um volume de 15L de produto da segunda amplificao foram
adicionados de 3L de corante para amostra 6X (azul de bromofenol
0,25% e Ficoll tipo 400 15%), seguindo-se anlise por eletroforese
horizontal em gel de agarose 1.2% (Invitrogen Life Technologies), em
tampo 1X TAE (40 mM Tris-acetato pH 8,0, 1 mM EDTA). Os gis
foram corados com brometo de etdio na concentrao de 0,5g/mL
(Invitrogen Life Technologies). Aps a corrida, as bandas foram
visualizadas por iluminao com luz ultravioleta e o gel fotografado.
5. Reaes de Semi-Nested PCR e Nested-PCR.
Os mesmos cDNAs positivos para os vrus influenza analisados por
Nested Multiplex PCR foram utilizados para a amplificao de
segmentos dos cDNAs que codificam a poro externa completa da
molcula da Hemaglutinina (HA1). A tcnica de "Semi-Nested PCR", foi
utilizada para a amplificao de segmentos dos cDNAs dos vrus da
influenza tipo A subtipo H1N1 e tipo B. J para os vrus do tipo A
subtipo H3N2, foi utilizada a tcnica de "Nested PCR".
5.1. Oligonucleotdeos iniciadores.
As reaes de "Semi-Nested PCR" utilizaram um par de iniciadores
externos para a primeira amplificao, sendo os iniciadores H1F e H1R
utilizados para os vrus influenza A H1N1, e os iniciadores BF e BR
utilizados para vrus influenza B. Para a segunda amplificao foram
utilizados os mesmos iniciadores externos senso (H1F e BF), no entanto

26

substituindo-se os iniciadores anti-senso utilizados na primeira reao por


iniciadores internos: H1R2 para vrus influenza A H1N1 e, BR2 para
vrus influenza B.
Para as reaes de "Nested PCR" de vrus influenza H3N2 foram
utilizados 2 pares de iniciadores, um par externo para a primeira
amplificao, H3F2 e H3R, e um par interno para a segunda
amplificao, H3F e H3R2.
A seqncia dos iniciadores H3F, H3R, H1F, H1R, BF e BR foram
descritas anteriormente (Xu e col., 1994; Xu e col., 1993; Rocha e col.,
1991) (tabela 5 e figuras 1, 2 e 3). Os demais iniciadores, H3F2 e H3R2
para o subtipo H3N2, H1R2 para o subtipo H1N1 e BR2 para o tipo B,
foram desenhados utilizando-se os programas de computador para
anlise, Oligo Tech (verso 1.0, Oligos Etc Inc e Oligo Therapeutics inc)
e DNA Sequence Search Program (verso 2.1)(tabela 5 e figuras 1, 2 e 3).

27

Tabela 5. Propriedades dos iniciadores do "Semi-Nested PCR e Nested PCR"


Posio da
Iniciador

extremidade 5
do iniciador

Tamanho do Produto
(pb)

Seqncia (5

3)

Primeiro "PCR" (iniciadores externos)


H3F2

12

H3R

1198

H1F

06

H1R
BF

1210
36

1205

gtaatcccgttaatggca
gaaggcaataattgtactac

BR

1140

1105

accagcaatagctccgaa

gggataattctattaacca
1187

atggctgcttgagtgctt
aagcaggggaaaataaaa

Segundo "PCR" (iniciadores internos)


H3F

36

H3R2

1153

1118

catctatcattcctgtc

H1R2

1122

1117

catctatcattcctgtc

BR2

1075

1040

cattggcaagcttcaaag

actatcattgctttgagc

A letra R que compe o nome do iniciador indica que ele um iniciador reverso, enquanto letra F
indica que o iniciador senso.

28

Stio de Clivagem*

cDNA

HA1

HA2

Direo de Sntese
(6)
5

H1F

(76)

(96)

H1A

3 Regio no Peptdio
traduzida
Sinal

Prod. PCR Multiplex 2

H1B

944 pb

HA1

HA2
H1EII
(1039)

H1FII H1R2
(1090) (1122)
Direo de Sntese

Produto de PCR Semi-Nested


Produto de PCR Semi-Nested
Produto de PCR Multiplex 1

1205 pares de bases


1117 pares de bases
1015 pares de

Fig. 1. Esquematizao da localizao dos iniciadores especficos para o


vrus da influenza tipo A subtipo H1N1
* Representao no cDNA do stio de clivagem da protena.

3
H1R 5
(1210)

29

Stio de Clivagem*

cDNA

HA1

Direo de Sntese
(12)
5

H3F2

(36)

Prod. PCR Multiplex 2

(174)

H3F

591 pb

(348)
H3B

H3A

3 Regio no Peptdio
traduzida
Sinal

HA2

HA2

HA1

H3CII
(938)

H3DII
(1056)

H3R
(1153)

Direo de Sntese
Produto de PCR Nested 1

1187 pares de bases

Produto de PCR Nested 2


Produto de PCR Multiplex

1118 pares de bases


883 pares de bases

Fig. 2. Esquematizao da localizao dos iniciadores especficos para o


vrus da influenza tipo A subtipo H3N2
* Representao no cDNA do stio de clivagem da protena.

H3R 5
(1198)

30

Stio de Clivagem*

cDNA

HA1

Direo de Sntese
(36)
5

PCR Multiplex 2

(154)

BF

767 pb

(196)
BHA

BHA

3 Regio no Peptdio
traduzida
Sinal

HA2

HA1

HA2
BHACII
(962)

BHADI BR2
(1053 (1075
Direo de

Produto de PCR Nested


Produto de PCR Nested
Produto de PCR Multiplex

1105 pares de bases


1040 pares de bases
900 pares de bases

Fig. 3. Esquematizao da localizao dos iniciadores especficos para o


vrus da influenza tipo B.
* Representao no cDNA do stio de clivagem da protena.

5.2. Reaes.
A primeira "PCR" foi realizada num volume total de 50 L,
utilizando-se de 2 L de cDNA positivo ou de controle negativo nos
experimentos de Nested Multiplex PCR e nas seguintes condies: 20
mM Tris-Cl pH 8,4, 50mM KCl, 1,5 mM MgCl2, 0,2 mM de cada dNTP,
0,2M de iniciador externo (H1F, H1R, H3F2, H3R, BF e BR), 2,5 U de
Taq DNA polimerase (Invitrogen Life Technologies). As condies de
ciclagem utilizadas nessa primeira amplificao encontram-se na tabela 6
para os vrus da influenza tipo A e tabela 7 para os vrus tipo B. A
segunda "PCR" foi realizada partindo-se de 1 L do produto da primeira
amplificao e nas mesmas condies da primeira "PCR", excetuando-se

BR
(1140

3
5

31

a temperatura de associao, a qual foi alterada para 55oC. As condies


utilizadas nessa segunda amplificao encontram-se nas tabelas 6 e 7.
Todas as amplificaes foram realizadas em termociclador "Perkin
Elmer Cetus DNA Thermal Cycler", utilizando-se leo mineral (Sigma)
para se impedir evaporao dos contedos.
Tabela 6 Para vrus da influenza tipo A.
Temperatura

Tempo em

Nmero de

em oC

Minutos

Ciclos

95

Desnaturao

94

Associao

53

Extenso

72

1.5

Manuteno

Etapas

Desnaturao
inicial

40
1

32

Tabela 7 Para vrus da influenza tipo B.


Programa de Ciclos do "Semi-Nested PCR"
Temperatura

Tempo em

Nmero de

em oC

Minutos

Ciclos

95

Desnaturao

94

Associao

55

Extenso

72

1.5

Manuteno

Etapas

Desnaturao
inicial

40
1

5.3. Anlise dos Produtos Amplificados.


Os produtos da segunda reao foram analisados por eletroforese
em gis de agarose exatamente da mesma maneira que os produtos de
Nested Multiplex PCR.
6. Determinao da seqncia de nucleotdeos.
A determinao da seqncia de nucleotdeos foi feita diretamente
do produto de "PCR". Para isso, foi utilizado o seqenciador ABI 377
(Applied Biosystems Inc) que emprega um gel de poliacrilamida com
capacidade de 96 canaletas.

33

6.1. Purificao dos Produtos de "PCR".


A purificao dos produtos das reaes de "Nested PCR e SemiNested PCR" foi feita em colunas, utilizando o sistema "QIAquick PCR
Purification Kit" (Qiagen) de acordo com as instrues do fabricante.
Alquotas do produto purificado foram submetidas eletroforese
em gel de agarose 1,2% e quantificadas com o auxlio de DNA de
bacterifago Lambda de massa conhecida (Invitrogen Life Technologies).
6.2. Reao de determinao de Seqncias de nucleotdeos.
Para a reao de determinao de seqncias de nucleotdeos foram
utilizados 3.2 moles de cada iniciador, 2 l de BigDye terminator
cycle sequencing kit 3.0 (Applied Biosystems Inc), 6l de tampo Save
Money (200mM de Tris-HCl pH 9 e 5mM de MgCl2), 30 a 100 moles
de produto de "PCR" e, gua deionizada para completar o volume final de
20 l. Os iniciadores utilizados foram os mesmos empregados para a
obteno de produtos do Nested-PCR e Semi-Nested PCR (H1F,
H1R2, H3F, H3R2, BF e BR2 - tabela 5). Para cada amostra foram feitas
quatro reaes de seqnciamento, duas reaes utilizando iniciadores
senso e duas com iniciadores anti-senso. As reaes foram realizadas no
termociclador "Thermal Cycler GeneAmp PCR System 2400". As
condies de ciclagem so apresentadas na tabela 8.

34

Tabela 8. Programa de ciclagem utilizado para as reaes de


determinao de seqncias de nucleotdeos.

Programa de Ciclos do Seqnciamento

Etapas

Desnaturao

Temperatura
em oC

Tempo

95

2 minutos

Desnaturao

94

45 segundos

Associao

50

10 segundos

Extenso

72

4 minutos

Manuteno

inicial

Nmero de
Ciclos

25
1

Os produtos das reaes de determinao da seqncia de


nucleotdeos foram purificados em colunas do kit "DyeEx 2.0 Spin Kit"
(Qiagen) de acordo com as instrues do fabricante, seguindo-se secagem
a vcuo por 30 minutos. As amostras purificadas foram ressuspendidas
em 3 l de formamida e submetidas eletroforese em gel de
poliacrilamida, utilizando o seqenciador automtico ABI 377 (Applied
Biosystems Inc).

35

7. Edio e Anlise das Seqncias Obtidas.


As quatro seqncias de nucleotdeos obtidas para cada amostra
positiva foram alinhadas e editadas manualmente no programa de
computador "Sequence Navigator" (verso 1.0.1 Applied Biosystems).
As seqncias editadas foram comparadas utilizando-se o programa de
computador ClustalX 1.83 (Thompson e col., 1997) e traduzidas para
aminocidos pelo programa "BioEdit Sequence Alignment Editor"
(verso 5.0.9) (Hall, 1999). Para a apresentao grfica dos alinhamentos
das seqncias de nucleotdeos obtidas, foi utilizado o programa de
computador "GeneDoc Multiple Sequence Alignment Editor & Shading
Utility" (verso 2.4.002) (Karl Nicholas, Copyright).
8. Localizao das diferenas na estrutura da hemaglutinina.
Aps mapeadas as diferenas encontradas, quando foram
comparadas as seqncias de aminocidos das amostras estudadas entre si
e entre as seqncias peptdicas das cepas vacinais, foi possvel localizar
estas diferenas na estrutura tridimensional da hemaglutinina. Para isso
foi utilizado o programa de computador "Rasmol" (verso 2.7.2.1.1)
(Sayle e Milner-White 1995) para a edio da estrutura tridimensional do
monmero de HA obtida por difrao de raios X (Influenza Sequence
Data Base, www.flu.lanl.gov). O Modelo foi baseado na estrutura obtida
por Sauter e cols., 1992 e depositada no Protein Data Bank sob o
nmero de acesso 1HGI.

36

9. rvore genealgica.
Para a construo da rvore genealgica foi utilizado o programa de
computador Meg Align 4.05 Expert Analysis Software (DNASTAR,
Inc). As seqncias de nucleotdeos utilizadas na rvore foram todas
alinhadas com o programa "BioEdit Sequence Alignment Editor" (verso
5.0.9) e editadas para ficarem no tamanho de 555 resduos de
nucleotdeos, que corresponde menor seqncia de nucleotdeos obtida
nas amostras analisadas.
Alm das seqncias de nucleotdeos por ns determinadas,
tambm foram utilizadas seqncias obtidas em bancos de dados de genes
GenBank e Influenza Sequence Database (www.ncbi.nlm.nih.gov e,
www.flu.lanl.gov respectivamente). Essas ltimas foram escolhidas de
acordo com trs critrios. Primeiro, foram obtidas seqncias de
nucleotdeos que tiveram maior similaridade com as seqncias das
amostras que analisamos. Segundo, foram selecionadas seqncias de
nucleotdeos de vrus influenza isolados em diferentes anos e hospedeiros
distintos, assim como uma seqncia do tipo A subtipo H5N1 e duas
seqncias do tipo C para que o programa de computador DNASTAR
tivesse base de comparao tendo como material de anlise seqncias
relacionadas, no entanto, heterogneas. Terceiro, foram utilizadas na
obteno da rvore genealgica as seqncias de nucleotdeos das cepas
vacinais dos anos 2000 e 2001, propostas pela Organizao Mundial de
Sade. Todas as seqncias utilizadas na rvore genealgica foram da
regio HA1 da hemaglutinina viral, com exceo para seqncias de
nucleotdeos dos vrus tipo C onde foram utilizadas seqncias correlatas
da sua glicoprotena de superfcie, hemaglutinina esterase (HE).

37

IV Resultados
1. Deteco, tipagem e subtipagem das amostras clnicas.
A tcnica de Nested Multiplex PCR previamente estabelecida (Ellis e
col., 1997) foi utilizada na deteco, tipagem e subtipagem dos vrus influenza
nas amostras estudadas. Essa tcnica baseia-se na amplificao de fragmentos
de tamanho distintos atravs da utilizao de iniciadores especficos para os
tipos e subtipos virais A H1N1, A H3N2 e B. Aps a segunda amplificao,
eram esperados fragmentos de tamanhos 944 pares de base (pb), 591pb e 767
pb respectivamente para amostras portadoras dos tipos virais A H1N1, A
H3N2 e B (figura 4). Em todos experimentos de Nested Multiplex PCR um
controle negativo onde o volume de cDNA foi substitudo pelo mesmo
volume de gua, controle dos reagentes, sempre resultou na ausncia de
deteco de algum produto, indicando a ausncia de contaminao de
reagentes.
No ano de 2000 foram coletadas 91 amostras e, sendo 57 amostras
coletadas em 2001. Das 91 amostras coletadas no ano de 2000, 18 se
mostraram positivas para vrus da influenza. Duas dessas 18 amostras (006 e
015) mostraram a peculiaridade de serem positivas para dois subtipos virais, A
H1N1 e A H3N2. Assim, no ano de 2000 foi possvel a deteco de 20
produtos de Nested Multiplex PCR independentes (figura 4 B e tabela 9).
Portanto, do total de 20 registros positivos, o que corresponde a
aproximadamente 22% do nmero total de amostras, 12 (60% dos registros
positivos) pertencem ao tipo A subtipo H3N2, 2 (10% dos registros positivos)
pertencem ao subtipoH1N1 e, 6 (30% dos registros positivos) pertencem ao
tipo B (tabela 09).

38

J para as 57 amostras coletadas em 2001, 16 se mostraram positivas


para o vrus influenza, o que corresponde a 28% do nmero total de amostras,
sendo 1 amostra positiva para o subtipo H3N2 (6,25% dos registros positivos),
14 para o subtipo H1N1 (87,5% dos registros positivos) e 1 amostra para o
tipo B (6,25% dos registros positivos) (figura 4 A e tabela 9).
A
PM
1.500 pb

600 pb

B
2

PM 1 2

1.200 pb
H1N1 (944 pb)
B (767 pb)
500 pb
H3N2 (591 pb)

H1N1 (944 pb)


H3N2 (591 pb)

100 pb
100 pb

Figura 4 Deteco, tipagem e subtipagem do vrus influenza em amostras clnicas. A) Gel


de agarose 1,2% corado com brometo de etdio representativo de amostras clnicas
portadoras dos diferentes tipos e subtipos virais. Canaleta 1, produto de Nested Multiplex
PCR da amostra 114, mostrando padro caracterstico de presena do vrus A H1N1.
Canaleta 2, produto de Nested Multiplex PCR da amostra 125, mostrando padro
caracterstico de presena do vrus A H3N2. Canaleta 3, produto de Nested Multiplex
PCR da amostra 110, mostrando padro caracterstico de presena do vrus tipo B.
Canaleta PM, padro de peso molecular 100 bp DNA Ladder (Invitrogen Life
Technologies). B) Produtos de Nested multiplex PCR positivos para vrus do tipo A
subtipos H3N2 e H1N1 na mesma amostra clnica. Canaleta 1, produtos gerados a partir da
amostra 006. Canaleta 2, produtos gerados a partir da amostra 015. Canaleta PM, padro
de peso molecular 100 bp DNA Ladder (New England Biolabs).

39

Tabela 9 Distribuio da amostras positivas pelos anos de coleta*.

Quantidade de Amostras positivas


Ano da
Coleta

Tipo A

Tipo B

Subtipo

Subtipo

H1N1

H3N2

2000

12

2001

14

Total

16

*Ver tambm o apndice 2.

Co-infeco com H3N2


H1N1

0
2

13

40

2. Obteno da regio codificadora completa de HA1.


A tcnica de "Semi-Nested PCR", foi utilizada para a amplificao do
segmento gnico contendo a poro externa da molcula de hemaglutinina
(HA1) dos vrus da gripe tipo A subtipo H1N1 e tipo B. Para os vrus do tipo
A subtipo H3N2 foi utilizada a tcnica de "Nested PCR". Os iniciadores
utilizados nestas reaes em cadeia pela polimerase foram desenhados para
serem especficos para a regio de peptdeo sinal do segmento gnico 4 e para
a regio que codifica a poro HA2 da hemaglutinina. Dessa forma, foi
possvel a obteno de produtos contendo as regies HA1 completas.
Os fragmentos obtidos com a tcnica de "Semi-Nested PCR" para os
vrus tipo A subtipo H1N1 foram de 1117 pares de bases, onde se incluem os
978 pares de bases quem compem a regio codificadora da poro HA1 da
hemaglutinina. Para os vrus do tipo B, foram obtidos produtos de PCR com
1040 pares de bases, sendo a regio codificadora de HA1 composta por 1038
nucleotdeos. Com a tcnica de "Nested PCR" obtivemos para o tipo A subtipo
H3N2 produtos com 1118 pares de bases, os quais contm a regio
codificadora da poro HA1 da hemaglutinina viral de 984 pares de base.
Do total de 34 amostras positivas que geraram 36 produtos amplificados
pela tcnica de "Nested Multiplex PCR", conseguimos obter 32 produtos que
correspondem s regies HA1 completas da hemaglutinina (Figura 5). No foi
possvel a amplificao de produtos de PCR contendo a regio completa de
HA1 de 4 amostras, sendo 3 do tipo A subtipo H3N2 (006, 011 e 013) e 1 do
tipo A subtipo H1N1 (006).
As amostras de influenza A subtipo H1N1, 123, 126, 133 e 140
mostraram bandas inespecficas (figura 5A, linhas 12, 13, 14 e 15
respectivamente). O mesmo ocorreu com as amostras 08, 10, 12, 15 e 125 do
tipo A subtipo H3N2 (figura 5B, linhas 2, 4, 5, 6 e 11 respectivamente).

41

PM 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 PM
A
1.200 pb

500 pb

100 pb
PM 01 02 03 04 05 06 07 08 09 10 11 PM

01 02 03 04 05 06 07 08 PM

1.200 pb

1500 pb

500 pb

600 pb
100 pb

100 pb
Figura 5. Obteno das regies codifcadoras completas de HA1. por Semi-Nested PCR e

Nested PCR A: Produtos de Semi-Nested PCR para cDNAs A H1N1 analisados em gel de agarose
1,2% corado com brometo de etdio. Linhas de 01 a 15 correspondem s amostras 15, 99, 101, 103, 104,
109, 112, 113, 114, 121, 122, 123, 126, 133 e 140 respectivamente. Padro de peso molecular (PM)
100bp DNA ladder (New England Biolabs INC). B: Produtos de Nested PCR para cDNAs A H3N2
analisados em gel de agarose 1,2% corado com brometo de etdio. Linhas de 01 a 11 correspondem s
amostras 03, 08, 09, 10, 12, 15, 18, 24, 49, controle negativo e 125 respectivamente. Marcador de peso
molecular (PM) 100bp DNA ladder (New England Biolabs INC). C: Produtos de Semi-Nested PCR
para cDNAs B analisados em gel de agarose 1,2% corado com brometo de etdio. Linhas de 01 a 08
correspondem s amostras 17, 53, 55, 64, 74, 79, controle negativo e 110 respectivamente. Marcador de
peso molecular (PM) 100bp DNA ladder (Invitrogen Life Technologies).

42

4. Seqncias de aminocidos de HA1 das amostras estudadas: anlise


comparativa das amostras entre si e com as cepas vacinais.
As regies codificadoras completas de HA1 da hemaglutinina viral das
amostras positivas foram utilizadas para a obteno de suas seqncias de
nucleotdeos. As seqncias de nucleotdeos obtidas foram traduzidas em
peptdeos, as quais foram utilizadas em diferentes alinhamentos. As
seqncias de aminocidos das regies HA1 obtidas foram alinhadas entre si,
assim como, com a seqncia das cepas vacinais utilizadas nos anos de 2000 e
2001.
Essa estratgia nos permite avaliar variaes na seqncia de
aminocidos para cada tipo e subtipo viral ao longo de 2 anos consecutivos e,
compar-las com as cepas vacinais. Uma vez mapeadas as diferenas,
podemos localiz-las na estrutura tridimensional da hemaglutinina e, verificar
se essas pertencem a stios antignicos conhecidos por sua alta variabilidade.
4.1. Tipo A Subtipo H1N1
Foram obtidos 14 produtos de "Semi-Nested PCR" para as amostras do
tipo A subtipo H1N1. A seqncia de nucleotdeos para esses produtos de
978 pares de bases. Devido ausncia de produto contendo a regio HA1
completa para a amostra 006, utilizou-se o produto de 891 pares de bases
obtido em experimentos de "Nested Multiplex PCR" para a obteno de
informao de seqncia de nucleotdeos. Esse fragmento corresponde a
aproximadamente a 91% da regio HA1 da hemaglutinina. Para a amostra 123
no foi possvel obter seqncias.
A comparao entre as seqncias peptdicas de HA1 de todas as
amostras do tipo A subtipo H1N1 entre si, assim como, com a seqncia da

43

cepa vacinal utilizada nos anos 2000 e 2001 (A/New Caledonia/20/99)


mostrou vrias diferenas. Das 20 diferenas mapeadas, 19 so substituies
de aminocidos, enquanto uma configura-se como uma deleo (figura 06).
Entre as amostras positivas que foram coletadas no ano 2000 (amostras 006 e
015) foi encontrado um total de 15 aminocidos de diferena quando
comparadas com as seqncias da cepa vacinal, sendo 13 diferenas referentes
seqncia 006 e duas referentes a seqncias 015 (tabela 10). Entre as
amostras do ano 2001 foram encontradas apenas 6 diferenas em suas
composies peptdicas quando comparadas com a seqncia da cepa vacinal
A/New Caledonia/20/99 (figura 06 e tabela 10).
Todas as alteraes de aminocidos ocorridas entre as seqncias
peptdicas das amostras do subtipo H1N1 foram relacionadas com os cinco
stios de maior variabilidade na regio de HA1 da molcula de hemaglutinina
(figura 07 e tabela 10) (Yewdell e col., 1983, Caton e col., 1982, Drescher e
Aron, 1999).

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

10
20
30
40
50
60
DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQLGNCSVAGW
............................................................
............................................................
............................................................
............................................................
............................................................
...........................................I................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
-------------.............................R.............I...

44

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

70
80
90
100
110
120
ILGNPECELLISKESWSYIVETPNPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKE
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
........S.F........A....S...................................

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

130
140
150
160
170
180
SSWPNHTVT-GVSASCSHNGKSSFYRNLLWLTGKNGLYPNLSKSYVNNKEKEVLVLWGVH
N........-...................................A..............
N........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-...................................A..............
.........-................................M.................
.........K..T...............................................

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

190
200
210
220
230
240
HPPNIGDQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLLEPGDTI
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
..S.......I..............................G..................

45

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

250
260
270
280
290
300
IFEANGNLIAPWYAFALSRGFGSGIITSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTI
...........R................................................
...........R................................................
...........R................................................
...........R.............................................I..
...........R................................................
...........R................................................
...........R................................................
...........R................................................
...........R................................................
...........R................................................
...........R................................................
...........R................................................
...........R................................................
..........................................K.................
..............................S.............................

Cepa
121H1
122H1
101H1
099H1
109H1
103H1
112H1
113H1
133H1
126H1
114H1
104H1
140H1
015H1
006H1

310
320
GECPKYVRSAKLRMVTGLRNIPSIQS
.........T................
.........T................
.........T................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
..........................
.........T----------------

Figura 06 - Comparao entre as seqncias peptdicas de HA1 obtidas de amostras do tipo A


subtipos H1N1 coletadas nos anos de 2000 e 2001 e a cepa vacinal A/New Caledonia/20/99.
Pontos (.) indicam similaridade entre as seqncias obtidas, somente os aminocidos diferentes
da seqncia da cepa vacinal esto representados. Traos (-) representam lacunas geradas por
ausncia de seqncia peptdica. A disposio grfica da figura foi obtida com o auxlio do
programa de computador "GeneDoc Multiple Sequence Alignment Editor & Shading Utility"
(verso 2.4.002) (Karl Nicholas, copyrigth). A ordem das seqncias foi determinada pela
similaridade entre as seqncias e arranjadas pelo programa de computador "ClustalX" (verso
1.83) (Thompson e col., 1997). Amostras coletadas no ano de 2000 esto em itlico e negrito, as
demais foram coletadas no ano de 2001. A seqncia peptdica da cepa vacinal A/New
Caledonia/20/99 (Cepa) foi obtida do "Genbank" sob nmero de acesso AJ344014.

46

Tabela 10. Sumrio das alteraes nas seqncias de aminocidos das


amostras coletadas nos anos de 2000 e 2001 em relao cepa vacinal A/New
Caledonia/20/99.
Nmero da

Posio dos

Amostra

Resduos

006

Stio

Cepa Vacinal

Alterao

43

leucina

arginina

---

103

44

leucina

isoleucina

---

006

57

valina

isoleucina

Cb

006

69

leucina

serina

Cb

006

71

isoleucina

fenilalanina

Cb

006

80

valina

alanina

Cb

006

85

prolina

serina

---

121 e 122

121

serina

asparagina

Ca1

006

130*

Lacuna

lisina

Ca2

006

133

serina

treonina

Ca2

015

162

lisina

metionina

Sa

165

valina

alanina

Ca1

006

183

prolina

serina

---

006

191

leucina

isoleucina

Sb

006

222

cido asprtico

glicina

Antignico

121, 122, 101,


099, 109, 103,
112, 113, 133,
126, 114 e
104 .

---

47

Nmero da

Posio dos

Amostra

Resduos

Stio

Cepa Vacinal

Alterao

251

triptofano

arginina

---

006

271

prolina

serina

---

015

282

glutamina

lisina

---

99

297

valina

isoleucina

---

309**

alanina

treonina

---

Antignico

121, 122, 101,


099, 109, 103,
112, 113, 133,
126, 114 e
104 .

006, 101, 121


e 122.

(---)Resduos de aminocidos que no se enquadram em nenhum stio antignico.


*A amostra 006 apresentou a insero de um aminocido na posio 130 da cadeia
peptdica.
** Para a amostra 006 esta alterao ocorreu no resduo 310 devido insero de um
aminocido na posio 130. Para as outras amostras esta diferena ocorreu no resduo 309.

48

Legenda
A) Mutaes ocorridas nos stios
antignicos Ca2, Sa, Sb, Ca1 e Cb.
i) Ca2
Resduo 130

Resduo 133

ii) Sa
Resduo 162
iii) Sb
Resduo 191
iv) Ca1
Resduo 121

Resduo 165

iv) Cb
Resduo 57
Resduo 80
Resduo 69
Resduo 57
B) Mutaes ocorridas fora dos stios
antignicos descritos.
Resduo 43
Resduo 85
Resduo 222
Resduo 271
Resduo 297

Resduo 44
Resduo 183
Resduo 251
Resduo 282
Resduo 309

Figura 07. Estrutura do monmero de HA obtida por difrao de raios X (Influenza Sequence Data Base,
www.flu.lanl.gov). Modelo baseado na estrutura obtida por Sauter e cols., 1992 e depositada no Protein Data
Bank sob o nmero de acesso 1HGI. "Rasmol" (2.7.2.1.1), foi o programa utilizado na edio da figura (Sayle
e Milner-White 1995).

49

4.2. Tipo A Subtipo H3N2


Foram obtidos 13 produtos de "Nested Multiplex PCR" para as
amostras do tipo A subtipo H3N2. Dessas, 9 tiveram as seqncias de
nucleotdeos, da regio codificadora de HA1 completa, determinadas. Devido
no ter sido possvel a obteno de produto de "Nested PCR" para as amostras
006, 011 e 013, foram obtidas seqncias dos produtos de "Nested Multiplex
PCR" com tamanho de 555 pares de bases ou, quando traduzidas para
aminocidos um tamanho de 185 resduos, cerca de 56% da regio HA1 da
hemaglutinina. Para a amostra 018 no foi possvel obter seqncias
caractersticas de influenza A H3N2. Todas as seqncias obtidas foram
traduzidas para sua forma peptdica e comparadas com a seqncia de
aminocidos da cepa vacinal.
A comparao entre as seqncias peptdicas de HA1 das
amostras coletadas do subtipo H3N2 com a seqncia de aminocidos das
cepas vacinais mostrou a existncia de 52 alteraes (Figura 08). Entre as
amostras coletadas no ano de 2000 a diferena entre a cadeia peptdica das
amostras e a seqncia da cepa vacinal de 2000 (A/Sydney/5/97) foi de 42
resduos de aminocidos (tabela 11). A seqncia peptdica da cepa vacinal de
2000 foi obtida no Genbank (www.ncbi.nlm.nih.gov) sob nmero de acesso
AJ311466. Para o ano de 2001 foi recomendada pela OMS a cepa vacinal
A/Panam/2007/99, sua seqncia peptdica foi obtida no banco de dados
Influenza Sequence Database (www.flu.lanl.gov) sob nmero de acesso
ISDNCDA001. Quando comparamos a seqncia peptdica da cepa vacinal de
2001 com a seqncia da amostra 125, coletada no ano de 2001, encontrou-se
o total de 10 diferenas de aminocidos (tabela 12).

50

Todas as alteraes de aminocidos ocorridas entre as seqncias


peptdicas das amostras dos subtipo H3N2 foram relacionadas com os cinco
stios de maior variabilidade na regio de HA1 da molcula de hemaglutinina
(Wiley e col., 1981, Underwood, 1982, Underwood 1984, Wiley e Skehel,
1987) (tabelas 11 e 12 e figura 09).

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3
006H3
011H3
013H3

10
20
30
40
50
60
QKIPGNDNSTATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHRILD
..L.................S...................................Q...
..L.V...............P...........H.......................Q...
..L.V...............P...........H.......................Q...
..L.V...............P...........H.......................Q...
..L.V...............P...........H.......................Q...
..L.V...............P........M..H.......................Q...
..L.................P.......................................
..L.................P.......................................
..L.................P.......................................
..L.................P.......................................
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3
006H3
011H3
013H3

70
80
90
100
110
120
GENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEF
............................................................
...............................T............................
...............................T............................
...............................T...................I........
...............................T............................
...............................T............................
.K..........................................................
.K..........................................................
.K..........................................................
.K..........................................................
------------------------------------........................
------------------------------------........................
------------------------------------........................

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3

130
140
150
160
170
180
NNESFNWTGVAQNGTSYACKRSSIKSFFSRLNWLHQLKYKYPALNVTMPNNDKFDKLYIW
................S....R.N...........................E........
................S....R.I...........................E........
................S....R.I...........................E........
................S....R.I...........................E........
................S....R.I...........................E........
................S....R.I...........................E........
I..D........S.E......G.V...........KSD.............G........
I..D........S.E......G.V...........KSD.............G........
I..D........S.E......G.V...........KSD.............G........
I..D........S.E......G.V...........KSD.............G........

51
006H3
011H3
013H3

I..D........S.E......G.V...........KSD.............G........
T..G........D.K......G.VN..........K.E......................
T..G........D.K......G.VN..........K.E......................

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3
006H3
011H3
013H3

190
200
210
220
230
240
GVHHPSTDSDQTSIYAQASGRVTVSTKRSQQTVIPNIGSRPWVRGISSRISIYWTIVKPG
..L........I.L...............................V..............
..H........I.L...............................V..............
..H........I.L...............................V..............
..H.L......I.L...............................V..............
..H........I.L...............................V..............
..H........I.L...............................V..............
..H.....RE...L.VR............................L..............
..H.....RE...L.VR............................L..............
..H.....RE...L.VR............................L..............
..H.....RE...L.VR............................L..............
..H.....RE...L.VR............................L..............
..H..........L.V............................................
..H.....R....L.V............................................

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3
006H3
011H3
013H3

250
260
270
280
290
300
DILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRI
............................................................
..............................N.............................
..............................N.............................
..............................N.............................
..............................N.............................
..............................N.............................
.....................T.............T.S......................
.....................T.............T.S......................
.....................T.............T.S......................
.....................T.............T.S......................
.....................T.............T.S...------------------.....................N............DN.....------------------.....................N............DN.....-------------------

52

Cepa1
Cepa2
003H3
049H3
125H3
012H3
024H3
008H3
015H3
010H3
009H3
006H3
011H3
013H3

310
320
TYGACPRYVKQNTLKLATGMRNVPEKQT
............................
............................
............................
................S...........
............................
............................
............................
............................
...........................N
............................
----------------------------------------------------------------------------------

Figura 08. Comparao entre as seqncias peptdicas de HA1 obtidas de amostras do tipo
A subtipos H1N1 coletadas nos anos de 2000 e 2001 e as cepas vacinais A/Sydney/5/97 e
A/Panama/2007/99. Os pontos (.) indicam similaridade entre as seqncias obtidas da
amostras e as seqncias de aminocidos das cepas vacinais. Somente as diferenas de
aminocidos da seqncia cepa vacinal esto representados. Traos (-) representam lacunas
geradas por ausncia de seqncia peptdica. A disposio grfica da figura foi obtida com
o auxlio do programa de computador "GeneDoc Multiple Sequence Alignment Editor &
Shading Utility" (verso 2.4.002). A ordem das seqncias na figura foi determinada pela
similaridade entre as seqncias e arranjadas pelo programa de computador "ClustalX"
(verso 1.83). A cepa vacinal do ano 2000 A/Sydney/5/97 representada na figura como
Cepa1. A cepa vacinal do ano 2001; A/Panama/2007/99 est representada na figura como
Cepa2. A seqncia peptdica do ano 2001 est em itlico e negrito (amostra 125), as
demais so referentes ao ano de 2000.

53

Tabela 11. Sumrio das alteraes encontradas entre as seqncias de


aminocidos das amostras coletadas no ano de 2000 e a seqncia cepa
vacinal A/Sydney/5/97.
Nmero da

Posio dos

Cepa Vacinal

Amostra

Resduos

(2000)

Isoleucina

Leucina

---

Glicina

Valina

---

30

Treonina

Metionina

---

33

Glutamina

Histidina

---

57

Arginina

Glutamina

Lisina

Alterao

Stio
Antignico

003, 008, 009,


010, 012, 015,
024 e 49
003, 012, 024
e 049
024
003, 012, 024
e 049
003, 012, 024
e 049
008, 009, 010
e 015
003, 012, 024

62

cido
Glutmico

92

Lisina

Treonina

121

Asparagina

Isoleucina

011 e 013

121

Asparagina

Treonina

006, 008, 009,

124

Serina

cido

e 049
006, 008, 009,
010 e 015

54

Nmero da

Posio dos

Cepa Vacinal

Amostra

Resduos

(2000)

010 e 015
011 e 013
006, 008, 009,
010 e 015
011 e 013
006, 008, 009,
010 e 015
011 e 013
003, 012, 024
e 049

Alterao

Stio
Antignico

Asprtico
124

Serina

Glicina

133

Asparagina

Serina

133

Asparagina

135

Treonina

135

Treonina

Lisina

137

Tirosina

Serina

142

Serina

Glicina

142

Serina

Arginina

144

Isoleucina

Valina

145

Lisina

Asparagina

156

Glutamina

Lisina

157

Leucina

Serina

cido
Asprtico
cido
Glutmico

A
A

006, 008, 009,


010, 011, 013
e 015
003, 012, 024
e 049
006, 008, 009,
010, 011, 013
e 015.
011 e 013
006, 008, 009,
010, 011, 013
e 015
006, 008, 009,
010 e 015

55

Nmero da

Posio dos

Cepa Vacinal

Amostra

Resduos

(2000)

158

Lisina

158

Lisina

006, 008, 009,


010 e 015
011 e 013
006, 008, 009,
010 e 015
003, 012, 024
e 049

172

cido
Asprtico

Alterao
cido
Asprtico
cido
Glutmico
Glicina

Stio
Antignico
B
B
D

cido

cido

Asprtico

Glutmico

Serina

Arginina

cido

cido

Asprtico

Glutmico

192

Treonina

Isoleucina

194

Isoleucina

Leucina

196

Alanina

Valina

197

Glutamina

Arginina

226

Isoleucina

Leucina

226

Isoleucina

Valina

172

006, 008, 009,


010, 013 e

189

015
006, 008, 009,
010 e 015
003, 012, 024
e 049

190

006, 008, 009,


010, 011, 013
e 015
006, 008, 009,
010 e 015
006, 008, 009,
010 e 015
003, 012, 024
e 049

56

Nmero da

Posio dos

Cepa Vacinal

Amostra

Resduos

(2000)

262

Serina

Treonina

262

Serina

Asparagina

Asparagina

---

006, 008, 009,


010 e 015
011 e 013
003, 012, 024
e 049
011 e 013
006, 008, 009,
010 e 015
011 e 013
006, 008, 009,
010 e 015
010

271

cido
Asprtico

Alterao

Stio
Antignico

cido

275

Glicina

276

Lisina

Treonina

276

Lisina

Asparagina

278

Asparagina

Serina

328

Treonina

Asparagina

---

Asprtico

(---)Resduos de aminocidos que no se enquadram em nenhum stio antignico.


() representa que a alterao apresentada foi observada em todas as amostras coletadas no
ano de 2000.

57

Tabela 12. Resumo das alteraes encontradas entre a seqncia de


aminocidos da amostra coletada no ano de 2001, e a seqncia da cepa
vacinal A/Panama/2007/99.
Posio dos

Cepa Vacinal

Resduos

(2001)

05

Glicina

Valina

---

21

Serina

Prolina

---

33

Glutamina

Histidina

---

92

Lisina

Treonina

112

Valina

Isoleucina

---

144

Asparagina

Isoleucina

183

Leucina

Histidina

---

185

Prolina

Leucina

---

Asparagina

---

Serina

---

271
317

cido
Asprtico
Alanina

Amostra 125

Stio
Antignico

(---)Resduos de aminocidos que no se enquadram em nenhum stio antignico.

58

Legenda
A) Mutaes no stio antignico A.
Resduo 133
Resduo 124
Resduo 135
Resduo 137
Resduo 142
Resduo 144
Resduo 145
B) Mutaes no stio antignico B.
Resduo 156
Resduo 158
Resduo 190
Resduo 194
Resduo 197

Resduo 157
Resduo 189
Resduo 192
Resduo 196

C) Mutaes no stio antignico C.

Resduo 275
Resduo 276
Resduo 278
D) Mutaes no stio antignico D.
Resduo 121
Resduo 172
Resduo 226
E) Mutaes no stio antignico E.
Resduo 57
Resduo 92

Resduo 62
Resduo 262

F) Mutaes ocorridas fora dos


stios antignicos descritos.
Resduo 3
Resduo 21
Resduo 33
Resduo 112
Resduo 185
Resduo 317

Resduo 5
Resduo 30
Resduo 328
Resduo 183
Resduo 271

Figura 09. Monmero de HA obtida por difrao de raios X (www.flu.lanl.gov). Modelo baseado na estrutura
obtida por Sauter e cols., 1992 e depositada no Protein Data Bank sob o nmero de acesso 1HGI. "Rasmol"
(2.7.2.1.1), foi o programa utilizado na edio da figura (Sayle e Milner-White 1995)

59

4.3. Tipo B
Foram obtidos 7 produtos de "Nested Multiplex PCR" para as
amostras do tipo B. Dessas, 6 tiveram 93% das seqncias de nucleotdeos, da
regio codificadora de HA1 completa, determinadas. Devido no ter sido
possvel a obteno de produto de "Nested PCR" para a amostra 017, foi
obtida seqncia do produto de "Nested Multiplex PCR" com tamanho de 717
pares de bases ou, quando traduzidas para aminocidos um tamanho de 239
resduos, cerca de 69% da regio HA1 da hemaglutinina. Todas as seqncias
obtidas foram traduzidas para sua forma peptdica e comparadas com a
seqncia de aminocidos da cepa vacinal.
Para o ano de 2000 a OMS props para a composio da vacina a cepa
B/Beijing/184/93, ou B/Shandong/97, no entanto a cepa mais utilizada neste
ano foi B/Yamanashi/166/98 que possui padro antignico equivalente cepa
B/Beijing/184/93. Das 6 seqncias obtidas das amostras coletadas em 2000
foram encontradas 7 diferenas de resduos de aminocidos quando
comparadas com a seqncia peptdica da cepa vacinal proposta pela OMS
para o ano de 2000 B/Yamanashi/166/98 (figura 10, tabela 13). Para o ano
2001 a OMS props a cepa vacinal B/Sichuan/379/99 para a composio da
vacina, e a comparao da seqncia de peptdeos de HA1 com a seqncia da
amostra coletada no ano 2001, 110, mostrou 4 diferenas de resduos de
aminocidos (figura 10 e tabela 14).

60

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

10
20
30
40
50
60
DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTKTRGKLCPTCLNC
............................A...............................
............................A...............................
............................A...............................
............................A...............................
............................A...............................
............................A...............................
....S.......................A...............................
------------------------------------------------............

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

70
80
90
100
110
120
TDLDVALGRPMCVGVTPSAKASILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYEKIRLS
..............I...........IK................................
..............I...........VR................................
..............I...........VR................................
..............I...........VR................................
..............I...........VR................................
..............I...........VR................................
..............I...........VR................................
..............I...........VR................................

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

130
140
150
160
170
180
TQNVINAEKAPGGPYRLGTSGSCPNATSRSGFFATMAWAVPKDNNKTATNPLTVEVPHIC
............................K............R..................
............................K............R..................
............................K............R..................
............................K............R..................
............................K............R..................
............................K............RA.................
............................K............R..................
............................K............R..................

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

190
200
210
220
230
240
TKEEDQITVWGFHSDNKTQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFPDQTEDGGLP
...............D......................I.....................
...............N......................I.....................
...............N......................I.....................
...............N......................I.........D...........
...............N......................I.....................
...............N......................I.....................
...............N......................I.....................
...............N......................I.....................

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

250
260
270
280
290
300
QSGRIVVDYMVQKPGKTGTIVYQRGILLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYG
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
............................................................
...............................................-------------

61

Cepa1
Cepa2
55B
64B
74B
53B
79B
110B
17B

310
320
GLNKSKPYYTGEHAKAIGNCPI
......................
......................
......................
......................
......................
......................
......................
----------------------

Figura 10. Comparao entre seqncias peptdicas de HA1 de amostras do tipo B e a


seqncia de aminocidos das cepas vacinais B/Yamanashi/166/98 e B/Sichuan/379/99. Os
pontos (.) indicam similaridade entre as seqncias das amostras e a seqncia das cepas
vacinais, somente os aminocidos diferentes das seqncias das cepas vacinais esto
representados. Traos (-) representam lacunas geradas por ausncia de seqncia peptdica.
A disposio grfica da figura foi obtida com o auxlio do programa de computador
"GeneDoc Multiple Sequence Alignment Editor & Shading Utility" (verso 2.4.002). A
seqncia peptdica da cepa vacinal B/Yamanashi/166/98 (Cepa1) foi obtida no "Genbank"
(www.ncbi.nlm.nih.gov) sob nmero de acesso AF100355. E a seqncia da cepa vacinal
B/Sichuan/379/99 (Cepa2) foi obtida do banco de dados de influenza (www.flu.lanl.gov)
sob o nmero de acesso ISDN13428. A seqncia peptdica do ano 2001 est em itlico e
negrito (amostra 110), as demais so referentes ao ano de 2000.

62

Tabela 13. Sumrio das alteraes encontradas entre as seqncias de


aminocidos das amostras do tipo B coletadas em 2000 e a seqncia da cepa
vacinal B/Yamanashi/166/98.
Nmero da

Posio dos

Amostra

Resduos

Cepa Vacinal

Alterao

29

Valina

Alanina

75

Valina

Isoleucina

149

Arginina

Lisina

162

Lisina

Arginina

079

163

219

Valina

074

229

Glicina

053, 055, 064,


74 e 079

cido
Asprtico

Alanina
Isoleucina
cido
Asprtico

() representa que a alterao apresentada foi observada em todas as amostras coletadas no


ano de 2000.

63

Tabela 14. Sumrio das alteraes encontradas entre a seqncia de


aminocidos da amostra do tipo B 110 coletada em 2001 e a seqncia da cepa
vacinal B/Sichuan/379/99.
Posio dos

Cepa Vacinal

Amostra

Resduos

(2001)

125

05

Treronina

Serina

87

Isoleucina

Valina

88

Lisina

Arginina

196

cido Asprtico

Asparagina

So necessrios mais estudos para a caracterizao dos stios


antignicos da hemaglutinina dos vrus do tipo B, apenas duas regies de HA
do vrus tipo B foram parcialmente relacionadas com stios A e B da
hemaglutinina dos vrus do subtipo H3N2 (Berton e col., 1984, Muyanga e
col., 2001).
4.4. Pesquisa das seqncias de nucleotdeos no "Genbank"
As seqncias de nucleotdeos obtidas das amostras coletadas foram
submetidas a uma pesquisa no "Genbank" com o objetivo de verificar quais
so as seqncias de nucleotdeos depositadas no banco, mais similares as
seqncias que obtivemos. Atravs dessa anlise possvel responder as
seguintes perguntas: As seqncias que obtivemos apresentam maior
similaridade com seqncias depositadas de amostras coletadas em quais
anos? Elas foram coletadas nos mesmos anos que as amostras que estudamos?
De quais regies do mundo so as seqncias de amostras depositadas que

64

foram mais similares as seqncias que obtivemos? So do hemisfrio sul? As


seqncias de nucleotdeos das amostras depositadas, mais similares as
seqncias que obtivemos foram colocadas para a comparao na rvore
genealgica (tabela 15).
4.5. Pesquisa no "Genbank" das seqncias de A H1N1
A seqncia de nucleotdeos da amostra 006 do subtipo H1N1 foi
submetida a uma pesquisa no "Genbank" (www.ncbi.nlm.nih.gov) e como
resultado foi apresentada uma lista de seqncias gnicas, das quais, trs
seqncias foram as que continham maior similaridade, apresentando apenas
trs bases de diferena. As seqncias depositadas foram: A/Canada/7/88
(nmero de acesso L19021), A/Finland/74/88 (nmero de acesso L33754) e
A/Suita/1/89 do Japo (nmero de acesso D13573). A amostra 015 apresentou
2 substituies na composio da sua seqncia peptdica, em comparao
com a seqncia da cepa vacinal. A amostra 015 uma amostra resultante de
um quadro de co-infeco (figura 7A). Mas, diferente de 006, que teve maior
similaridade com seqncias de 1988 e 1989, a amostra 015 em pesquisa no
"Genbank"

apresentou

maior

similaridade

com

seqncia

A/Madagascar/57794/2000, nmero de acesso AJ457893, isto , seqncia de


amostra obtida no mesmo ano de coleta da amostra 015.
Todas as seqncias de nucleotdeos das amostras coletadas em 2001
foram submetidas pesquisa no "Genbank", e todas sem exceo,
encontraram maior similaridade com as seqncias das linhagens depositadas
no banco, A/Fukui/1/2001, do Japo (nmero de acesso AB117181),
A/Ireland/649/2001

(nmero

de

acesso

AJ457930)

A/Saudi

Arabia/7971/2000 (nmero de acesso AJ457862). As amostras 104, 114, 126 e


133 tiveram duas bases nucleotdicas de divergncia com as seqncias

65

depositadas. As amostras 112 e 109 tiveram trs nucleotdeos de diferena


entre suas seqncias e as seqncias depositadas. Quatro bases de diferena
foram encontradas entre as seqncias nucleotdicas das amostras 103, 099,
101 e 121, com as seqncias depositadas. A amostra 122 tem 6 nucleotdeos
de divergncia entre sua seqncia de nucleotdeos e as seqncias
depositadas no "Genbank" mencionadas acima.
4.6. Pesquisa no "Genbank" das seqncias de A H3N2
As seqncias de nucleotdeos das amostras coletadas foram comparadas ao
"Genbank" (www.ncbi.nlm.nih.gov). As amostras 003, 012, 024, 049 e a
amostra 125 apresentaram maior similaridade com as seqncias depositadas
A/Michigan/22568/99 (nmero de acesso AF501531), A/Virginia/21833/99
(nmero de acesso AF501517) e A/Charlottesville/69/99 (nmero de acesso
AF297097). As amostras 003, 012 e 024 tiveram 8 nucleotdeos de diferena
com as seqncias listadas acima, enquanto a amostra 125 mostrou 13 bases
de diferena. As amostras 006, 008, 009, 010 e 015 foram submetidas
mesma anlise e mostraram maior similaridade com a seqncia depositada no
"Genbank", A/South Dakota/1/91 (nmero de acesso AF008675). As amostras
006, 010 e 015 tiveram apenas um nucleotdeo de diferena com a seqncia
citada, enquanto as amostras 008 e 009 mostraram dois nucleotdeos de
diferena. As amostras 011 e 013 tambm foram submetidas pesquisa no
"Genbank" e as seqncias depositadas que tiveram maior similaridade em
suas seqncias de nucleotdeos foram: A/Finland/380/95 (nmero de acesso
AF311677), A/Osaka/c1/95 (nmero de acesso U65553), A/Korea/45/96
(nmero de acesso AF008736) e A/Brazil/2/95 (nmero de acesso AF008734).
A amostras 011 teve 100% de similaridade com as seqncias depositada
listadas acima. A amostra 013 apresentou 1 nucleotdeo de diferena.

66

4.7. Pesquisa no "Genbank" das seqncias de vrus do tipo B


Todas as seqncias de nucleotdeos obtidas das amostras coletadas
foram submetidas pesquisa no "Genbank". Dentre as seqncias depositadas
no "Genbank" as que mostraram maior similaridade com as amostras
coletadas

foram:

B/Vienna/1/99

(nmero

de

acesso

AF387495),

B/Quebec/51/98 (nmero de acesso AJ419587), B/United Kingdom/34520/99


(nmero de acesso AY096192), B/Kansas/22992/99 (nmero de acesso
AY096190), B/Michigan/22691/99 (nmero de acesso AY096187) e
B/Netherlands/429/98 (nmero de acesso AF217216). As amostras 053, 055 e
064 tiveram 4 nucleotdeos de diferena entre suas seqncias nucleotdicas e
as seqncias depositadas citadas. A amostra 110 apresentou 5 nucleotdeos
de diferena entre sua seqncia de nucleotdeos e as seqncias depositadas
no "Genbank". As amostras 074 e 079 apresentaram 6 nucleotdeos de
diferena quando comparadas suas seqncias de nucleotdeos com as das
seqncias depositadas. A amostra 017 apresentou maior similaridade com as
seqncias depositadas B/Johanesburg/1/99 (nmero de acesso AY22388) e
B/Quebec/51/98 (nmero de acesso AJ419587) onde apresentou 3
nucleotdeos de diferena.

4.8. rvore Genealgica


Para corroborar os resultados apresentados de tipagem e subtipagem
molecular e os resultados de seqncia, uma rvore genealgica (figura 11) foi
obtida por meio da comparao entre as seqncias de nucleotdeos das
amostras coletadas e as amostras listadas na tabela 15.

H3/Foca/92
H3/Sydney/97
H3/Michigan/99 (1)
BR003H3 (1)
BR125H3
BR012H3 (1)
H3/Panama/99
H3/Charl/99
H3/Suno/99
BR011H3 (4)
BR013H3
BR009H3
BR006H3 (3)
H3/S.Dakota/91
H3/Suno/84
H3/Suno/93
H3/Petbird/99
H3/Pato/77
H3/Ganso/76
H3/Eqino/81
H3/Eqino/94
H5/Peru/91
BR103H1
BR112H1
BR099H1 (1)
H1/Fukui/01 (2)
BR104H1 (5)
BR101H1
BR121H1 (1)
H1/N.Caled/99
BR015H1
H1/Madag/00
H1/Canada/88 (1)
BR006H1
H1/Suita/89
H1/Suno/98
H1/Pato/01
H1/Peru/99
H1/Suno/85
H1/Pato/76
B/Yaman/98
B/Kansas/99
BR017B
B/Michigan/99
BR074B
B/Sichuan/99
BR079B
BR053B (3)
B/99
B/Neth/98
B/40
B/Vienna/99
He/C/99
He/C/66

67

Tipo A Subtipo H3

Tipo A Subtipo H1

Tipo B

Figura 11. rvore obtida atravs do programa de computador "DNAstar" pela comparao da seqncia de
nucleotdeos das amostras coletadas e seqncias obtidas no "GeneBank". Nossas amostras esto em negrito e
possuem o prefixo BR. As demais amostras foram obtidas no "GenBank" (tabela 15). Os nmeros entre parnteses
indicam a quantidade de amostras com seqncias idnticas. Estas amostras foram excludas da figura (tabela 16).

68

Tabela 15. Cepas virais utilizadas para a obteno da rvore genealgica.


Seqncias de nucleotdeos obtidas em banco de dados internacionais.
Abreviao

Cepa

Nmero de Acesso

He/C/66
He/C/99
B/Yaman/98
B/Kansas/99
B/Michigan/99
B/Sichuan/99
B/99
B/Neth/98
B/Vienna/99
B/40
H5/Peru/91
H1/Pato/76
H1/Suno/85
H1/Suno/98
H1/Peru/99
H1/Pato/01
H1/Madag/00
H1/Canada/88
H1/Suita/89
H1/N.Caled/99
H1/Fukui/01
H3/Eqino/94
H3/Eqino/81
H3/Foca/92
H3/Petbird/99
H3/Ganso/76
H3/Pato/77
H3/Suno/93
H3/Suno/84
H3/S.Dakota/91
H3/Suno/99
H3/Sydney/97
H3/Michigan/99
H3/Charl/99
H3/Panama/99

C/Johannesburg/1966
C/Miyagi/3/1999
B/Yamanashi/166/1998
B/Kansas/22992/1999
B/Michigan/22691/1999
B/Sichuan/379/1999
B/Hong Kong/157/1999
B/Netherlands/429/1998
B/Vienna/1/1999
B/Lee/1940
A/turkey/England/50-92/1991
A/duck/Alberta/35/1976
A/swine/Netherlands/12/1985
A/Swine/Wisconsin/464/1998
A/Turkey/MO/24093/1999
A/Duck/NC/91347/2001
A/Madagascar/57794/2000
A/Canada/7/1988
A/Suita/1/1989
A/New Caledonia/20/1999
A/Fukui/1/2001
A/Equine/Kentucky/1/1994
A/eq/Kentucky/1981
A/Seal/MA/3911/92
A/pet bird/Hong Kong/1559/1999
A/Gs/HK/10/1976
A/DK/HK/231/77
A/swine/Bakum/909/1993
A/Swine/Ukkel/1/1984
A/South_Dakota/1/1991
A/Swine/Minnesota/593/1999
A/Sydney/5/1997
A/Michigan/22568/1999
A/Charlottesville/69/1999
A/Panama/2007/1999

M17868
AB086669
AF100355
AY096190
AY096187
AF319590
AF387503
AF217216
AF387495
J02093
S68489
AF091309
AF091317
AF222036
AY038014
AY233393
AJ457893
L19021
D13573
AJ344014
AB117181
L39914
U58195
L31949
AJ427304
D00930
D00932
AJ 252130
M73775
AF008675
AF251427
AJ311466
AF501531
AF297097
ISDNCDA001

69

Tabela 16. Amostras com seqncias idnticas (complementao das informaes da rvore genealgica).
Idntica 1
A/Canada/7/88
A/Michigan/22568/99
BR003H3
BR012H3
BR099H1
BR121H1

A/Finland/74/88
A/Virginia/21833/99
BR049H3
BR024H3
BR109H1
BR122H1

A/Fukui/1/01

A/Ireland/649/01

BR011H3
BR006H3
BR053B
BR104H1

A/Finland/380/95
BR008H3
BR055B
BR113H1

Idntica 2

Idntica 3

Idntica 4

Idntica 5

A/Saudi
Arabia/7971/00
A/Osaka/c1/95
BR010H3
BR064B
BR114H1

A/Korea/45/96 A/Brazil/2/95
BR015H3
BR110B
BR126H1
BR126H1
BR140H1

70

V - Discusso
A metodologia empregada neste trabalho seguiu uma estratgia que
permitisse obter dados moleculares diretamente das amostras clnicas
coletadas, com o objetivo de caracterizar variaes moleculares da regio
externa da hemaglutinina do vrus da gripe (HA1). Com o objetivo de
caracterizar variaes moleculares de HA1, foram realizadas reaes
diretamente a partir das amostras clnicas, pois so conhecidos os fenmenos
de mutao no genoma viral durante o processo de cultivo, alm da seleo de
variantes com maior afinidade pelos receptores celulares das culturas,
principalmente quando os vrus so cultivados em ovos embrionados (Rocha e
col., 1993, Gambaryan e col., 1999). Aliado a estes fenmenos est a presso
seletiva exercida pelo hospedeiro que seleciona os vrus mais aptos a escapar
do sistema imune do hospedeiro e com isso gerar novos quadros infecciosos.
A variao continua na seqncia gentica atravs de mutaes de ponto
favorece o surgimento de alteraes nas propriedades antignicas de HA1. O
processo de variao antignica atravs de mutaes pontuais e contnuas
denominada de drift antignico (Plotkin e col., 2002). O monitoramento
continuado dos fenmenos de drift importante para a seleo de cepas
vacinais eficientes (Besselaar e col., 2004).
A tcnica de Nested Multiplex PCR permitiu a deteco de 35
amostras positivas, com 36 produtos de reao independentes, para o vrus
influenza dentre as 148 estudadas (24,3 % do total) A porcentagem na
obteno de amostras positivas utilizando-se esta tcnica pode sofrer grandes
variaes, onde muitos fatores contribuem para isso. Entre eles esto, o
perodo de coleta das amostras, que podem ou no coincidir com picos de
circulao viral, o mtodo de coleta das amostras, o tempo de demora no

71

transporte do material clnico, a temperatura de transporte das amostras, alm


do segmento do genoma viral que escolhido para a deteco. Outros
trabalhos apresentam nveis maiores de deteco viral, ficando em torno de
38%, (Ellis e col., 1997, Koenig e col., 2003). No entanto estes trabalhos
utilizam para a deteco o segmento do genoma codificador da matriz protica
dos vrus da influenza, que possui taxas de mutaes bem inferiores aos
apresentados pela hemaglutinina ou utilizam lavados orofarngeos e aspirados
de secrees nasais que permitem uma maior recuperao viral do que a coleta
empregando esfregao nasal (Cruz e Col., 1987).
A utilizao de "Nested Multiplex PCR" permitiu a deteco de dois
casos de co-infeco, nos quais foram encontrados em uma mesma amostra
(amostras 006 e 015) vrus da influenza do tipo A subtipos H1N1 e H3N2.
Devido ao genoma do vrus da gripe ser segmentado, permite o rearranjo de
genes entre diferentes subtipos virais do tipo A, este processo de rearranjo
gentico denominada de "shift" antignico (Nguyen-Van-Tam e Hampson
2003). Casos de isolamento de vrus do tipo A subtipos H1N1 e H3N2 com
rearranjos em humanos so espordicos (Xu e col., 1993). Apesar destes vrus
rearranjados circularem por breves perodos, no se estabeleceram na
populao at 2001, quando foram identificados vrus da influenza A do
subtipo H1N2 associados a casos de gripe em vrias partes do mundo,
incluindo pases da frica, Amrica, sia e Europa (Xu X e col., 2002). Os
dois casos de co-infeco ocorreram no ano de 2000 e portanto podem servir
de subsdio a teoria de que os rearranjos genticos que deram origem ao
subtipo H1N2, em 2001, ocorreram em uma pessoa infectada com os dois
subtipos originais e que o evento de rearranjo teria ocorrido entre 1999 e o
comeo de 2001 (Ellis e col., 2003).

72

Aps a utilizao do "Nested Multiplex PCR" para a deteco do cido


nuclico viral, tipagem e subtipagem, utilizamos a tcnica de "Nested" e
"Semi-Nested PCR" para a amplificao da regio completa de HA1 da
hemaglutinina dos vrus da influenza A subtipos H1N1 e H3N2 e do tipo B.
Do total de 36 amostras positivas pelo "Nested Multiplex PCR", 3
amostras do tipo A subtipo H3N2 (006, 011 e 013) e uma amostra do subtipo
H1N1 (006) no amplificaram pelas tcnicas de "Nested" e "Semi-Nested
PCR" respectivamente. A diferena nos tamanhos dos produtos obtidos por
ambas as tcnicas pode ter influenciado para a no amplificao destas
amostras. As reaes de "Nested PCR" produzem fragmentos de 1118 pares
de bases (pb) para os vrus do tipo A subtipo H3N2, e o "Nested Multiplex
PCR" gera produtos de 591 pb. Para os vrus do subtipo H1N1 a diferena no
tamanho do produto entre o "Nested Multiplex PCR" e o "Semi-Nested PCR"
de 173 pb, sendo o produto do "Semi-Nested PCR" de 1117 pb e o "Nested
Multiplex PCR" produz fragmentos de 944pb. No entanto, alm do tamanho
dos produtos de PCR, outro fator que pode ter contribudo para a no
amplificao das amostras, pela tcnica de "Nested" e "Semi-Nested PCR", a
alta taxa de mutao que ocorre nos vrus da gripe do tipo A, principalmente
na regio HA1, na qual a taxa de fixao na substituio de aminocidos de
at 7.2 vezes maior que em outras regies do genoma viral, por HA1 estar sob
seleo positiva (Fitch e col., 1997, Ferguson e col., 2003). Com isso, pode ter
ocorrido mutaes em um ou mais stios de ligao dos iniciadores utilizados
para a amplificao por "Nested PCR", podendo prejudicar a eficincia da
reao em cadeia da polimerase. Estas amostras foram seqenciadas partindo
dos produtos gerados pelo "Nested Multiplex PCR".
Das 15 amostras amplificadas pelo mtodo de "Semi-Nested PCR", para
os vrus da influenza A subtipo H1N1, uma amostra (123) no foi seqenciada

73

de modo satisfatrio. Para as reaes de seqnciamento, so utilizados os


mesmos iniciadores das reaes de "Semi-Nested PCR", e estas, so feitas em
duplicatas para cada iniciador, ou seja so feitas duas reaes com o iniciador
H1F (iniciador sense) e duas reaes com o iniciador H1R2 (iniciador Antisense). Para a amostra 123, as reaes de seqnciamento com iniciador antisense produziram um bom resultado, no entanto, as reaes que utilizaram o
iniciador sense, no ficaram boas e no puderam ser utilizadas, isso ocorreu
em todas as repeties feitas com a amostra 123. Aparentemente, o iniciador
sense se liga em outra regio do produto do "Semi-Nested PCR" e
impossibilita a leitura da seqncia. Fenmeno semelhante ocorreu com a
amostra 017 do tipo B. No entanto, para esta amostra foi possvel obter dados
de seqncia dos produtos de "Nested Multiplex PCR".
Todas as seqncias geradas foram comparadas com seqncias
depositadas no "Genbank" (www.ncbi.nlm.nih.gov). A maioria das amostras
do tipo A subtipo H1N1, como esperado, tiveram maior semelhana com
seqncias depositadas de amostras que foram coletadas nos anos de 2000 e
2001, sugerindo que os vrus do tipo A subtipo H1N1 que provocou gripe aqui
no Brasil, e especificamente na cidade So Paulo foram similares aos vrus
epidmicos de outras regies do planeta para o mesmo perodo. No entanto, a
seqncia obtida da amostra 006, coletada de um paciente com AIDS que
estava internado no Instituto da Criana (FMUSP), mostrou maior
similaridade com seqncias, depositadas no "Genbank", de amostras de
influenza circulantes nos anos de 1988 e 1989, ou seja, amostras presentes na
populao humana 11 ou 12 anos antes da amostra 006 ser coletada. O
reaparecimento deste variante, provavelmente, est relacionado baixa
imunidade do paciente, no entanto, este foi um caso isolado no sendo
detectado em amostras coletadas no ano seguinte (2001). Podemos especular

74

que este vrus permaneceu circulante na populao, principalmente em


crianas menores de 12 anos, causando quadros gripais brandos, ou at mesmo
assintomticos, e somente provocando um quadro gripal mais intenso em um
paciente imunodeprimido. Em 2000 e 2001 foi relatado (Shaw e col., 2002) o
reaparecimento, depois de uma dcada, de um variante do vrus da influenza
tipo B antignicamente semelhante a vrus dos anos de 1987 e 1988. Este
variante que havia ficado isolado no leste da sia desde 1992, ressurgiu em
vrias partes do mundo causando epidemias.
As seqncias do tipo A subtipo H3N2 tambm foram comparadas com
as seqncias depositadas no "Genbank", e de modo inesperado formaram trs
grupos distintos, nos quais, as amostras 003, 012, 024, 049 e 125, foram mais
similares as seqncias depositadas de amostras virais do ano de 1999 do
hemisfrio norte, sugerindo a sua origem neste hemisfrio com fluxo destes
vrus para o hemisfrio sul. No entanto, as seqncias referentes s amostras
011 e 013 foram similares as seqncias do "Genbank" do ano de 1995,
incluindo um variante do Brasil (A/Brazil/2/95). Como ambas as amostras
foram coletadas de crianas com 4 anos de idade, nos d a idia da
possibilidade desses variantes ainda circularem em crianas que eram menores
de 5 anos e que portanto, no possuam imunidade contra este variante de
1995. Fato semelhante ocorreu com seqncias obtidas das amostras 006, 008,
009, 010 e 015 que foram similares a seqncias de vrus circulantes no ano
de 1991, ou seja 9 anos antes da coleta dessas amostras em 2000. Ao
conferirmos a idade dessas crianas, (apndice 1), vimos que a criana mais
velha a sofrer de gripe causada por este variante tinha 9 anos de idade
(amostra 009) e que a mais nova tinha apenas 3 meses (amostra 10), sugerindo
que esse vrus estavam circulando entre as crianas no nascidas ou no

75

infectadas na poca do surgimento deste variante, e que no ano de 2000, por


no possurem imunidade especfica desenvolveram quadros de gripe.
A existncia destes variantes em circulao, pelo menos na populao
infantil, pode gerar novas epidemias, pois como a vacina feita tomando
como base os dados coletados no ano anterior ao da vacinao, pode ocorrer
que estes variantes, de origem mais antiga, causem novos surtos de gripe.
As reaes de seqnciamento sense e anti-sense da amostra 018 do
subtipo H3N2 produziram seqncias em que apenas 200 nucleotdeos
tiveram boa qualidade. Esta seqncia de 200 nucleotdeos quando comparada
com as seqncias depositadas no "Genbank", mostrou maior similaridade
com uma seqncia de cromossomo 1 humano com funo no descrita, por
eventual contaminao do DNA (nmero de acesso AL445591). A
similaridade encontradada foi de 98%.
A seqncia peptdica completa da regio HA1 da hemaglutinina do
tipo B possui um tamanho de 346 aminocidos. A regio por ns estudada
possui 322 resduos de aminocidos, portanto, representam 93% do tamanho
total da regio HA1. As seqncias que obtivemos de amostras do tipo B
foram similares a seqncias depositadas no "Genbank" do hemisfrio norte
dos anos de 1998 e 1999, sugerindo que estes variantes que causaram gripe na
cidade de So Paulo nos anos de 2000 e 2001 tenham vindo do hemisfrio
norte. No entanto, como os banco de dados internacionais possuem mais
seqncias provenientes de pases, do hemisfrio norte, como Estados Unidos,
Japo, e pases da Europa, pode ser que a similaridade encontradas com
variantes advindos destes locais e os variantes que coletamos seja
superestimada visto que poucas seqncias do hemisfrio sul compem os
bancos de dados internacionais.

76

Para corroborar os resultados de tipagem e subtipagem pelo


"Nested Multiplex PCR", obtivemos uma rvore genealgica utilizando
seqncias de nucleotdeos obtidas no "Genbank" (figura 11). A rvore
genealgica contm trs grupos distintos, um grupo formado pelas amostras
do tipo A subtipo H3N2, outro grupo formado pelas seqncia de vrus do tipo
A subtipo H1N1 e o terceiro grupo formado por amostras do tipo B. Essa
anlise teve como funo apenas agrupar seqncias de nucleotdeos de
acordo com sua semelhana, sendo til para identificar amostras que
pertencem a uma mesma famlia, gnero, espcie ou no caso dos vrus da
gripe, gentipos.
A Organizao Mundial da Sade (OMS) recomenda em 1o de outubro
a vacina que ser utilizada a partir de maio do ano seguinte no hemisfrio sul.
Portanto, a vacina composta por cepas que causaram epidemias ou surtos
gripais no ano anterior ao da vacinao, assim, para os anos 2000 e 2001,
foram selecionadas variantes que provocaram gripe em vrias partes do
mundo nos anos de 1999 e 2000. Portanto, para a composio da vacina contra
gripe distribuda no ano de 2000, a OMS recomendou como padro
antignico,

as

seguintes

cepas:

A/Moscow/10/99

(H3N2),

A/New

Caledonia/20/99 (H1N1) e B/Beijing/184/93 (Weekly Epidemiological


Record, 1999). No entanto, a OMS, devido a dificuldades na produo da
vacina com a cepa A/Moscow/10/99 (H3N2), e que por falta de tempo hbil,
autorizou a utilizao da cepa vacinal A/Sydney/5/97 (H3N2), originalmente
recomendada para o ano de 1999 (Weekly Epidemiological Record, 1999).
Para o ano de 2001, a OMS recomendou como padro antignico para a
composio da vacina as cepas, A/Moscow/10/99 (H3N2), A/New
Caledonia/20/99 (H1N1) e B/Sichuan/379/99 (Weekly Epidemiological
Record, 2000).

77

Quando comparamos as seqncias das nossas amostras do tipo A


subtipo H1N1, com a seqncia de aminocidos da cepa vacinal (A/New
Caledonia/20/99) que comps a vacina de 2000 e 2001, encontramos 20
aminocidos diferentes. Sendo que destas 20 diferenas, 10 esto localizadas
em stios antignicos (tabela 09). Os stios antignicos so regies da protena
onde se ligam anticorpos. Mutao nestes stios podem provocar alteraes em
sua conformao e com isso favorecer a evaso desse variante do sistema
imune do hospedeiro. As mutaes que ocorrem fora dos stios antignicos
descritos tambm podem influenciar na antigenicidade da hemaglutinina. Na
amostra 006 foram encontradas 13 diferenas de aminocidos quando
comparada com a cepa vacinal. Sendo que 7 alteraes ocorreram nos stios
antignicos A, B, C, D e E (tabela 09). Na amostra 15, foram encontradas 2
alteraes, sendo que a alterao no resduo 162 pode acarretar alterao na
conformao do stio antignico Sa. A anlise das seqncias de HA1 obtidas
das amostras 006 e 015 para o subtipo H1 (amostras de co-infeco)
demonstrou que estes vrus so do subtipo H1N1 e no H1N2, visto que estes
ltimos s apareceram em 2001, e que os vrus do subtipo H1N2 possuem
substituies nos resduos 178, 193 e 218 da regio HA1 da hemaglutinina
(Ellis e col., 2003). As seqncias das amostras 006 e 015 no possuem estas
alteraes. A amostra 103 possui 03 alteraes de aminocidos da regio HA1
em relao vacina. Sendo que uma alterao ocorreu no resduo 165 que
pertence ao stio antignico Ca1 (tabela 09). As amostras 121 e 122
apresentaram 4 alteraes de aminocidos em relao regio HA1 da cepa
vacinal. Destas, 2 pertencerem aos stios antignicos Ca1 e ocorreram nos
resduos 121 e 165, as outras duas ocorrem nos resduos 251 e 309. A amostra
101 possui 3 alteraes em relao seqncia de aminocidos da vacina,
destas somente a que ocorre no resduo 165 pertencente a um stio

78

antignico (Ca1). As demais amostras apresentaram alteraes em relao


seqncia de aminocidos de HA1 da vacina nos resduos 165 e 251, sendo o
resduo 165 pertencente ao stio antignico da hemaglutinina Ca1. Quanto
maior for a diferena da seqncia de aminocidos de HA1 da cepa vacinal e
do variante epidmico pior ser a proteo proporcionada pela vacina (Pyhl
e col., 2002).
Nas amostras do tipo A subtipo H3N2 encontramos 42 diferenas entre
as seqncias de aminocidos das amostras coletadas em 2000 e a seqncia
da cepa vacinal (A/Sydney/5/97). Destas, 36 ocorreram nos stios antignicos
descritos e potencialmente provocam alteraes na conformao de HA1 nas
regies de ligao do anticorpo favorecendo o escape dos variantes do sistema
imunolgico (Nakajima e col., 2000). As amostras 03, 12 e 49 tiveram 12
diferenas de aminocidos em comparao com a cepa vacinal de 2000, sendo
que 8 foram em stios antignicos (tabela 10). A amostra 24 teve 13 diferenas
em relao cepa vacinal e como as amostras 03, 12, e 49 apresentaram 8
diferenas em stios antignicos. As amostras 08, 09 e 15 tiveram 21
diferenas em suas seqncias de aminocidos quando comparadas com as
seqncias de aminocidos da cepa A/Sydney/5/97, sendo 20 em stios
antignicos. O mesmo nmero de diferenas nos stios antignicos foi
apresentado pela amostra 10, no entanto esta amostra teve o total de 22
diferenas. A amostra 06 teve 19 diferenas entre sua seqncia de
aminocidos e a da cepa vacinal, sendo todas localizadas em stios antignicos
descritos. A amostra 11 teve 14 diferenas na comparao de sua seqncia
peptdica com a seqncia da cepa vacinal, todas em stios antignicos. O
mesmo ocorreu com a amostra 13, porm esta apresentou 15 diferenas, todas
localizadas em regies de stios antignicos. Portanto, as amostras de
influenza do tipo A subtipo H3N2 coletadas se mostraram bastante

79

heterogneas e com muitas alteraes em todos os stios antignicos (tabela


10), a exceo de 4 amostras (3, 12, 24 e 49) que no apresentaram alterao
no stio C, a quantidade de alteraes encontradas, sugere que para o ano de
2000 a vacina poderia no ter sido totalmente eficaz.
No ano 2001 OMS indicou a cepa vacinal do tipo A subtipo H3N2,
A/Panama/2007/99, para a composio da vacina. A comparao de sua
seqncia peptdica com a da amostra 125, coletada no ano de 2001, mostrou
o total de 10 diferenas de aminocidos, sendo 2 mutaes localizadas em
stios antignicos. Os dados de seqncia dos anos de 2000 e 2001, nos
indicam que as amostras coletadas em 2000, principalmente as amostra 003,
049, 012 e 024, seriam melhores candidatas composio da vacina que a
cepa vacinal (A/Panama/2007/99), pois estas amostras possuem apenas dois
aminocidos de diferenas entre elas e a amostra do ano 2001, e nenhuma
destas alteraes se localizam em stios antignicos.
As seqncias de aminocidos dos vrus tipo B coletados foram
comparadas com as seqncias de aminocidos das cepas vacinais propostas
pela OMS. Para o ano de 2000 a OMS props a amostra do tipo B
B/Yamanashi/166/98. A comparao de sua seqncia de aminocidos com as
seqncias das amostras coletadas mostrou 7 diferenas de aminocidos. Os
vrus tipo B no possuem stios antignicos descritos. As amostras 53, 55 e 64
tiveram 5 diferenas de aminocidos de suas seqncias peptdicas em relao
seqncia da cepa vacinal, as amostras 74 e 79 tiveram 6 diferenas e a
amostra 17 teve 4 diferenas. Em 2001 a OMS indicou a amostra do tipo B
B/Sichuan/379/99 para a composio da vacina (tabela 12). A seqncia de
aminocidos da amostra 110 do tipo B, quando comparada com a da cepa
vacinal, mostrou 4 resduos de diferena (tabela 13). O nmero de diferenas
apresentado significativo (Besselaar e col., 2004), pois, os vrus da influenza

80

tipo B so geneticamente mais estveis que os vrus do tipo A e toda variao


encontrada pode favorecer seu escape do sistema imunolgico do paciente. Os
dados de seqncia dos anos de 2000 e 2001, sugerem que as amostras
coletadas em 2000, seriam melhores candidatas composio da vacina que a
cepa vacinal (B/Sichuan/379/99), pois estas amostras possuem apenas 1
aminocido de diferena entre elas e a amostra do ano 2001, enquanto a cepa
vacinal possui 4 diferenas com a amostra 110.
Os dados pertinentes ao hemisfrio sul so muito escassos, podendo
gerar em casos extremos, a seleo de variantes, devido utilizao de cepas
vacinais antignicamente diferentes dos vrus circulantes. Com esse trabalho
estamos contribuindo para o aumento dos dados de seqncias para o
hemisfrio sul e especialmente o Brasil que possui pouqussimas seqncias
depositadas no bancos de dados internacionais.

81

VI Concluso
Com base nos resultados obtidos podemos concluir:
1) A tcnica de "Nested Multiplex PCR" eficiente para a deteco, tipagem e
subtipagem de amostras clnicas com rapidez e sensibilidade.
2) Variantes de influenza caractersticos de anos passados, at 12 anos, podem
circular em crianas e causar gripe em imunodeprimidos ou pessoas
suscetveis.
3) Casos de co-infeces como as aqui relatadas, do subsdio teoria de
surgimento do novo subtipo H1N2.
4) O nmero de alteraes de aminocidos verificadas entre as seqncias
obtidas das amostras estudadas e as seqncias das cepas vacinais indica a
necessidade de monitorao anual dos vrus influenza em circulao no Brasil.
5) Mais dados de seqncias do hemisfrio sul so necessrios para a melhor
escolha das cepas vacinais.
6) As alteraes encontradas nos vrus da influenza A subtipo H3N2 sugerem
que a vacina pode no ter sido eficiente no ano de 2000.
7) As amostras coletadas no ano de 2000 do tipo A subtipo H3N2 tendo em
vista a seqnciamento de uma s amostra em 2001, aparentemente seriam
melhores candidatas composio da vacina para o ano 2001.
8) As amostras coletadas em 2000 para o tipo B seriam melhores candidatas
para a composio da vacina para o ano de 2001; onde s obtivemos o
seqnciamento

de

uma

amostra.

82

VII Variantes moleculares do vrus influenza


Epidemias anuais de influenza so causadas pela rpida evoluo do
genoma viral. Variao extensa e contnua tem sido observada na
molcula de hemaglutinina (HA) atravs de processos de drift
antignicos. Devido rpida variao, particularmente do domnio
HA1 molcula de HA, a composio da vacina tem que ser
atualizada todos os anos. Monitoramento de variantes em circulao
necessrio para a seleo de cepas vacinais eficientes. Foram
coletados, atravs de esfregaos nasais, 148 amostras clnicas de
crianas com sintomas de gripe no pronto socorro do Instituto da
Criana (FMUSP) durante os anos de 2000 e 2001. Atravs da
tcnica de "Nested Multiplex PCR" foram detectados 36 amostras
positivas (24,3%). A comparao das seqncias de aminocios das
amostras de influenza A H1N1 de 2000 e 2001 com a cepa vacinal
A/New Caledonia/20/99 revelou 20 diferenas de resduos nas
seqncias de aminocidos. J a comparao das seqncias de
aminocidos de amostras de influenza A H3N2 com a seqncia da
cepa vacinal de 2000 (A/Sydney/5/97) e 2001(A/Panama/2007/99)
mostrou 52 alteraes de aminocidos. A comparao da seqncia
de aminocidos de HA1 de amostras de influenza B coletadas em
2000 e 2001 com as cepas vacinais, A/Yamanashy/166/98 e
B/Sichuan/379/99 revelou 11 alteraes de aminocidos. Nosso
trabalho pioneiro na implantao da tcnica de "Nested Multiplex
RT-PCR" para tipagem e subtipagem de amostras de vrus influenza
no Brasil, assim como, tambm o na avaliao de seqncias de
nucleotdeos e aminocidos de HA1. Nossos resultados reforam a
necessidade de monitorao de variantes, em nosso meio, dos vrus
da gripe atravs das tcnicas por ns implantadas.

83

VIII - Molecular variants of influenza virus


Annual infuenza epidemics are caused by rapid evolution of the viral
genome. Continuous and extensive antigenic variation has been shown for
hemagglutinin (HA), by antigenic drift process. Due to rapid antigenic
drift, particularly of the HA1 domain of the HA molecule, the vaccine
composition has to be updated annually. Monitoring the antigenicity
circulating infuenza viruses is necessary for selection of the most suitable
vaccine strains. Nasal swabs, in a total of 148 samples, were obtained from
children with influenza like illness by a physician of Instituto da Criana
(FMUSP) during 2000 and 2001. By multiplex PCR 36 (24,3%) positive
samples were detected. The sequences analysis of the influenza A and B
samples revealed a significant drift in the amino acids residues compared
with vaccines strains for 2000 and 2001. Sequence comparison of the 2000
and 2001 flu A H1N1 samples with A/New Caledonia/20/99 vaccine strain
revealed differences in 20 amino acids residues. Comparison of flu A
H3N2 sequences with 2000 vaccine strain (A/Sydney/5/97) showed 42
changes of amino acids residues. For 2001, comparison of flu A H3N2 and
vacine strain (A/Panama/2007/99) showed 10 changes of amino acids
residues. Sequence comparison of the 2000 influenza B samples with
A/Yamanashy/166/98 vaccine strain revelead diferences in 7 amino acids
residues.

For

2001,

comparison

of

flu

B and

vaccine

strain

(B/Sichuan/379/99) showed 4 changes of amino acids residues. Our work is


pioneer to establish of a Nested Multiplex RT-PCR technic for type and
subtype of influenza virus in Brazil and analysis of HA1 nucloetide and
aminoacids sequences. Our results increase the needs of a monitoring the
variants of influenza virus in Brasil by technic that we establish.

84

IX Apndice 1. Dados gerais dos pacientes


No da

Data da

Idade do

Doena de

amostra

coleta

Paciente

Base

001

30/05/00

53 anos

---

---

negativa

002

30/05/00

57 anos

---

---

negativa

003

15/06/00

40 anos

---

---

H3N2

004

15/06/00

24

---

---

negativa

005

16/06/00

Aids

---

negativa

006

16/06/00

Aids

---

007

06/07/00

---

---

negativa

008

06/07/00

3 anos

---

---

H3N2

009

06/07/00

9 anos

---

---

H3N2

010

6 meses

---

---

H3N2

011

06/07/00
07/07/00

4 anos

Neuropatia

---

H3N2

012

07/07/00

10 meses

---

---

H3N2

013

07/07/00

4 anos

---

---

H3N2

014

12/07/00

3 meses

---

---

negativa

015

12/07/00

5 anos

---

---

016

12/07/00

4 meses

---

---

negativa

---

---

Tipo B

---

---

H3N2

017

12/07/00

018

14/07/00

no
fornecida
no
fornecida
7 anos e 10
meses

no
fornecida
2 anos e 11
meses

Observaes

Multiplex
PCR

H1N1 e
H3N2

H1N1 e
H3N2

85

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

019

14/07/00

020

14/07/00

021

14/07/00

022

19/07/00

023

19/07/00

2 anos e 10

Observaes

Multiplex
PCR

---

---

negativa

7 meses

---

---

negativa

8 meses

---

---

negativa

Cardiopatia

---

negativa

---

---

negativa

---

---

H3N2

meses

no
fornecida
8 meses
10 anos e

024

19/07/00

025

10 anos

---

---

negativa

026

19/07/00
21/07/00

10 meses

---

---

negativa

027

21/07/00

1 ano

---

---

negativa

028

26/07/00

2 anos

---

---

negativa

029

26/07/00

2 anos

---

---

negativa

030

26/07/00

2 meses

---

---

negativa

031

2 anos

---

---

negativa

032

26/07/00
01/08/00

1 ms

---

---

negativa

033

01/08/00

---

---

negativa

034

01/08/00

2 anos

---

---

negativa

035

01/08/00

3 anos

---

---

negativa

036

01/08/00

10 anos

---

---

negativa

037

30 anos

---

---

negativa

038

01/08/00
28/07/00

45 anos

---

---

negativa

039

31/07/00

40 anos

---

---

10 meses

1 ano e 9
meses

negativa

86

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

040

01/08/00

42 anos

---

---

negativa

041

03/08/00

27 anos

---

---

negativa

042

04/08/00

Diarria

---

negativa

043

05/08/00

5 anos

---

---

negativa

044

09/08/00

33 anos

---

---

negativa

045

10/08/00

38 anos

---

---

negativa

046

11/08/00

3 anos

---

---

negativa

047

11/08/00

28 anos

---

---

negativa

048

11/08/00

14 anos

Aids

---

negativa

049

15/08/00

5 anos

---

---

H3N2

050

15/08/00

23 anos

---

---

negativa

051

16/08/00

40 anos

---

---

negativa

052

16/08/00

20 anos

---

---

negativa

053

17/08/00

6 anos

AIDS

---

Tipo B

054

17/08/00

10 anos

AIDS

---

negativa

Neuroglioma

---

Tipo B

---

negativa

1 ano e 9
meses

1 ano e 5

Observaes

Multiplex
PCR

055

17/08/00

056

17/08/00

2 anos

057

17/08/00

30 anos

---

---

negativa

058

17/08/00

24 anos

---

---

negativa

059

17/08/00

7 anos

---

---

negativa

060

18/08/00

38 anos

---

---

negativa

061

21/08/00

21 anos

---

---

meses

Insuficincia
renal

negativa

87

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

Observaes

Multiplex
PCR

Meningite
062

23/08/00

10 meses

---

negativa

---

negativa

Hidrocefalia

---

Tipo B

---

---

negativa

---

---

negativa

---

---

negativa

---

---

negativa

---

negativa

---

negativa

---

negativa

---

Grvida

negativa

---

---

negativa

---

---

Tipo B

em
tratamento

063

23/08/00

064

23/08/00

065

31/08/00

066

31/08/00

067

31/08/00

068

05/09/00

12 meses
1 ano e 2
meses
no
fornecida
no
fornecida
no
fornecida
7 meses

Fibrose
cstica

Insuficincia
069

05/09/00

18 anos

Renal
Crnica

070

05/09/00

1 ms e 4
dias

--Insuficincia

071

05/09/00

5 anos

Renal
Crnica

072

12/09/00

073

12/09/00

074

14/09/00

27 anos
2 anos e 3
meses
28 anos

88

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

075

14/09/00

076

14/09/00

077

no

Observaes

Multiplex
PCR

---

---

negativa

11 meses

---

---

negativa

14/09/00

3 anos

---

---

negativa

078

19/09/00

4 meses

---

---

negativa

079

19/09/00

---

---

Tipo B

fornecida

no
fornecida

Teste Rpido
080

22/09/00

27 anos

---

para
influenza

negativa

negativo
Teste Rpido
081

22/09/00

no
fornecida

---

para
influenza

negativa

negativo
082

28/09/00

5 meses

---

---

negativa

083

04/10/00

10 meses

Conjuntivite

---

negativa

Teste Rpido
084

04/10/00

no
fornecida

---

para
influenza

negativa

negativo
085

11/10/00

5 meses

---

Gemelar 1

negativa
negativa

086

11/10/00

5 meses

---

Gemelar 2

89

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

Observaes

Multiplex
PCR

Teste Rpido
087

11/10/00

1 ano e 3
meses

---

para
influenza

negativa

negativo
088

11/10/00

10 anos

089

24/10/00

35 anos

090

24/10/00

091
092

24/10/00
04/07/01

093

Crise de

---

negativa

---

---

negativa

12 anos

---

---

negativa

4 anos

---

---

negativa

26 anos

---

---

negativa

04/07/01

7 meses

---

---

negativa

094

04/07/01

11 anos

---

---

negativa

095

04/07/01

---

---

negativa

096

04/07/01

2 anos

---

---

negativa

097

04/07/01

4 anos

---

---

negativa

098

04/07/01

5 meses

---

---

negativa

099

05/07/01

13 anos

---

---

H1N1

100

05/07/01

---

---

negativa

101

05/07/01

6 meses

---

---

H1N1

102

05/07/01

11 anos

---

---

negativa

103

09/07/01

24 anos

---

---

H1N1

104

09/07/01

5 anos

---

---

H1N1

105

09/07/01

---

---

negativa

2meses e 15
dias

2 anos e 9
meses

no
fornecida

asma

90

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

106

12/07/01

5 anos

---

---

negativa

107

12/07/01

23 anos

---

---

negativa

108

12/07/01

4 anos

Pneumonia

---

negativa

109

16/07/01

3 anos

---

---

H1N1

110

16/07/01

---

---

Tipo B

111

16/07/01

---

---

negativa

112

16/07/01

24 anos

---

---

H1N1

113

18/07/01

40 anos

---

---

H1N1

114

18/07/01

3 anos

Leucemia

---

H1N1

115

18/07/01

1 ano

---

---

negativa

116

18/07/01

25 anos

---

---

negativa

117

25/07/01

27 anos

---

---

negativa

118

25/07/01

8 meses

Convulso

---

negativa

119

25/07/01

---

---

negativa

120

27/07/01

---

---

H3N2

121

27/07/01

1 ano

---

---

H1N1

122

27/07/01

3 anos

---

---

H1N1

123

27/07/01

5 anos

---

---

H1N1

124

30/07/01

4anos

---

---

negativa

125

30/07/01

---

---

H3N2

126

30/07/01

---

---

H1N1

1 ano e 3
meses
4 anos e 9
meses

1 ano e 6
meses
no
fornecida

1 ano e 11
meses
1 ano

Observaes

Multiplex
PCR

91

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

127

30/07/01

28 anos

---

---

negativa

128

30/07/01

6 meses

---

---

negativa

129

03/08/01

23 anos

---

---

negativa

130

03/08/01

5 meses

---

---

negativa

131

03/08/01

10 meses

---

---

negativa

132

06/08/01

1 ano

---

Filho

negativa

133

06/08/01

30 anos

---

Me

H1N1

134

06/08/01

---

---

negativa

135

06/08/01

2 anos

Otite

---

negativa

136

08/08/01

29 anos

---

---

negativa

137

08/08/01

---

Internada

negativa

138

08/08/01

Otite

---

negativa

139

08/08/01

---

---

negativa

140

10/08/01

9 anos

---

---

H1N1

141

10/08/01

2 anos

---

---

negativa

142

10/08/01

---

---

negativa

143

13/08/01

3 anos

---

---

negativa

144

13/08/01

5 meses

---

---

negativa

145

13/08/01

5 meses

---

---

negativa

146

15/08/01

1 ano e 6
meses

1 ano e 4
meses
6 meses
1 ano e 7
meses

1 ano e 10
meses

no
fornecida

Observaes

Multiplex
PCR

negativa
---

---

92

No da

Data da

Idade do

Doena de

amostra

coleta

Pacinte

Base

147

15/08/01

148

15/08/01

no
fornecida
no
fornecida

Observaes

Multiplex
PCR

---

---

negativa

---

---

negativa

93

X Apndice 2. Distribuio das amostras.


As amostras clnicas de gripe foram coletadas no perodo de
maior incidncia dos casos, ou seja, entre os meses de maio e outubro
para o ano de 2000 e julho e agosto para o ano de 2001 (figura 4 e 5).
Coletamos 148 amostras em dois anos consecutivos com o total de
36 registros positivos (24.3%) para o vrus da influenza atravs da
metodologia de "Multiplex PCR". No ano 2000 foram coletadas 91
amostras com o total de 20 produtos de "Nested Multiplex RT-PCR"
detectados (22%) (figura 4). Em 2001 foram coletadas 57 amostras de
pacientes com suspeita de gripe, sendo 16 positivas (28%) (figura 5). A
idade dos pacientes variou de 1 ms a 57 anos. No entanto, maior parte da
populao analisada, 92 pacientes (62%), situou-se na faixa etria de 1
ms a 10 anos. Quarenta pacientes tinham idade entre 11 e 57 anos e, em
16 registros no constava a idade dos pacientes (figura 6).

94

Nmero de Amostras

Fig. 4 - Distribuio das Coletas feitas no Ano de 2000.


50
45
40
35
30
25
20
15
10
5
0

42

25
15

14

9
4

30/05 a 19/07 20/07 a 31 /08 01/09 a 30/09

Perodo das Coletas

0
01/10 a 24/10

As barras azuis indicam o nmero de amostras coletadas no perodo e as barras


laranjas representam o nmero de amostras positivas pela tcnica de "Nested
Multiplex RT-PCR" neste mesmo perodo. O perodo foi distribudo para a melhor
apresentao da figura.

95

Fig. 5 - Distribuio das Coletas feitas no Ano de 2001.


18
Nmero de Amotras

16
14

16
14

14

13

12
10
8
6
4

2
0

04/07 a 11/07 12/07 a 25/07 26/07 a 06/08

07/08 a 15/08

Perodo das Coletas


As barras azuis indicam o nmero de amostras coletadas no perodo e as barras
vermelhas representam o nmero de amostras positivas pela tcnica de "Nested
Multiplex RT-PCR". O perodo foi distribudo para a melhor apresentao da figura.

96

Fig. 6 Faixa etria dos pacientes (anos de 2000 e 2001).

Nmero de Pacientes

70
60

0 - 2 anos

60

3 - 5 anos

50

6 - 10 anos

40
30
20
10

11 - 18 anos
22

19
10

15

16

19 - 29 anos
30 - 57 anos
Sem Registro

0
Idade dos Pacientes

A distribuio do perodo de idades apresentada foi feita para a melhor apresentao


da figura.

97

XI - Referncias Bibliogrficas
Akazawa, M., Sindelar J. L., Paltiel, A. D. (2003). "Economic costs of
influenza-related work absenteeism." V. Health 6(2): 107-115.
Ali, A., Avalos, R. T., Ponimaskin, E., Nayak, D. P. (2000). "Influenza virus
assembly: effect of influenza virus glycoproteins on the membrane
association of M1 protein." J. Virol. 74(18): 8709-8719.
Arrese, M., Portela, A. (1996). "Serine 3 is critical for phosphorylation at the
N-terminal end of the nucleoprotein of influenza virus A/Victoria/3/75." J
Virol. 70(6):3385-3391.
Barman, S., Ali, A., Hui, E. K., Adhikary, L., Nayak, D. P. (2001). "Transport
of viral proteins to the apical membranes and interaction of matrix protein
with glycoproteins in the assembly of influenza viruses." Virus Res. 77(1):
61-69.
Berton, M. T., Naeve, C. W., Webster, R. G. (1984). "Antigenic structure of
the influenza B virus hemagglutinin: nucleotide sequence analysis of
antigenic variants selected with monoclonal antibodies." J. Virol. 52(3):
919-927.
Besselaar, T. G., Blackburn, N. K., Schoub, B. D. (1996) "The molecular
characterization of influenza virus strains isolated in South Africa during
1993 and 1994." Res. Virol 147: 239-245.
Besselaar T. G., Botha L., McAnerney J. M, Schoub B. D. (2004).
"Phylogenetic studies of influenza B viruses isolated in southern Africa:
19982001." Virol. Res. 103: 61-66.

98

Betakova, T., Nermut, M. V., Hay, A. J. (1996). "The NB protein is an


integral component of the membrane of influenza B virus." J. Gen. Virol.
77: 2689-2694.
Biswas, S. K., Boutz, P. L., Nayak, D. P. (1998). "Influenza virus
nucleoprotein interacts with influenza virus polymerase proteins." J. Virol.
72(7): 5493-5501.
Braakman, I., Anken, E. (2000). "Folding of viral envelope glycoproteins in
the endoplasmic reticulum. " Traffic 1: 533-539.
Braam, J., Ulmanem, I., Krug, R. M., (1983). "Molecular model of a
eukariotic transcription complex: functions and movements of influenza P
proteins during capped RNA-primed transcription." Cell 34: 609-618.
Brassard, D. L., Leser, G. P., Lamb, R. A. (1996). "Influenza B virus NB
glycoprotein is a component of virions." Virology 220: 350-360.
Bridges, C. B., Kuehnert, M. J., Hall, C. B. (2003). "Transmission of
influenza: implications for control in health care settings." Clin Infect Dis.
37(8): 1094-1101.
Brown, E. G. (2000). "Influenza virus genetics." Biomed. Pharmacother.
54(4): 196-209.
Brown, E. G., Bailly, J. E. (1999). "Genetic analysis of mouse-adapted
influenza A virus identifies roles for the NA, PB1, and PB2 genes in
virulence." Virus Res., 61(1): 63-76.

99

Bush, R. M., Fitch, W. M., Bender, C. A., Cox, N. J. (1999). "Positive


selection on the H3 hemagglutinin gene of human influenza virus A." Mol.
Biol. Evol. 16(11): 1457-1465.
Capua, I., Alexander, D. J. (2002). "Avian influenza and human health." Acta
Trop. 83(1): 1-6.
Caton, A. J., Brownlee, G. G., Yewdell, J. W., Gerhard, W. (1982). "The
antigenic structure of the influenza virus A/PR/8/34 hemagglutinin (H1
subtype)." Cell 31 (2): 417-427.
Chen, Z., Krug, R. M. (2000). "Selective nuclear export of viral mRNAs in
influenza-virus-infected cells." Trends Microbiol. 8(8): 376-383.
Chen, Z., Li, Y., Krug, R. M. (1999). "Influenza A virus NS1 protein targets
poly(A)-binding protein II of the cellular 3'
-end processing machinery."
EMBO J., 18(8): 2273-2283.
Chung, T. D., Cianci, C., Hagen, M., Terry, B., Matthews, J. T., Krystal, M.,
Colonno, R. J. (1994). "Biochemical studies on capped RNA primers
identify a class of oligonucleotide inhibitors of the influenza virus RNA
polymerase." Proc. Natl. Acad. Sci. U. S. A 91(6): 2372-2376.
Colman, P. M. (1998). "Structure and function of the neuraminidase " p. 6573. in K. G. Nicholson, R. G. Webster, A. J. Hay (ed.), Textbook of
influenza. Blackwell Science, London, England.
Compans, R. W., Duesberg, J. P. (1972). "Structure of the ribonucleprotein of
influenza virus." Virology 10: 795-800.

100

Cox, N. J., Subbarao, K. (2000). "global epidemiology of influenza: past and


present." Annu. Rev. Med. 51: 407-421.
Cox, N. J., Tamblyn, S. E., Tam, T. (2003). "Influenza pandemic planning."
Vaccine 21(16): 1801-1803.
Crescenzo-Chaigne, B., Naffakh, N., Werf, S. (1999). "Comparative analysis
of the ability of the polymerase complexes of influenza viruses type A, B
and C to assemble into functional RNPs that allow expression and
replication of heterotypic model RNA templates in vivo." Virology 265(2):
342-353.
Cruz, J. R., Quionez, E., Fernandez, A., Peralta, F. (1987). "Isolation of
viruses from nasopharyngeal secretions: comparison of apiration and
swabbing as means of sample collection." J. infect. Dis. 156(2): 415-416.
Dessellberger, U., Racianello, V. R., Zazra, J. J., Palese, P. (1980). "The 3and 5-terminal sequences of influenza A, B and C viruses are higly
conserved and show partial inverted complementarity." Gene 8: 315-328.
Drescher, J., Aron, R. (1999). "Influence of the amino acid differences
between the hemagglutinin HA1 domains of influenza virus H1N1 strains
on their reaction with antibody." J. Med. Virol. 57(4): 397-404.
Egorov, A., Brandt, S., Sereinig, S., Romanova, J., Ferko, B., Katinger, D.,
Grassauer, A., Alexandrova, G., Katinger, H., Muster, T. (1998).
"Transfectant influenza A viruses with long deletions in the NS1 protein
grow efficiently in Vero cells." J. Virol. 72(8): 6437-6441.
Ellis, J. S., Alvarez-Aguero, A., Gregory V., Lin Y. P. Hay A., Zambom M. C.
(2003). "Influenza AH1N2 viruses, United Kingdom, 2001-02 influenza

101

season." Emerg. Infect. Dis. 9(3): 304-310.


Ellis, J. S., Chakraverty P., Clewley,W. (1995). "Genetic and antigenic
variation in the haemagglutinin of recently circulating human influenza
A(H3N2) viruses in the United Kingdom." Arch. Virol. 140: 1889-1904.
Ellis, J. S., Fleming, D. M., Zambon, M. C. (1997). "Multiplex Reverse
Transcription-PCR for Surveillance of Influenza A and B Viruses in
England and Wales in 1995 and 1996." J. Clin. Microbiol. 35: 2076-2082.
Elster, C., Fourest, E., Baudin, F., Larsen, K., Cusack, S., Ruigrok, R. W.
(1994). "A small percentage of influenza virus M1 protein contains zinc
but zinc does not influence in vitro M1-RNA interaction." J. Gen. virol. 75
(1): 37-42.
Epand, R. S., Epand, R. M. (2003). "Irreversible unfolding of the neutral pH
form of influenza hemagglutinin demonstrates that it is not in a metastable
state." Biochem. 42: 5052-5057.
Fechter, P., Mingay, L., Sharps, J., Chambers, A., Fodor, E., Brownlee, G. G.
(2003). " Twon aromatic residues in the PB2 subunit of influenza A RNA
polymerase are crucial for cap-binding." J. Biol. Chem. 278(22): 2038120388.
Ferguson, N. M., Galvani A. P., Bush R. M. (2003). "Ecological and
immunological

determinants

of

influenza

evolution."

Nature

422(6930):428-33.
Fischer, W. B., Pitkeathly, M., Wallace, B. A., Forrest, L. R., Smith, G. R.,
Sansom, M. S. P. (2000). "Transmembrane peptide NB of influenza B: a
simulation, structure, and conductance study." Biochem. 39: 12708-12716.

102

Fitch, V. M., Bush, R. M., Bender, C. A., Cox, N. J. (1997). "Long term trends
in the evolution of H(3) HA1 human influenza type A." PNAS 94: 77127718.
Fodor, E., Mikulasova, A., Mingay, L. J., Poon, L. L., Brownlee, G. G.
(2000). "Messenger RNAs that are not synthesized by RNA polymerase II
can be 3'end cleaved and polyadenylated." EMBO Rep. 1(6): 513-518.
Fodor, E., Mingay, L. J., Brownlee, G. G. (2003). "A single aminoacid
mutation in the PA subunit of the influenza virus RNA polymerase
promotes the generation of defective interfering RNAs." J. Virol. 77(8):
5017-5020.
Fouchier, R. A. M., Schneeberger, P. M., Rozendaal, F. W., Broekman, J. M.,
Kemink, S. A. G., Munster, V., Kuiken, T., Rimmelzwaan, G. F., Schutten,
M., Doornun, G. J. J., Koch G., Bosman, A., Koopmans, M., Osterhaus, A.
D. M. E. (2004). "Avian influenza (H7N7) associated with human
conjunctivitis and a fatal case of acute respiratory distress syndrome."
P.N.A.S. 101(5): 1356-1361.
Gambaryan, A. S., Robertson J. S., Matrosovich M. N. (1999). "Effects of
egg-adaptation on the receptor-binding properties of human influenza A
and B viruses." Virology 258(2): 232-239.
Gerdil, C. (2003). "The annual production cycle for influenza vaccine."
Vaccine (21): 1776-1779.
Hall, T. A. (1999). "BioEdit: a user-friendly biological sequence alignment
editor and analysis program for Windows 95/98/NT." Nucl. Acids. Symp.
Ser. 41: 95-98.

103

Hatta, M., Kawaoka, Y. (2002). "The continued pandemic threat posed by


avian influenza viruses in Hong Kong." Trends Microbiol. 10(7): 340-344.
Hatta, M., Kawaoka, Y. (2003). "The NB protein of influenza B virus is not
necessary for virus replication in vitro." J. Virol. 77(10): 6050-6054.
Hay, A. J. (1998). "The virus genome and its replication." p. 43-53. in K. G.
Nicholson, R. G. Webster, and A. J. Hay (ed.), Textbook of influenza.
Blackwell Science, London, England.
Hay, A. J., Lomniczi, B., Bellmany, A. R., Skehel, J. J. (1977). "Transcription
of the influenza genome." Virology 83: 337-355.
Hay, A. J., Skehel, J. J., McCauley, J. (1982). "Characterization of influenza
virus RNA complete transcripts." Virology 116(2): 517-522.
Hilleman, M. R. (2002). "Realities and enigmas of human viral influenza:
pathogenesis, epidemiology and control." Vaccine 20: 3068-3087.
Hiromoto, Y., Saito, T., Lindstrom, S. E., Li, Y., Nerome, R., Sugita, S.,
Shinjoh, M., Nerome, K. (2000a). "Phylogenetic analysis of the three
polymerase genes (PB1, PB2 and PA) of influenza B virus." J. Gen. Virol.
81(Pt 4): 929-937.
Hiromoto, Y., Yamazaki, Y., Fukushima, T., Saito, T., Lindstrom, S. E.,
Omoe, K., Nerome, R., Lim, W., Sugita, S., Nerome, K. (2000b).
"Evolutionary characterization of the six internal genes of H5N1 human
influenza A virus." J. Gen. Virol. 81(5): 1293-1303.

104

Hoffmann, E., Webster, R. G. (2000). "Unidirectional RNA polymerase Ipolymerase II transcription system for the generation of influenza A virus
from eight plasmids." J. Gen. Virol. 81(12): 2843-2847.
Honda, A., Endo, A., Mizumoto, K., Ishihama, A. (2001). "Differential roles
of viral RNA and cRNA in functional modulation of the influenza virus
RNA polymerase." J. Biol. Chem. 276(33): 31179-31185.
Hongo, S., Sugawara, K., Muraki, Y., Kitame, F., Nakamura, K. (1997).
"Characterization of a second protein (CM2) encoded by RNA segment 6
of influenza C virus." J. Virol. 71: 2786-2792.
Huarte, M., Falcn, A., Nakaya, Y., Ortn, J., Garca-Sastre, A., Nieto, A.
(2003). "Threonine 157 of influenza virus PA polymerase subunit
modulates RNA replication in infectious viruses." J. Virol. 77(10): 60076013.
Isin, B., Doruker, P., Bahar, I. (2002). "Functional motions of influenza virus
hemagglutinin: A structure-based analytical approach." Biop. J. 82: 569581.
Jennings, P. A. , Finch, J. T., Winter, G., Robertson, J. S. (1983). "Does the
higher order structure of the influenza virus ribonucleoprotein guide
sequence rearrangements in influenza virus RNA ?" Cell 34: 619-627.
Johnson, F. B. (1990). "Transport of viral specimes." Clin. Microbiol. Rev. 3:
120-131.
Kates, M., Alison, A. C., Tyrell, D. A., James, A. T. (1962). "Origen of lipids
in influenza virus." Cold Spring Harbor Symp Quant. Biol. 27: 293-301.

105

Kawaoka, Y., Krauss, S., Webster, R. G. (1989). "Avian-to-human


transmission of the PB1 gene of influenza A viruses in the 1957 and 1968
pandemics." J. Virol. 63(11): 4603-4608.
Kemble, G., Greenberg, H. (2003). "Novel generations of influenza vaccines."
Vaccine 21(16):1789-95.
Kendal, A. P., Cox, N. J. (1985). "Forecasting the epidemic potential of
influenza virus variants based on their molecular properties." Vaccine 3:
263-266.
Klenk, H. D., Wagner, R., Heuer, D., Wolff, T. (2002). "Importance of
hemagglutinin glycosylation for the biological functions of influenza
virus." Virus Res. 82(1-2):73-5.
Klumpp, K., Ruigrok, R. W., Baudin, F. (1997). "Roles of the influenza virus
polymerase and nucleoprotein in forming a functional RNP structure."
EMBO J. 16(6): 1248-1257.
Knossow, M., Daniels, R. S., Douglas, A. R., Skehel, J. J., Wiley, D. C.
(1984). "Three-dimensional structure of an antigenic mutant of the
influenza virus haemagglutinin." Nature 311(5987): 678-680.
Koenig, M., Kosha, S., Hickman, M., Heath, D., Riddell, S., Aldous, W.
(2003). "Detection of influenza virus from throat and pharyngeal swabs
with a nested duplex light cycler RT-PCR." Dign. Microbiol. Infect. Dis.
46(1): 35-37.
Krug. R. M. (1981). "Priming of influenza viral RNA transcription by capped
heterologous RNAs." Curr. top. Microbiol. Immunol. 93: 125-149.

106

Krug, R. M., Yuan, W., Noah, D. L., Latham, A. G. (2003). "Intracellular


warfare between human influenza viruses and human cells: the roles of the
viral NS1 protein." Virology 309: 181-189.
Kuszewski, K., Brydak, L. (2000). "The epidemiology and history of
influenza." Biomed. Pharmacother. 54(4):188-195.
Lamb, R.A. (1989). "Genes and proteins of the influenza viruses." p. 89-113.
In R.M. Krug (ed.), The Influenza Viruses 1st ed. Plenum Press. New
York.
Lamb, R. A., Choppin, P. W. (1983). "The gene structure and replication of
influenza virus." Ann. Rev. Biochem. 52: 467-506.
Lavanchy, D. (1998). "The WHO update on influenza A (H5N1) in Hong
Kong." Euro Surveill. 3(3): 23-25.
Laver, G., Garman, E. (2002). "Pandemic influenza: its origin and control."
Microbes Infect. 4(13): 1309-1316.
Laver, W. G., Webster, R. G. (1973). "Studies on the origin of pandemic
influenza. 3. Evidence implicating duck and equine influenza viruses as
possible progenitors of the Hong Kong strain of human influenza."
Virology 51(2): 383-391.
Lazarev, V. N., Shmarov, M. M., Zakhartchouk, A. N., Yurov, G. K.,
Misurina, O. U., Akopian, T. A., Grinenko, N. F., Grodnitskaya, N. G.,
Kaverin, N. V., Naroditsky, B. S. (1999). "Inhibition of influenza A virus
reproduction by a ribozyme targeted against PB1 mRNA." Antiviral Res.
42(1): 47-57.

107

Lin, J., Andreasen, V., Levin, S. A. (1999). "Dynamics of influenza A drift:


the linear three-strain model." Math. Biosci. 162(1-2): 33-51.
Lindsay, M. I., Herrmann, E. C., Morrow, G. W., Brown, A. L. (1970). "Hong
Kong influenza : clinical, microbiologic, and pathologic features in 127
cases." J. Am. Med. Assoc. 214: 1825-1832.
Liu, C., Eichelberger, M. C., Compans, R. W., Air, G. M. (1995). "Influenza
type A virus neuraminidase does not play a role in viral entry, replication,
assembly, or budding." J. Virol. 69(2): 1099-1106.
Lommer, B. S., Lou, M. (2002). "Structural plasticity in influenza virus
protein NS2 (NEP)." J. Biol. Chem. 277(9): 7108-7117.
Martin, K., Helenius, A. (1991). "Nuclear transport of influenza virus
ribonucleoproteins: the viral matrix protein (M1) promotes export and
inhibits import." Cell 67(1):117-30.
Matrosovich, M., Zhou, N., Kawaoka, Y., Webster, R. (1999). "The surface
glycoproteins of H5 influenza viruses isolated from humans, chickens, and
wild aquatic birds have distinguishable properties." J. Virol. 73(2): 11461155.
McGeoch, D., Fellner, P., Newton, C. (1976). "Influenza virus genome
consists of eight distinct RNA species." Proc. Natl. Acad. Sci. USA 73:
3045-3049.
Medcalf, L., Poole, E., Elton, D., Digard, P. (1999). "Temperature-sensitive
lesions in two influenza A viruses defective for replicative transcription
disrupt RNA binding by the nucleoprotein." J. Virol. 73(9): 7349-7356.

108

Mena, I., Jambrina, E., Albo, C., Perales, B., Ortin, J., Arrese, M., Vallejo, D.,
Portela, A. (1999). "Mutational analysis of influenza A virus
nucleoprotein: identification of mutations that affect RNA replication." J.
Virol. 73(2): 1186-1194.
Mitnaul, L. J., Matrosovich, M. N., Castrucci, M. R., Tuzikov, A. B., Bovin,
N. V., Kobasa, D., Kawaoka, Y. (2000). "Balanced hemagglutinin and
neuraminidase activities are critical for efficient replication of influenza A
virus." J. Virol. 74(13): 6015-6020.
Mould, J. A., Li, H. C., Dudlak, C. S., Lear, J. D., Pekosz, A., Lamb, R. A.,
Pinto, L. H. (2000). "Mechanism for proton conduction of the M2 ion
channel of influenza A virus." J. Biol. Chem. 275(12): 8592-8599.
Mould, J. A., Paterson R. G., Takeda, M., Ohigashi, Y., Venkataraman P.,
Lamb, R. A., Pinto, L. H. (2003). "Influenza B virus BM2 protein has ion
channel activity that conducts protons across membranes." Dev. Cell 5:
175-184.
Murphy, B. R., Webster, R. G. (1990). "Orthomyxovirus" p.1091-1152. In
Fields, B. N., Knipe, D. M. (ed.), Virology, 2nd ed. Raven Press, New
York.
Muyanga, J., Matsuzaki, Y., Sugawara, K., Kimura, K., Mizuta, K., Ndumba,
I., Muraki, Y., Tsuchiya, E., Hongo, S., Kasolo, F. C., Numazaki, Y.,
Nakamura, K. (2001). "Antigenic and genetic analyses of influenza B
viruses isolated in Lusaka, Zambia in 1999." Arch. Virol. 146(9): 16671679.

109

Nakagawa, Y., Kimura, N., Toyoda, T., Mizumoto, K., Ishihama, A., Oda, K.,
Nakada, S. (1995). "The RNA polymerase PB2 subunit is not required for
replication of the influenza virus genome but is involved in capped mRNA
synthesis." J. Virol. 69(2): 728-733.
Nakagawa, Y., Oda, K., Nakada, S. (1996). "The PB1 subunit alone can
catalyze cRNA synthesis, and the PA subunit in addition to the PB1
subunit is required for viral RNA synthesis in replication of the influenza
virus genome." J. Virol. 70(9): 6390-6394.
Nakajima, S., Nobusawa, E., Nakajima, K. (2000). " Variation in response
among individuals to antigenic sites on the HA protein of human influenza
virus may be responsible for the emergence of Drift strains in the human
population." Virology 274: 220-231.
Neumann, G., Hughes, M. T., Kawaoka, Y. (2000b). "Influenza A virus
NS2protein mediates vRNP nuclear export through NES-independent
interaction with hCRM1." Embo J. 19(24): 6751-6758.
Neumann, G., Watanabe, T.,

Kawaoka, Y. (2000a). "Plasmid-driven

formation of influenza virus-like particles." J. Virol. 74(1): 547-551.


Nguyen-Van-Tam J. S., Hampson A. W. (2003). " The epidemiology and
clinical impact of pandemic influenza." Vaccine 21: 1762-1768.
Nicholson, K. G. (1998). "Human influenza." p. 219-264. in K. G. Nicholson,
R. G. Webster, A. J. Hay (ed.), Textbook of influenza. Blackwell Science,
London, England.

110

Odagiri, T., Hong, J., Ohara, Y. (1999). "The BM2 protein of influenza B
virus is synthesized in the late phase of infection and incorporated into
virions as a subviral component." J. Gen. Virol. 80 (Pt 10): 2573-2581.
O'
Neill, R. E., Talon, J., Palese, P. (1998). "The influenza virus NEP (NS2
protein) mediates the nuclear export of viral ribonucleoproteins." Embo J.
17(1): 288-296.
Palese, P., Compans, R. W. (1976). "Inhibition of influenza virus replication
in tissue culture by 2-deoxy-2,3-dehydro-N-trifluoro-acetyl-neuraminic
acid (FANA): Mechanism of action." J. Gen. Virol. 33: 159-163.
Palese, P., Garcia-Sastre, A. (2002). "Influenza vaccines: present and future."
J. Clin. Invest. 110(1): 9-13.
Paragas, J., Talon, J., O'
Neill, R. E., Anderson, D. K., Garca-Sastre, A.,
Palese, P. (2001). "Influenza B and C virus NEP (NS2) protein possess
nuclear export activities." J. Virol. 75(16): 7375-7383.
Park, E. K., Castrucci, M. R., Portner, A., Kawaoka, Y. (1998). "The M2
ectodomain is important for its incorporation into influenza A virions." J.
Virol. 72(3): 2449-2455.
Paterson, G. R., Takeda, M., Ohigashi, Y., Pinto, L. H., Lamb, R. A. (2003) "
Influenza B virus BM2 protein is an oligomeric integral membrane protein
expressed at the cell surface." Virology 306: 7-17.
Peiris, M., Yuen, K. Y., Leung, C. W., Chan, K. H., Ip, P. L., Lai, R. W., Orr,
W. K., Shortridge, K. F. (1999). "Human infection with influenza H9N2."
Lancet 354(9182): 916-917.

111

Pekosz, A., Lamb, R. A. (1997). " The CM2 protein of influenza C virus is a
oligomeric integral membrane glycoprotein structurally analogous to
influenza A virus M2 and influenza B virus NB proteins" Virology 237:
439-451.
Pekosz, A., Lamb, R. A. (1998). "Influenza C virus CM2 integral membrane
glycoprotein is produced from a polypeptide precursor by cleavage of an
internal signal sequence." Proc. Natl. Acad. Sci. U. S. A 95(22): 1323313238.
Perales, B., Ortin, J. (1997). "The influenza A virus PB2 polymerase subunit is
required for the replication of viral RNA." J. Virol. 71(2): 1381-1385.
Perez, D., R., Donis R. O. (2001). "Functional Analysis of PA binding by
influenza A virus PB1: effects on polymerase activity and viral
infectivity." J. Virol. 75(17): 8127-8136.
Plakokefalos, E. T., Markoulatos, P., Spyrou, N., Bei, T. A., Vamvakopoulos,
N. C. (2001). "Molecular and phylogenetic analysis of haemagglutinin and
neuraminidase sequences from recent human influenza type A (H3N2)
viral isolates in Southern Greece." Arch. Virol. 146(10): 1899-1918.
Plotkin J. B., Dushoff J., Levin S. A. (2002). "Hemagglutinin sequence
clusters and the antigenic evolution of influenza A virus." PNAS 99(9):
6263-6268.
Potter, C. W. (2001). "A histroy of infuenza" J. Appl. Microbiol. 91(4): 572579.
Pringle, C. R. (1996). "Virus taxonomy 1996-a bulletin from the Xth
Internacional Congress of Virology in Jerusalem" Arch Virol 141: 2251-

112

2256.
Pritlove, D. C., Poon, L. L., Fodor, E., Sharps, J., Brownlee, G. G. (1998).
"Polyadenylation of influenza virus mRNA transcribed in vitro from
model virion RNA templates: requirement for 5'conserved sequences." J.
Virol. 72(2): 1280-1286.
Pyhl, R., Ikonen, N., Haanp, M., Santanen, R., Tervahauta, R. (2002). "
Phylogenetic and antigenic analysis of influenza A(H3N2) viruses isolated
from conscripts receiving influenza vaccine prior to the epidemic season of
1998/9." Epidemiol. Infect. 129: 347-353.
Reid, A. H., Fanning, T. G., Janczewski, T. A., Taubenberger, J. K. (2000).
"Characterization of the 1918 "Spanish" influenza virus neuraminidase
gene." PNAS 97 (12): 6785-6790.
Reinhardt, J., Wolff, T. (2000). "The influenza A virus M1 protein interacts
with the cellular receptor of activated C kinase (RACK) 1 and can be
phosphorylated by protein kinase C." Vet. Microb. 74(1-2): 87-100.
Roberts, P. C., Compans, R. W. (1998). "Host cell dependence of viral
morphology." Proc. Natl. Acad. Sci. U. S. A 95(10): 5746-5751.
Rocha, E. P., Cox, N. J., Black, R.A., Harmon, M. W., Harrisson, C. J.,
Kendal, A. P. (1991). "Antigenic and gentic variation in influenza A (
H1N1)

virus

isolates

recovered

from

persistently

infected

immunodeficient child." J. Virol. 65(5): 2340-2350.


Rocha, E. P., Xu, X., Hall, H. E., Allen, J. R., Regnery, H. L., Cox, N. J.
(1993). "Comparison of 10 influenza A (H1N1 and H3N2) haemagglutinin

113

sequences obtained directly from clinical specimens to those of MDCK


cell- and egg-grown viruses." J Gen Virol. 11: 2513-2518.
Rogers, G. N., Herrler, G., Paulson, J. C., Klent, H. D. (1986). "Influenza C
virus uses 9-Oacetyl-N-acetylneuramine acid as a high affinity receptor
determinant for attachement to cells." J. Biol. Chem. 261: 5947-5951.
Rota, P. A., Hemphill, M. L., Whistler, T., Regnery, H. L., Kendal, A. P.
(1992). "Antigenic and genetic characterization of the haemagglutinins of
recent cocirculating strains of influenza B virus." J. Gen. virol. 73 (10):
2737-2742.
Rota, P. A., Wallis, T. R., Harmon, M. W., Rota, J. S., Kendal, A. P., Nerome,
K. (1990). "Cocirculation of two distinct evolutionary lineages of influenza
type B virus since 1983." Virology 175: 59-68.
Sanz-Ezquerro, J. J., Fernandez, S. J., Sierra, T., Aragon, T., Ortega, J., Ortin,
J., Smith, G. L., Nieto, A. (1998). "The PA influenza virus polymerase
subunit is a phosphorylated protein." J. Gen. Virol. 79 ( Pt 3): 471-478.
Savy, V. L., Baumeister E. G., Pontoriero A. V. (1999) "Antigenic
relationship between influenza A(H3N2) strains circulating in Argentina
and vaccine strains." Medicina-Buenos Aires 59(3): 225-230.
Schweiger, B., Zadow, I., Heckler, R. (2002). "Antigenic drift and variability
of influenza viruses." Med. Microbiol. Immunol. 191(3-4): 133-138.
Shapiro, G. I., Gurney, T. J., Krug, R. M. (1987). "Influenza virus gene
expression: control mechanisms at early and late times of infection and
nuclear-cytoplasmatic transport of virus-specific RNAs." J. Virol. 61: 764773.

114

Shaw, M. W., Xu, X., Li, Y., Normand, S., Ueki, R. T., Kunimoto, G. Y.,
Hall, H., Klimov, A., Cox, N. J., Subbarao, K. (2002). "Reappearance and
global spread of variants of influenza B/Victoria/2/87 lineage viruses in the
2000-2001 and 2001-2002 seasons." Virology 303(1): 1-8.
Shortridge, K. F., Peiris, J. S., Guan, Y. (2003). "The next influenza
pandemic: lessons from Hong Kong." J. Appl. Microbiol. 94(Suppl): 70S79S.
Simonsen, L. (1999). "The global impact of influenza on morbidity and
mortality." Vaccine 17 (1): 3-10.
Skehel, J. J. (1972). "Polypeptide synthesis os influenza virus-infected cells."
Virology 56: 394-399.
Skehel, J. J., Wiley, D. C. (2000). "Receptor binding and membrane fusion in
virus entry: the influenza hemagglutinin." Annu. Rev. Biochem. 69: 531569.
Skehel, J. J., Wiley, D. C. (2002). "Influenza haemagglutinin." Vaccine 20(2):
51-54.
Smith D. J. (2003). "Applications of bioinformatics and computational biology
to influenza surveillance and vaccine strain selection." Vaccine 21(16):
1758-1761.
Smith, G. L., Hay, A. J. (1982). "Replication of the influenza virus genome."
Virology 118: 96-108.
Subbarao, K., Klimov, A., Katz, J., Regnery, H., Lim, W., Hall, H., Perdue,
M., Swayne, D., Bender, C., Huang, J., Hemphill, M., Rowe, T., Shaw, M.,

115

Xu, X., Fukuda, K., Cox, N. (1998). "Characterization of an avian


influenza A (H5N1) virus isolated from a child with a fatal respiratory
illness." Science 279(5349): 393-396.
Tada, Y., Hongo, S., Muraki, Y., Matsuzaki, Y., Sugawara, K., Kitame, F.,
Nakamura, K. (1998). "Phosphorylation of influenza C virus CM2
protein." Virus Res. 58(1-2): 65-72.
Thompson, J. D., Gibson, T. J., Plewniak, F., Jeanmougin, F., Higgins, D. G.
(1997). "The ClustalX windows interface: flexible strategies for multiple
sequence alignment aided by quality analysis tools." Nucleic Acids
Research 24: 4876-4882.
Thompson, W. W., Shay, D. K., Weintraub, E., Brammer, L., Cox, N.,
Anderson, L. J., Fukuda, K. (2003). "Mortality associated with influenza
and respiratory syncytial virus in the United States." JAMA 289(2): 179186.
Ulmanem, I., Broni, B. A., Krug, R. M. (1981). "Role of two of the influenza
virus core P proteins in recognizing cap 1 structures (M7GpppNm) on
RNAs and initiating viral RNA transcription." Proc. Natl. Acad, Sci. USA
78: 7355-7359.
Underwood, P. A. (1982). "Mapping of antigenic changes in the
haemagglutinin of Hong Kong influenza (H3N2) strains using a large panel
of monoclonal antibodies." J. Gen. Virol. 62 (1):153-169.
Underwood, P. A. (1984). "An antigenic map of the haemagglutinin of the
influenza Hong Kong subtype (H3N2), constructed using mouse
monoclonal antibodies." Mol. Immunol. 21(7): 663-671.

116

Wagner, R., Wolff, T., Herwig, A., Pleschka, S., Klenk, H. D. (2000).
"Interdependence of hemagglutinin glycosylation and neuraminidase as
regulators of influenza virus growth: a study by reverse genetics." J. Virol.
74(14):6316-6323.
Watanabe, S., Imai, M., Ohara, Y., Odagiri, T. (2003). "Influenza B virus
BM2 protein is transported trough the trans-golgi network as an integral
membrane protein." J. Virol. 77(19): 10630-10637.
Webby, R. J., Webster R. G. (2001). "Emergence of Influenza A virus." Phil.
Trans. R. Soc. Lond. B. 356: 1817-1828.
Webster, R. G. (1998). "Influenza: an emerging disease." Emerg. Infect. Dis.
4(3): 436-441.
Webster, R. G., Air, G. M., Metzger, D. W., Colman, P. M., Varghese, J. N.,
Baker, A. T., Laver, W. G. (1987). "Antigenic structure and variation in an
influenza virus N9 neuraminidase." J. Virol. 61(9): 2910-2916.
Webster, R. G., Bean, W. J., Gorman, O. T., Chambers, T., M., Kawaoka, Y.
(1992). "Evolution and ecology of influenza A viruses." Microbiol. Rev.
56(1): 152-179.
Webster, R. G., Shortridge, K. F., Kawaoka, Y. (1997). "Influenza:
interspecies transmission and emergence of new pandemics." FEMS
Immunol Med Microbiol. 18(4): 275-279.
Weekly Epidemiological Record. (1999). 74 (47).
Weekly Epidemiological Record. (2000). 75(41).

117

WHO Fact Sheet 211, 1999


Wiley, D. C., Skehel, J. J. (1987). "The structure and function of the
hemagglutinin membrane glycoprotein of influenza virus." Ann. Rev.
Biochem. 56: 365-394.
Wiley, D. C., Wilson, I. A., Skehel, J. J. (1981). "Structural identification of
the antibody-binding sites of Hong Kong influenza haemagglutinin and
their involvement in antigenic variation." Nature 289: 373-378.
Wolff, T., O'
Neill, R. E., Palese, P. (1996). "Interaction cloning of NS1-I, a
human protein that binds to the nonstructural NS1 proteins of influenza A
and B viruses." J. Virol. 70(8): 5363-5372.
Wood J. M. (2002). "Selection of influenza vaccine strains and developing
pandemic vaccines." Vaccine 20 (5): B40-4.
Xu, X. Kilbourne, E.D., Hall, H.E., Cox, N.J. (1994). "Nonimmunoselected
intrastrain genetic variation detected in pairs of high-yielding influenza
A(H3N2) vaccine and parental viruses." J.Infec. Dis. 170: 1432-1438.
Xu, X., Rocha, E.P., Regenery, H.L., Kendal, A.P., Cox, N.J. (1993). "Genetic
and antigenic analyses of influenza A (H1N1) viruses, 1986-1991." Virus
Research 28: 37-55.
Xu, X., Smith C. B., Mungall B. A., Lindstrom S. E., Hall H. E., Subbarao K.,
Cox N. J., Klimov A. (2002). "Intercontinental Circulation of Human
Influenza A(H1N2) Reassortant Viruses during the 20012002 Influenza
Season." J. Infect. Dis. 186: 1490-1493.
Yamashita, M., Krystal, M., Palese, P. (1989). "Comparison of three large

118

polymerase proteins of influenza A, B, and C viruses." Virology 171: 458466.


Yang, P., Bansal, A., Liu, C., Air, G. M. (1997). "Hemagglutinin specificity
and neuraminidase coding capacity of neuraminidase-deficient influenza
viruses." Virology 229: 155-165.
Yewdell, J., Garcia-Sastre, A. (2002). "Influenza virus still surprises." Cur.
Opin.Microbiol. 5: 414-418.
Yewdell, J. W.,Gerhard, W., Bachi, T. (1983). "Monoclonal antihemagglutinin antibodies detect irreversible antigenic alterations that
coincide with the acid activation of influenza virus A/PR/834-mediated
hemolysis." J. Virol. 48(1): 239-248.
Zambon, M. C. (1999). "Epidemiology and pathogenesis of influenza." J.
Antimicrob. Chemother. 44(B): 3-9.
Zebedee, S. L., Lamb, R. A. (1988). "Influenza virus M2 protein: monoclonal
antibody restriction of virus growth and detection of M2 in virions." J.
Virol. 62: 2762-2772.
Zhang, W., Evans, D.H. (1991). "Detection and identification of human
influenza viruses by the polymerase chain reaction." J. Virol. Met. 33: 165189.
Zhirnov, O. P., Ikizler, M. R., Wright, P. F. (2002). "Cleavage of influenza A
virus hemagglutinin in human respiratory epithelium is cell associated and
sensitive to exogenous antiproteases." J. Virol. 76(17): 8682-8689.

119

XII - Biografia.
Miguel Augusto Golono, nascido em 13 de novembro de 1974, em
Londrina no Pr. Ingressou na Universidade Estadual de Londrina em 1993 no
curso de Cincias Bilogicas, titulando-se em licenciatura em 1997. Vrios
trabalhos apresentados em forma de painel em congressos, como o Brasileiro
de Gentica, Brasileiro de Virologia, e Reunies Cientficas do Instituto
Butantan. Prmio Jovem Cientista categoria Mestrado, meno honrosa
proferida ao Trabalho Co-infeces Causadas por Diferentes Tipos e
Subtipos do Vrus Influenza, Reunies Cientficas do Instituto Butantan, em
2002. E pai de gmeas tambm em 2002, as quais dediquei este trabalho.