Você está na página 1de 695

UNIVERSIDADE DE SO PAULO

FACULDADE DE FILOSOFIA, LETRAS E CINCIAS HUMANAS













DICIONRIO TERMINOLGICO DA GESTO
PELA QUALIDADE TOTAL EM SERVIOS






MANOEL MESSIAS ALVES DA SILVA



VOLUME I






SO PAULO
2003




2


UNIVERSIDADE DE SO PAULO
FACULDADE DE FILOSOFIA, LETRAS E CINCIAS HUMANAS
DEPARTAMENTO DE LETRAS CLSSICAS E VERNCULAS
CURSO DE PS-GRADUAO EM LETRAS CLSSICAS E VERNCULAS
REA DE CONCENTRAO EM FILOLOGIA E LNGUA PORTUGUESA








DICIONRIO TERMINOLGICO DA GESTO
PELA QUALIDADE TOTAL EM SERVIOS


Manoel Messias Alves da Silva
















So Paulo
2003




3


UNIVERSIDADE DE SO PAULO
FACULDADE DE FILOSOFIA, LETRAS E CINCIAS HUMANAS
DEPARTAMENTO DE LETRAS CLSSICAS E VERNCULAS
CURSO DE PS-GRADUAO EM LETRAS CLSSICAS E VERNCULAS
REA DE CONCENTRAO EM FILOLOGIA E LNGUA PORTUGUESA







DICIONRIO TERMINOLGICO DA GESTO
PELA QUALIDADE TOTAL EM SERVIOS




Tese apresentada ao Departamento de Letras Clssicas
e Vernculas, rea de Concentrao em Filologia e
Lngua Portuguesa da Faculdade de Filosofia, Letras e
Cincias Humanas da Universidade de So Paulo,
como exigncia parcial para a obteno do ttulo de
Doutor em Letras: Filologia e Lngua Portuguesa.



Orientadora: Prof. Dr. Ieda Maria Alves






So Paulo
2003




4


Manoel Messias Alves da Silva










DICIONRIO TERMINOLGICO DA GESTO
PELA QUALIDADE TOTAL EM SERVIOS







DOUTORADO EM LETRAS:

FILOLOGIA E LNGUA PORTUGUESA















SO PAULO
2003




5


Ficha Catalogrfica









Dados Internacionais de Catalogao-na-Publicao (CIP)
(Biblioteca Central - UEM, Maring PR., Brasil)

Silva, Manoel Messias Alves da
S586d Dicionrio terminolgico da gesto pela qualidade total
em servios / Manoel Messias Alves da Silva. So Paulo :
[s.n.], 2003.
2 v.

Orientadora : Prof. Dr. Ieda Maria Alves
Tese (Doutorado) - Departamento de Letras Clssicas e
Vernculas. Faculdade de Filosofia, Letras e Cincias
Humanas. Universidade de So Paulo, 2003.

1. Qualidade total em servios - Dicionrio
Terminolgico. 2. Qualidade total em servios -
Terminologia e definio. 3. Gesto pela qualidade total
em servios - Dicionrio terminolgico. I. Universidade de
So Paulo. Faculdade de Filosofia, Letras e Cincias
Humanas. Departamento de Letras Clssicas e Vernculas. II.
Ttulo.



CDD 21.ed. 658.4013



























6


MANOEL MESSIAS ALVES DA SILVA




DICIONRIO TERMINOLGICO DA
GESTO PELA QUALIDADE TOTAL EM SERVIOS


Tese apresentada Faculdade de Filosofia, Letras e
Cincias Humanas, da Universidade de So Paulo, como
requisito parcial para obteno do ttulo de Doutor em
Letras: Filologia e Lngua Portuguesa.

Aprovada em ___/___/___.



COMISSO JULGADORA


Presidenta e Orientadora .........................................................................................

2 Examinador (a) ...................................................................................................

3 Examinador (a) ...................................................................................................

4 Examinador (a) ...................................................................................................

5 Examinador (a) ...................................................................................................





7





Este trabalho dedicado.





Aos meus pais, Maria e Paulo, este in memoriam, aos meus irmos Maria
Aparecida, Luis, Paulinho e Amaro e ao colega e amigo Silvestre Bong,
tambm este in memoriam, pelos incentivos.












8


AGRADECIMENTOS















A realizao deste trabalho s foi possvel graas
colaborao e ao incentivo de vrias pessoas, amigos e
especialistas, que se deixa de enumerar para no cometer
injustias. A todos, de corao, muito obrigado.

Entretanto, no se pode absolutamente deixar de expressar
um especial agradecimento Prof. Dr. Ieda Maria Alves
pela carinhosa ateno que promoveu ao orientando nesta
caminhada, desde o Mestrado, Camila e ao Ncolas por
terem nascido em momentos distintos que permitiram os
avanos considerveis, esposa Vanusa pela dedicao e
pacincia e Universidade Estadual de Maring (UEM) e
Fundao Coordenao de Aperfeioamento de Pessoal de
Nvel Superior (Capes) pelo apoio financeiro.









9


RESUMO

O objetivo desta Tese de Doutorado apresentar o resultado de uma pesquisa
terminolgica monolnge descritiva acerca das unidades de conhecimento
especializado relacionadas a uma rea especfica da lngua portuguesa denominada
gesto pela qualidade total em servios, por meio da organizao desses elementos em
um dicionrio terminolgico. Para a concretizao desse objetivo, esclarece-se,
primeiramente, a escolha e a justificativa do tema e apresentado um apanhado
histrico que contextualiza a gesto pela qualidade total em manufatura e servios no
mundo e no Brasil. Apresentam-se, ainda, fundamentos tericos da cincia da
Terminologia e a importncia desta no mundo globalizado atual. A partir da
apresentao das modalidades do trabalho terminolgico, percorre-se um iderio
terico que contempla a tipologia de dicionrios, o dicionrio terminolgico e suas
especificidades, a estrutura conceitual da rea, as unidades de conhecimento
especializado oriundas de traduo e suas adaptaes lngua portuguesa por meio de
seus modos de formao, at a concentrao na questo da definio, com o intuito de
se apresentar uma base terica que possa responder s hipteses levantadas: a gesto
pela qualidade total em servios constitui efetivamente uma rea de especialidade em
relao gesto pela qualidade total em manufatura ou apenas uma subrea dessa?
Uma vez que essa filosofia administrativa surge em lngua estrangeira, se surgiu, como
as unidades de conhecimento especializado se adaptaram lngua portuguesa? Quais
teriam sido os modos de formao utilizados nessa adaptao? So expostas, ainda, as
informaes pertinentes sobre a pesquisa bibliogrfica, a recolha das unidades de
conhecimento especializado, a ficha/pesquisa terminolgica, a estrutura dos verbetes
do dicionrio e, em seguida, os verbetes que constituem o Dicionrio terminolgico da
gesto pela qualidade total em servios, apresentado de acordo com o trip de
Deming: o planejamento, o controle e a melhoria da qualidade total.

Palavras-chave: Dicionrio terminolgico. Gesto pela qualidade total. Servios.
Terminografia. Terminologia.






10


ABSTRACT

A descriptive monolingual terminological research concerning terms related to a specific area
of the Portuguese language called Total Quality Control in Services is provided. Items have
been collected in a Terminological dictionary. Choice and justification of themes and a
historical summary that contextualizes Total Quality Control in Services and Manufacturing
in Brazil and wordwide are given, together with the theoretical basis of Terminology Science
and its importance in a globalized world. Working through modalities of terminology, the
author follows a theoretical design covering the typology of dictionaries, the terminological
dictionary and its specialties, the problem of the conceptual structure area, units of specialized
knowledge from translation and its adaptation to the Portuguese language, from its different
modes of formation to the definition problem. It will lead the reader to form a theoretical basis
that answers some hypotheses. Is Total Quality Control in Services a true specialty area with
regard to Total Quality Control in Manufacturing, or is it merely a subarea? If this
administrative philosophy arose within a foreign language, how were the terms adapted to
Portuguese? Which were the formation modes employed in the adaptation? Information on
bibliographical research, collection of terms, terminological card research, structure of words
in the dictionary is also given. Finally, the words in the Terminological Dictionary of Total
Quality Control in Services are arranged according to the Deming tripod of planning, control
and an improvement in total quality.

Key words: Terminography. Terminological dictionary. Terminology. Total Quality Control.
Services.

















11


RESUMEN

El propsito de esta Tesis de Doctorado es exponer el resultado de una investigacin
terminolgica monolinge descriptiva a respecto de las unidades de significacin
especializada relacionadas a un rea especfica de la lengua portuguesa nombrada gestin por
la calidad total en servicios por intermedio de la organizacin de esos elementos en un
diccionario terminolgico. Para alcanzar este objetivo, se aclara, de primero, la eleccin y la
justificacin del tema y se presenta un recorrido histrico que contextualiza la gestin por la
calidad total en manufatura y servicios en el mundo y en Brasil. Se presenta, todava, los
fundamentos tericos de la ciencia de la Terminologa y su importancia en el mundo
globalizado actual. Partiendo de la presentacin de las modalidades del trabajo terminolgico,
se hace un recorrido terico que pondr en evidencia la tipologa de los diccionarios, el
diccionario terminolgico y sus aspectos, la estructura conceptual de la rea, las unidades de
significacin especializada que son versadas para otro idioma y como han ocorrido sus
adaptaciones en la lengua portuguesa por sus modos de formacin, hasta la concentracin en
la cuestin de definicin en terminologa, se h buscado atender a las exigencias de
presentacin de una base terica que puede responder a las siguientes hiptesis: la gestin por
la calidad total en servicios es efectivamente un rea de especialidad en relacin a la gestin
por la calidad total en manufatura o si se trata slo de su subarea? A la vez que esa filosofa
administrativa ha venido de una otra lengua, se ha venido, como las unidades de significacin
especializada han realizado sus adaptaciones en la lengua portuguesa? Cules hubieram sido
los modos de formacin utilizados en esa adaptacin? Se expone, an, las informaciones
pertinentes sobre la investigacin bibliogrfica, la recoleccin/extraccin de las unidades de
significacin especializada, la ficha/investigacin terminolgica, la estructura de los verbetes
del diccionario y, luego, los verbetes que constituyen el Diccionario terminolgico de la
gestin por la calidad total en servicios, presentado de acuerdo con la trpliceloga de
Deming: el planeamiento, el control y la mejora de la calidad total.

Palabras-clave: Diccionario terminolgico. Gestin por la calidad total. Servicios.
Terminografa. Terminologa.






12


RSUM

Le but de ce travail est de prsenter le rsultat dune recherche terminologique monolingue
descriptive sur les units de connaissance spcialise appartenant un domaine spcifique de
la langue portugaise dnomm gestion pour la qualit totale en services, tenant compte de
lorganisation de ces lments dans un dictionnaire terminologique. Pour atteindre cet
objectif, on explique dabord le choix et la justification du sujet pour ensuite prsenter un
aperu historique qui puisse mettre en contexte la gestion pour la qualit totale en produit
manufactur et services dans le monde et au Brsil. On prsente, encore, les principes
thoriques de la science de la Terminologie et son importance actuellement dans la
mondialisation. A partir de la prsentation des modalits du travail terminologique, on
parcourt un idal thorique qui s'accorde avec la typologie des dictionnaires et ses spcificits,
la carte gographique conceptuele du domaine, les units de connaissance spcialise qui sont
originaires de la traduction et de ses adaptations la langue portugaise par l'organisation de
ces faons de formation, jusqu' la concentration dans la question de la dfinition
terminologique, ayant comme but la prsentation dune base thorique qui peut rpondre aux
hypothses de la recherche mene : la gestion pour la qualit totale en services constitue-t-elle
en effet un domaine en relation la gestion pour la qualit totale en produit manufactur ou
n'est-elle q'un sous-domaine de cele l ? Vu que cette philosophie administrative est venue en
langue trangre, si cela vraiment est arriv, comment les units de connaissance spcialise
se sont-elles adaptes la langue portugaise ? Quelles ont t les manires de formation
utilises dans cette adaptation ? On expose encore les informations concernant les recherches
bibliographiques, le recensement des units de connaissance spcialise, la fiche/recherche
terminologique, la structure des articles du dictionnaire et, ensuite, les articles qui constituent
le Dictionnaire terminologique de la gestion pour la qualit totale en services, prsent selon
le trpied de Deming : lamnagement, le contrle et lamlioration de la qualit totale.

Mots-cl: Dictionnaire terminologique. Gestion pour la qualit totale. Services.
Terminographie. Terminologie.








13


LISTA DE ILUSTRAES


Figura 1 Total de UCEs coletadas ............................................................................... 656
Figura 2 Total de UCEs coletadas em suas subreas e rea de especialidade ............. 657
Figura 3 Total de UCEs coletadas em relao trilogia da qualidade em servios .... 659
Figura 4 Total de UCEs relacionadas ao setor de manufatura e servios .................... 661
Figura 5 Total de UCEs relacionadas ao setor de servios .......................................... 664
Figura 6 Formao essencial de UCEs terminognicas complexas ............................. 671
Figura 7 Outras formaes de UCEs terminognicas complexas ................................ 674


































14


SUMRIO

VOLUME I
Resumo .....................................................................................................................................09
Abstract ....................................................................................................................................10
Resumen ...................................................................................................................................11
Rsum .....................................................................................................................................12
Lista de Ilustraes ...................................................................................................................13
Apresentao ............................................................................................................................16

I. INTRODUO
I.1. Escolha do tema .................................................................................................................18
I.2. Justificativas ao tema .........................................................................................................28
I.3. Histria e contextualizao da gesto pela qualidade total em manufatura ......................42
I.4. Histria e contextualizao da gesto pela qualidade total em servios ...........................71

II. FUNDAMENTOS TERICOS
II.1. As vrias perspectivas da pesquisa terminolgica ..........................................................100
II.1.1. A importncia da terminologia no mundo atual ..........................................................109
II.2. Modalidades do trabalho terminolgico......... ................................................................114
II.2.1. Tipologia de dicionrios ..............................................................................................114
II.2.2. A macroestrutura, a microestrutura e o sistema de remissivas de um dicionrio
terminolgico..............................................................................................................132
II.3. A estrutura conceitual da gesto pela qualidade total em servios ............................... 137
II.4. Unidades de conhecimento especializado oriundas de traduo e suas adaptaes lngua
portuguesa .......................................................................................................................179
II.4.1. Modos de formao de unidades de conhecimento especializado ..............................179
II.5. A problemtica da definio terminogrfica ..................................................................220







15


III. ESTABELECIMENTO DO CORPUS E METODOLOGIA
III.1. Etapas da pesquisa ........................................................................................................235
III.1.1. Pesquisa bibliogrfica ................................................................................................236
III.1.2. Estabelecimento do corpus ........................................................................................238
III.1.3. Busca e organizao dos dados ..................................................................................248
III.2. Estrutura da ficha terminolgica....................................................................................250
III.3. Estrutura do verbete ......................................................................................................262

VOLUME II
IV. DICIONRIO TERMINOLGICO DA GESTO PELA QUALIDADE TOTAL EM
SERVIOS .....................................................................................................................269
IV.1. Introduo .....................................................................................................................270
IV.1.1. Constituio da nomenclatura ....................................................................................271
IV.1.2. Apresentao dos verbetes .........................................................................................272
IV.2. Abreviaturas utilizadas..................................................................................................278
IV.3. ndice remissivo das unidades de conhecimento especializado ...................................279
IV.4. Repertrio das unidades de conhecimento especializado relacionadas ao planejamento
da gesto pela qualidade total em servios ...................................................................312
IV.5. Repertrio das unidades de conhecimento especializado relacionadas ao controle da
gesto pela qualidade total em servios ........................................................................462
IV.6. Repertrio das unidades de conhecimento especializado relacionadas melhoria da
gesto pela qualidade total em servios ........................................................................586

V. CONCLUSO
V.1. Consideraes finais .......................................................................................................655
V.2. Confirmao das hipteses levantadas ...........................................................................666

VI. REFERNCIAS BIBLIOGRFICAS
VI.1. Obras gerais/lingsticas/lexicolgicas/lexicogrficas .................................................677
VI.2. Obras terminolgicas/terminogrficas ..........................................................................681
VI.3. Obras especializadas .....................................................................................................692





16


APRESENTAO

Esta Tese est disposta em dois volumes. Os trs primeiros captulos compem uma
parte inicial onde h uma exposio terico-metodolgica referente ao percurso de elaborao
de um dicionrio terminolgico, produto da aplicao dessas teorias, e encontram-se no I
volume. A outra parte denomina-se parte prtica e encontra-se no II volume. Nela, est
apresentado o dicionrio propriamente dito antecedido de questes que elucidam o seu
manejo, como o ndice remissivo das unidades de conhecimento especializado (UCEs), as
abreviaturas utilizadas e uma apresentao dos verbetes.
A parte inicial est dividida em trs captulos. O primeiro captulo, intitulado
Introduo, traz questes referentes a situar o leitor dentro do tema abordado. A partir do item
Escolha do tema, tudo colidido para este situar, inclusive justificando o mesmo e
apresentando a histria e a contextualizao da gesto pela qualidade total em manufatura e
em servios.
Aps essas consideraes, so apresentados, no Captulo II, os fundamentos tericos
em que esta pesquisa est baseada. Eles se iniciam a partir da apresentao das vrias
perspectivas da pesquisa terminolgica e de sua importncia no mundo atual,
prosseguem pelas modalidades do trabalho terminolgico, subdividido em dois
subitens, onde o primeiro contempla a tipologia de dicionrios e o segundo debrua-se
sobre o dicionrio terminolgico e suas especificidades. A questo do mapa conceitual
compe o terceiro item do captulo. Em seguida, como quarto item, so apresentadas
as teorias relacionadas s unidades de conhecimento especializado oriundas de
traduo e suas possveis adaptaes lngua portuguesa. Como subitem desse item,
so relacionados os modos de formao que a lngua portuguesa oferece para essas




17


adaptaes. Como quinto e ltimo item desse captulo terico, abordada a questo da
definio terminogrfica. A preocupao deste segundo captulo apresentar uma base
terica que possa responder s hipteses levantadas na Tese: a gesto pela qualidade
total em servios constitui efetivamente uma rea de especialidade em relao gesto
pela qualidade total em manufatura ou apenas uma subrea dessa? Uma vez que essa
filosofia administrativa surge em lngua estrangeira, se surgiu, como as unidades de
conhecimento especializado se adaptaram lngua portuguesa? Quais teriam sido os
modos de formao utilizados nesta adaptao?
No Captulo III, so expostas, ainda, no primeiro item, as informaes
pertinentes sobre a pesquisa bibliogrfica e como foi estabelecida a metodologia para a
recolha das UCEs; no segundo item, como foi composta a ficha/pesquisa
terminolgica; por ltimo, apresentada a estrutura dos verbetes do dicionrio.
No Captulo IV, j dentro da parte dita prtica, so relacionados os verbetes que
constituem o Dicionrio terminolgico da gesto pela qualidade total em servios,
apresentado de acordo com o trip de Deming: o planejamento, o controle e a melhoria
da qualidade total.
No Captulo V, h uma confirmao das hipteses levantadas, apresentando
ndices estatsticos dos tipos de formaes utilizados e um texto conclusivo sobre a
pesquisa realizada.
Para encerrar, no Captulo VI, so relacionadas as referncias bibliogrficas,
subdivididas em trs itens: obras gerais/lingsticas/lexicolgicas/lexicogrficas; obras
terminolgicas/terminogrficas; obras especializadas.






18


I. INTRODUO
I.1. Escolha do tema
A escolha desse tema deveu-se a fatores pessoais e cientficos. Pessoais, porque desde
1994 pesquisas vm sendo realizadas pelo ps-graduando relacionadas s unidades de
conhecimento especializado (UCEs) dessa rea de especialidade a gesto pela qualidade
total (GQT) que foram contempladas, em uma primeira etapa, na defesa da Dissertao de
Mestrado na Universidade de So Paulo, em 1998. Na poca, foi apresentado um trabalho
intitulado Dicionrio terminolgico da gesto pela qualidade total com as UCE's pertinentes
a essa rea de especialidade relacionadas manufatura, ou seja, o trabalho contemplou o trip
propagado por William Edwards Deming, um americano especialista em estatstica que
considerado o introdutor dessa Filosofia Administrativa nas organizaes: o planejamento, o
controle e a melhoria da qualidade. Ao todo, foram recolhidas 269 (duzentas e sessenta e
nove) UCEs dessa rea de especialidade e a obra foi apresentada em trs partes com as UCEs
correspondentes a cada uma das subreas explicitadas anteriormente. Os fatores cientficos
coexistem com os pessoais. Como a Dissertao apresentada teve uma boa receptividade, os
membros da Banca Examinadora sugeriram que fosse dado prosseguimento quela pesquisa,
agora voltada ao setor de servios. Essa sugesto foi acolhida e, portanto, essa pesquisa hoje
apresentada como Tese de Doutoramento.
Essa incurso de uma rea do conhecimento em outra plenamente justificvel tendo
em vista a questo da interdisciplinaridade. Os especialistas em Administrao de Empresas, e
no os da Engenharia de Produo, como se ver adiante no item I.3., utilizam as UCEs da
gesto pela qualidade total porque as mesmas fazem parte de seu cotidiano profissional. No
entanto, ao delimitarem esses conceitos em um dicionrio terminolgico, esses especialistas
encontram dificuldades, pois a eles no facultado, pelos respectivos cursos de graduao, o




19


conhecimento terico necessrio acerca da cincia da Terminologia. Em pases
desenvolvidos, como o Canad, por exemplo, essa unio entre especialistas e termingrafos
tem sido importante, pois o pas bilnge e todo o conhecimento especializado forjado em
uma das lnguas oficiais (Lngua Inglesa ou Lngua Francesa) deve ser vertido para a outra
lngua e vice-versa.
Nesse sentido, esses estudos tm sido realizados no Brasil nas mais diferentes reas
como na Economia, nos Efluentes, na Geografia Poltica, na Inteligncia Artificial, na
Epilepsia, na Informtica, etc. Muitos desses temas esto sendo desenvolvidos na equipe da
qual o ps-graduando faz parte sob superviso da Sra. Orientadora, Prof. Dr. Ieda Maria
Alves, a partir da coordenao que exerce no Projeto Integrado de Pesquisa "Observatrio de
Neologismos Cientficos e Tcnicos do Portugus Contemporneo" com o apoio do Conselho
Nacional de Desenvolvimento Cientfico e Tecnolgico (CNPq) - (Processo 522419/95-0),
desde 1988.
Apenas a ttulo de exemplo, vale a pena citar os depoimentos de dois usurios do
website disponibilizado pelo ps-graduando na Internet entre novembro de 1999 e maro de
2002, no endereo eletrnico http://www.pessoal.onda.com.br/manoelma: Na verdade, este
website continha a parte prtica da Dissertao de Mestrado j aludida, ou seja, o Dicionrio
Terminolgico sem a parte terica apresentada na defesa. Ele foi disponibilizado com o
intuito de se obter um retorno por parte dos especialistas da rea em questo. No entanto,
dentre as dezenas de retornos obtidos, muitos foram surpreendentes. Eis os depoimentos:

Caro Manoel, / Trabalho na rea de planejamento em uma empresa de
manufatura, e aqui, (sic) estamos iniciando os trabalhos de implantao dos
tpicos da Qualidade Total para a obteno da ISO. / Participando das




20


reunies, notei que alguns termos e tpicos abordados ficaram de certa
forma sem a devida compreenso. / Agora que encontrei esse site, vou
elaborar uma cartilha bsica com informaes que sero teis para
realizarmos nossos treinamentos/conscientizao dos funcionrios, pois se
levssemos termos e jarges tcnicos ao pessoal de cho de fbrica acredito
que no conseguiramos alcanar os objetivos. / Por isso, fiquei muito
contente por ter disposio estas informaes, e acredite, ter (sic) uma
grande aplicabilidade. / PCP Pessoas Comprometidas Permanentemente.
(Melhoria Contnua da Qualidade) / Sds.
1


Uma outra mensagem eletrnica dizia o seguinte:

Oi, meu nome e (sic) Julio. Sou analista de sistemas da URBS Urbanizao
de Curitiba S/A. Estamos implantando em nossa empresa os 5S da qualidade
total e eu fao parte da comissao (sic) responsvel pelo assunto. / J
avanamos um pouco com a finalizao do 3 S. Agora nos resta o 4 e o 5
S. A fase agora a de concientizar (sic) as pessoas no sentido de economizar
os recursos que nos so proporcionados, como por exemplo: xerox, papel,
copinhos descartveis, gua, luz.... / Gostaria muitissimo (sic), se possvel,
de receber algum material sobre esse assunto, que nos ajudem na
concretizao desse trabalho. / Todo tipo de material ser muito bem
recebido / Desde j, agradeo sua colaborao.


1
Mensagem eletrnica enviada em 7/1/00, s 9h18min, por Juarez Henrique Jnior, Supervisor de PCP da
Organizao Brightpoint do Brasil, produtora de componentes de segurana para aparelhos celulares, com sede
no Estado de So Paulo.





21


(Julio Panicio / URBS Urbanizao de Curitiba S/A).
2


Muitas outras mensagens foram enviadas, pois o website possibilitava um contato
entre o usurio e o autor para que aquele pudesse enviar sugestes ou crticas. Para se ter uma
idia, nada menos do que 38 (trinta e oito) mensagens foram enviadas e 5.051 (cinco mil e
cinqenta e um) internautas visitaram o website at o dia 18 de maro de 2002, quando ento
foi solicitado o seu cancelamento. No entanto, estas duas mensagens so significativas do
universo coletado e vo ao encontro dos objetivos traados que, como j aludido, diziam
respeito ao feed-back dos especialistas e da pertinncia desta terminologia para eles, enquanto
usurios finais.
Como se pde perceber por estas mensagens eletrnicas, a rea de Letras pode
desenvolver pesquisas que sejam utilizadas no mundo do trabalho empresarial. Esta, ora
apresentada, procura dar continuidade pesquisa anterior, da gesto pela qualidade total em
manufatura. A rea de especialidade dos servios o setor da economia que mais se
desenvolve ultimamente, embora essa terminologia esteja se constituindo ainda. Basicamente,
segundo a literatura existente, servios so trabalhos executados para atender a terceiros
dentro ou fora de uma organizao. Por outro lado, segundo o dicionrio de lngua geral mais
utilizado no Brasil, o Dicionrio Aurlio, em sua verso eletrnica, no h meno ao
vocbulo no plural e a forma no singular traz nada menos do que 22 (vinte e dois) significados
para o mesmo, mas apenas o 19 (dcimo nono) apresenta um significado terminolgico:

2
Mensagem eletrnica enviada em 23/5/00, s 17h52min, por Julio Panicio, Supervisor de Sistemas da
Urbanizao de Curitiba S. A. (URBS), localizada no Estado do Paran.





22


"Econ. Produto da atividade humana que, sem assumir a forma de um bem material, satisfaz
uma necessidade".
3

Polticos e economistas vm sucessivamente afirmando que, embora a indstria de
transformao perca empregos, esses esto se transferindo para o setor de servios. Este setor
tem adquirido tanta importncia para a economia do Brasil que j conta com reportagens em
jornais de grande circulao, como O Estado de S. Paulo. Esse veculo trouxe, em 25 de
agosto de 2002, uma matria com o sugestivo ttulo "Servios devero puxar o crescimento".
4

Neste texto, no qual entrevistada a especialista Sheila Najberg, gerente-executiva da rea de
emprego do Banco Nacional de Desenvolvimento Econmico e Social (BNDES),
apresentado um retrato das contas do pas onde se observa que, de acordo com nmeros do
Instituto Brasileiro de Geografia e Estatstica (IBGE), esta tendncia observada. Diz a
especialista que, no perodo entre 1990 e 2000,

... o valor da produo industrial caiu 3%, enquanto a alocao da mo-de-
obra recuou ainda mais, 21%. J no comrcio, o valor da produo recuou
5% e a participao do emprego cresceu 15%. No setor de servios, o valor
da produo aumentou 6% na dcada de 90 e a mo-de-obra empregada
cresceu 30% nessa mesma poca.

Ela ainda explica que:

...a reduo do emprego na indstria resultou, em parte, da abertura
comercial acelerada que fez com que as empresas instaladas aqui adotassem

3
FERREIRA, Aurlio B. de Holanda. Dicionrio Aurlio Eletrnico V.1.3., 1994, s/p.
4
CHIARA, M. de. Servios devero puxar o crescimento. In Jornal O Estado de S. Paulo, 2002, p. B 9.




23


padres de competitividade mais rigorosos. Para isso, as companhias
reestruturaram os mtodos de produo e terceirizaram vrios servios que
no faziam parte do foco do negcio, como refeio, limpeza, entre outros.
Alm disso, com a privatizao, surgiu um grande nmero de empresas
prestadoras de servios. "O que ns percebemos que, enquanto as
indstrias demitem, as prestadoras de servios absorvem essa mo-de-obra".

Ainda como intuito de demonstrar essa importncia, vale citar o surgimento de
publicaes especficas encartadas em jornais de grande circulao. o caso, por exemplo, do
Jornal de Servios, Publicao Quinzenal do Trabalho Temporrio e da Terceirizao,
encartado no Jornal O Estado de S. Paulo. No nmero 162, do ano 4, publicado em 2 de
fevereiro de 2003, consta que:

O setor de servios foi o que mais contribuiu para a gerao de empregos em
2002, segundo revelam dados do Cadastro Geral de Empregados e
Desempregados (Caged) do Ministrio do Trabalho e Emprego. O setor
respondeu por mais de 285 mil (37,5%) dos 762 mil postos criados no
perodo.
Em segundo lugar, veio o comrcio, com 283 mil novos postos, e logo em
seguida a indstria de transformao, com 161 mil. J a construo civil foi a
atividade com pior desempenho, apresentando saldo negativo: eliminou 29
mil vagas a mais do que criou.
Embora com oscilaes, o levantamento do Ministrio aponta uma tendncia
ascendente na criao de empregos no pas. O saldo geral de 2002 superou o
de 2001, quando foram gerados 591 mil postos, e o de 2000, que registrou




24


658. Um ano antes, quando o Caged divulgou seus primeiros dados, o saldo
havia sido negativo em 196 mil vagas.
5


Desse modo, h uma procura muito grande por parte dessas organizaes de servios
pela obteno do Certificado ISO 9001, que normalizou os procedimentos de prestao de
servios com qualidade. No h, por um lado, no mercado editorial brasileiro, nenhuma obra
especfica que contemple as UCEs relacionadas gesto pela qualidade total nessa rea. H,
sim, por outro lado, uma vez que o ineditismo desta Tese encontra-se nos procedimentos
metodolgicos, obras cunhadas por especialistas que foram publicadas sem muitos critrios,
inclusive mesclando manufatura e servios como se distino no houvesse entre os dois
modos de obteno da qualidade.
O pesquisador possui informaes, de 1994, da publicao dos Fascculos Folha
QT. Esses fascculos faziam parte de um projeto da Empresa Folha da Manh S. A. e
circularam encartados no Jornal Folha de S. Paulo entre os dias 13 de maro de 1994 e
1 de maio de 1994. O objetivo desses fascculos era trazer informaes sobre a gesto
pela qualidade total em uma linguagem acessvel ao grande pblico, a denominada
divulgao terminolgica. Escritos por Roberto Grimaldi e Jos Humberto Mancuso, a
publicao trazia tambm um pequeno glossrio e algumas referncias bibliogrficas.
Alm desse, h conhecimento tambm do Glossrio da qualidade total, que foi
elaborado pelos professores Alberto Amarante Macedo e Francisco Liberato Pvoa
Filho. A obra foi publicada em 2. ed. revista e ampliada no ms de julho de 1995. A
edio ficou por conta da Fundao Christiano Ottoni da Escola de Engenharia da

5
JORNAL DE SERVIOS. In Jornal O Estado de S. Paulo, Caderno de Classificados Empregos, 2003, p. 8.




25


Universidade Federal de Minas Gerais. Em sua apresentao, Jos Martins de Godoy,
Diretor da referida Fundao, colocava:

Promovemos a elaborao e a edio deste Glossrio da Qualidade
Total, para atender a todos os que participam do Projeto TQC -
Controle da Qualidade Total, bem como aos que militam na rea.
Colaboraram em sua elaborao instrutores e consultores da Fundao
Christiano Ottoni, bem como pessoas ligadas a empresas vinculadas ao
mencionado projeto.
6


Como se observa, o dicionrio, tratado como glossrio, no contou com a
colaborao de nenhum especialista em terminologia/terminografia. Possuindo
aproximadamente 350 (trezentas e cinqenta) UCEs, a referida obra no traz a
microestrutura como preconizada nas teorias terminolgicas. Alm disso, suas
definies so extensas, o que em nada auxilia na compreenso dessas unidades.
A outra obra que se conhece denomina-se Dicionrio de termos da qualidade.
Foi elaborada por Paulo Mundin Prazeres, engenheiro qumico, ps-graduado em
Engenharia pelo Instituto Tecnolgico da Aeronutica (ITA) e em Administrao de
Empresas pela Escola de Administrao de Empresas de So Paulo/Fundao Getlio
Vargas (EAESP/FGV). tambm engenheiro de qualidade certificado pela American
Society for Quality Control (ASQC) e tem cursos de especializao de qualidade na


6
MACEDO & PVOA FILHO. Glossrio da qualidade total, 1995, p. 3.




26


Alemanha e Estados Unidos da Amrica (EUA), alm de vasta experincia em
implantao de sistemas de qualidade em empresas industriais e de servios de grande,
mdio e pequeno porte.
Como a obra anterior, essa tambm no contou com a colaborao de um
terminlogo e foi elaborada por um especialista da rea. A obra rene
aproximadamente 4.000 (quatro mil) UCEs e expresses (sic) da qualidade. Isso
porque, alm da GQT, inclui termos de administrao, confiabilidade, estatstica,
inspeo, jurisprudncias, metrologia, normalizao, probabilidade, produo,
produtividade, projeto de experimentos, psicologia e tecnologia. O autor, na
apresentao, declara:

Este livro uma obra, at onde sei, totalmente original (no mundo).
Entretanto, procurando fazer uso da mais elevada conscincia
profissional e franqueza, desejo esclarecer:
i. incompleto como todo e qualquer dicionrio.
ii. em sua grande maioria, uma compilao de definies, conceitos,
pareceres e teorias de um sem-nmero de profissionais de diversos
pases.
iii. fruto de uma necessidade de auto-realizao, aliada ao estmulo e
colaborao de alguns amigos, sobretudo meus pais.
7


Como se observa, a falta de um colaborador na confeco de uma obra
terminogrfica traz certos desencontros entre a academia e o mundo cientfico. Como

7
PRAZERES, Paulo Mundin. Dicionrio de termos da qualidade, 1996, p. 7.




27


na obra anterior, essa traz muitas remissivas e uma microestrutura sem respaldo nas
teorias terminolgicas. Suas definies so, na grande maioria das UCEs, muito
extensas. O dicionrio quase enciclopdico, pois apresenta uma grande quantidade de
grficos e apndices. O apndice 1 traz a relao de Associaes para a Qualidade
existentes no Brasil. O apndice 2 traz as instituies certificadoras de Sistemas da
Qualidade segundo a ISO 9000 do Brasil e do exterior com sede no Brasil. O apndice
3 apresenta uma ampla relao de laboratrios de ensaio e metrologia. O apndice 4
traz uma relao das sociedades prestadoras de servios de inspeo credenciadas pelo
Inmetro. Por ltimo, o apndice 5 uma relao de cursos de Ps-Graduao e
Certificao em Qualidade no Brasil.
Portanto, pode-se considerar que uma contribuio como esta apresentada possa ser
til tanto para o mundo acadmico quanto para o mundo do trabalho empresarial, apesar de
no estar to em voga a questo da qualidade, uma vez que a mesma j tenha sido incorporada
ao cotidiano de muitas organizaes. Para a academia, ser a oportunidade de mais uma vez
estar empregando teorias terminolgicas/terminogrficas em uma rea de especialidade. Para
o mundo do trabalho empresarial e, especificamente, do setor de servios, ser a oportunidade
de utilizao de um trabalho acadmico.











28


I. 2. Justificativas ao tema
Mas, o que vem a ser a gesto pela qualidade total? Basicamente, essas idias,
segundo Silva,
8
comportam parte da gerncia global que determina e implementa a poltica
da qualidade a partir de um conjunto de procedimentos que incluem planejamento estratgico,
alocao de recursos e outras atividades sistemticas como o planejamento, o controle e a
Melhoria da qualidade. A definio oficial da International Organization for Standardization
Organizao Internacional de Normalizao (ISO) : A qualidade o conjunto das
propriedades e caractersticas de um produto, processo ou servio que lhe fornecem a
capacidade de satisfazer as necessidades explcitas ou implcitas.
9
A definio dada pela
Associao Francesa de Normalizao (Afnor) bem prxima: A qualidade a capacidade
de um produto ou servio satisfazer as necessidades dos usurios.
10
A definio inglesa
engloba exatamente a definio francesa: The totality of features and characteristics of a
product, process or service that bear on its ability to satisfy stated or implied needs. A
totalidade de aspectos e caractersticas de um produto, processo ou servio que tem a
capacidade de satisfazer necessidades implcitas ou explcitas.
11
A definio japonesa da
Norma JIS-Z-8101 de 1981 : A gesto da qualidade um sistema de meios colocados em
prtica para produzir economicamente produtos ou servios que satisfaro as necessidades dos
clientes.
12
Se os tericos mais conhecidos dessa rea de especialidade forem consultados, se
ver que, por exemplo, para Kaoru Ishikawa, um dos mestres da escola japonesa da qualidade,
a gesto da qualidade consiste em desenvolver, criar e fabricar mercadorias mais
econmicas, teis e satisfatrias para o comprador. Administrar a qualidade tambm

8
Cf. SILVA, Manoel M. A. da. Dicionrio terminolgico da gesto pela qualidade total, 1988, p. 104.
9
Cf. TEBOUL, J. Gerenciando a dinmica da qualidade, 1991, p. 54.
10
Cf. TEBOUL, J. Op. Cit., p. 54.
11
Cf. TEBOUL, J. Op. Cit., p. 56.
12
Cf. TEBOUL, J. Op. Cit., p. 56.




29


administrar o preo de custo, o preo de venda e o lucro.
13
Para Philip Crosby, um dos
precursores do movimento zero defeito que levou um grande nmero de organizaes a essa
revoluo cultural, a qualidade significa ir ao encontro das exigncias: meeting the
requirements (especificao por parte do cliente de suas necessidades).
14
J para Juran, o
renomado consultor americano, a qualidade a aptido para o uso, fitness for use. Para Pat
Townsend, que criou um Plano de Qualidade Total para uma companhia de seguros
americana, a Paul Revere, a qualidade seria aquilo que o cliente percebe quando sente que o
produto ou servio vai ao encontro das suas necessidades e corresponde s suas
expectativas.
15
Ele distingue entre a qualidade de percepo e a qualidade de fato. A primeira
fazer aquilo que deve ser feito, isto , o bom produto ou o servio de boa qualidade, a
eficcia. A segunda fazer como deve ser feito, isto , o produto ou o servio de boa
qualidade, a eficincia. Um outro consultor renomado, Tom Peters, autor do livro A paixo
pela excelncia, coloca que a qualidade deve apresentar o aspecto dinmico do algo mais
pois no queremos apenas satisfazer o cliente, queremos seduzi-lo, queremos que ele vibre de
desejo!
16
Uma outra contribuio aquela dada por Genichi Taguchi. Para ele, a qualidade
consiste em minimizar as perdas causadas pelo produto no apenas ao cliente, mas
sociedade, a longo prazo.
17
Resumindo, h concordncia aqui com a definio dada por
James Teboul, que esclarece que a qualidade a capacidade de satisfazer as necessidades,
tanto na hora da compra, quanto durante a utilizao, ao melhor custo possvel, minimizando



13
Cf. TEBOUL, J. Op. Cit., p. 56.
14
Cf. TEBOUL, J. Op. Cit., p. 56.
15
Cf. TEBOUL, J. Op. Cit., p. 58.
16
Cf. TEBOUL, J. Op. Cit., p. 59.
17
Cf. TEBOUL, J. Op. Cit., p. 59.




30


as perdas, e melhor do que os nossos concorrentes.
18

Mas, como tudo isso comeou? As idias preconizadas pela GQT iniciaram-se no
Japo na dcada de 50 do sculo XX. Era uma poca em que os japoneses estavam arrasados
economicamente devido s contingncias inevitveis que se abateram sobre o pas aps a
derrota na II Guerra Mundial. Eles, ento, convidaram, por meio da Union of Japanese
Scientists and Engineers Unio dos Cientistas e Engenheiros Japoneses (Juse), um
americano de nome William Edwards Deming para uma srie de conferncias naquela
entidade para os engenheiros e gerentes de fbricas. Posteriormente, os altos executivos
japoneses ouviram o especialista e acreditaram em suas idias, o que no havia acontecido nos
Estados Unidos da Amrica (EUA).
Essas mesmas idias, que deram resultado no Japo, acabaram por ser
implementadas tambm nos EUA tempos depois, j que os japoneses acabaram
ganhando mercado dos americanos.
No Brasil, as mesmas idias chegaram bem depois. Apenas em 1987 que se
conhece uma empresa obtendo o Certificado da Srie ISO 9000. Foi a Siemens,
organizao fabricante de equipamentos pesados e de capital alemo. Desde ento, por
fora da competio acirrada entre as organizaes e pela abertura do mercado
brasileiro competio internacional, no final de 1995 o pas j ocupava o 20
(vigsimo) lugar no ranking/pas do mundo com 923 (novecentos e vinte e trs)
Certificados da srie ISO 9000, que normalizou os procedimentos da GQT.
A novidade no parou por a. Em agosto de 1996, o Brasil j acumulava 1.292
(mil duzentas e noventa e duas) emisses da srie ISO 9000 com possibilidade de
alcanar, como alcanou no final do ano, um total de 1.500 (mil e quinhentas)

18
Cf. TEBOUL, J. Op. Cit., p. 62.




31


organizaes detentoras de Certificados de Qualidade. No final de 1999, nada menos
do que 3.333 (trs mil trezentas e trinta e trs) organizaes estavam certificadas no
pas, enquanto outras 144.669 (cento e quarenta e quatro mil, seiscentas e sessenta e
nove) eram certificadas no exterior pelas mesmas certificadoras que atuavam no Brasil,
obtendo-se um montante de 148.002 (cento e quarenta e oito mil e duas). Atualmente,
s no Brasil, j so mais de 6.000 (seis mil) organizaes certificadas. Esses dados, os
ltimos disponveis, datados de 20 de junho de 2000, so do Instituto Nacional de
Metrologia, Normalizao e Qualidade Industrial (Inmetro), rgo do Ministrio da
Cincia e Tecnologia (MCT) do governo brasileiro, com fonte no Brasilian Quality
Index - BQI.
19

O Inmetro coordena o Sistema Brasileiro de Certificao (SBC). Pertencentes
ao SBC esto alguns organismos nacionais e internacionais responsveis pela vistoria e
atestado de que a organizao adotou certas normas de gesto de qualidade,
reconhecidas internacionalmente, no processo produtivo ou na prestao de servios.
So elas: a Associao Brasileira de Normas Tcnicas (ABNT), a ABS Group Services
do Brasil Ltda., a Avaliaes da Qualidade Ltda. S/C
___
RWTV IBQN Associados
(BRTV), a Britisth Standards Institution
___
Quality Assurrance (BSI), a Bureau
Veritas Quality International (BVQI), o Centro Tcnico Aeroespacial Instituto de
Fomento e Coordenao Industrial (CTA/IFI), o Centro Cermico do Brasil (CCB), a
DNV Certificadora Ltda., a Det Norske Veritas Certificadora Ltda. (DNV), a Deutsche
Gessellschalft zur Zertifizierung von Managementsystemen mbh (DQS), a Fundao
Carlos Alberto Vanzolini (FCAV), o Fondo para la Normalizacin y la Certificacin

19
Cf. ORGANISMOS CERTIFICADORES PARA SISTEMAS DA QUALIDADE: Nmero de Certificados
Emitidos. [Braslia. D. F.: Ministrio da Cincia e Tecnologia, 2000?]. Disponvel em:
<http://www.mct.gov.br/temas/info/ds1/qualidad/indcert5.htm >. Acesso em 20 jun. 2003.




32


de la Calidad (Fondonorma), a Germanischer Lloyd Certification South America Ltda.,
o Instituto da Qualidade Automotiva (IQA), o Instituto Argentino de Racionalizacin
de Materiales (Iram), o Instituto de Tecnologia e Qualidade da Construo (ITQC), o
Lloyds Register Quality Assurance Ltd. (LRQA), o Registro Italiano Navale (Rina), a
Sociedade dos Auditores de Sistema (SAS), a SGS ICS Certificadora Ltda., o Instituto
de Tecnologia do Paran (Tecpar), a Unio Certificadora para o Controle de
Conformidade de Produtos, Processos ou Servios (UCIEE) e o Instituto Uruguaio de
Normas Tcnicas (Unit).
20
Alm desses Organismos Certificadores para Sistemas da
Qualidade pertencentes ao SBC, h outros que no so pertencentes a esse sistema. So
eles: a Ceramic Industry Certification Scheme Ltda. (CICS), o Istituto Italiano del
Marchio di Qualit (IMQ), o Intertek Testing Services Quality Systems (ITS), o
National Standards Authority of Ireland (NSAI), o RWTV (TV CERT), a Schweiz.
Vereiningung fr Qualitatssicherungzertifikate (SQS), o TV Bayern Brasil (TV
CERT), o TV Essen, o TV International do Brasil Ltda. (Grupo TV Rheinland), o
TV Sudwest (TV CERT) e o Underwriters Laboratories Inc. UL.
21
Esses dados
esto de acordo com os publicados pelo Comit Brasileiro da Qualidade (CB-25),
pertencente Associao Brasileira de Normas Tcnicas (ABNT), representante no
Brasil da International Organization for Standardization (ISO), organizao no-
governamental responsvel pela elaborao de normas de aplicao internacional, que
tem sua sede mundial em Genebra, Sua, foi fundada em 23 de fevereiro de 1947 e

20
Cf. ORGANISMOS CERTIFICADORES PARA SISTEMAS DA QUALIDADE PERTENCENTES AO
SISTEMA BRASILEIRO DE CERTIFICAO. [Braslia. D. F.: Ministrio da Cincia e Tecnologia, 2000?].
Disponvel em: <http://www.mct.gov.br/temas/info/ds1/qualidad/indcert.htm >. Acesso em 20 jun. 2003.
21
Cf. ORGANISMOS CERTIFICADORES PARA SISTEMAS DA QUALIDADE NO PERTENCENTES
AO SISTEMA BRASILEIRO DE CERTIFICAO. [Braslia. D. F.: Ministrio da Cincia e Tecnologia, 2000?].
Disponvel em: <http://www.mct.gov.br/temas/info/ds1/qualidad/indcert2.htm >. Acesso em 20 jun. 2003.





33


atualmente conta com a participao de 91 pases que representam mais de 95% da
produo industrial e prestao de servios do mundo.
Esses organismos certificadores verificam, nas organizaes que os contratam,
se as mesmas possuem os procedimentos adequados de acordo com a srie ISO 9000.
Essa um conjunto de normas de GQT nas organizaes, normalizadas pela ISO, com
cinco verses conforme o grau de exigncia. Mas, por que adot-las? Primeiro, porque
a norma escolhida pela organizao estabelece um modelo para especificao,
documentao e manuteno de um sistema da qualidade econmico e eficaz. Segundo,
porque uma norma aceita internacionalmente, o que facilita a comercializao dos
produtos/servios oferecidos ao mercado. Terceiro, porque uma exigncia dos
clientes que s negociam, ou preferem negociar, com organizaes certificadas. Por
ltimo, possuir uma certificao em um mundo globalizado como o atual passou a ser
um instrumento de marketing, criando uma imagem de organizao diferenciada das
demais.
Em relao s cinco normas vigentes desde 1994, vale esclarecer que a ISO
9000 normaliza a seleo das demais normas da srie, incluindo tambm aspectos
conceituais relativos qualidade. A ISO 9001, no Brasil NBR ISO 9001, a mais
completa e exigente, pois inclui as atividades e procedimentos para garantia da
qualidade em projetos, desenvolvimento, produo, instalao e servios associados.
mais completa do que as duas posteriores. A ISO 9002, no Brasil NBR ISO 9002,
exclui o projeto, mas um modelo para garantia da qualidade na produo, instalao
e servios associados. A ISO 9003, no Brasil NBR ISO 9003, limita-se
demonstrao, pelo fornecedor, de sua capacidade na realizao de inspeo e ensaios
dos produtos acabados. A ISO 9004, no Brasil NBR ISO 9004, voluntria e no




34


implica certificao, ao contrrio das trs anteriores, que tm carter contratual, ou
seja, envolvem a exigncia, pelo comprador, de que o fornecedor seja capaz de seguir
criteriosamente determinadas normas de qualidade.
importante ressalvar que essas caractersticas das normas perduraram at o
ano de 2000, quando ento houve uma reviso peridica, patrocinada pela ABNT com
apoio da ISO, obrigatria a cada sete anos, uma vez que a verso anterior era de 1994,
e o sistema sofreu modificaes que simplificaram a certificao das organizaes
interessadas. Foram elas:
i. das cinco normas da verso anterior, a nova eliminou ou substituiu duas e
preconizou agora apenas trs;
ii. a ISO 9000 : 2000, Fundamentos e Vocabulrio de Sistemas de Gesto da
Qualidade, cancelou e substituiu a NBR ISO 8402 : 1994, a NBR ISO 9000-1 :
1994 e a NBR ISO 9000-2 : 1994;
iii. a ISO 9001 : 2000, Requisitos de Sistemas de Gesto da Qualidade, cancelou e
substituiu a NBR ISO 9002 : 1994 e a NBR ISO 9003 : 1994, como tambm
substituiu a NBR ISO 9001 : 1994;
iv. a ISO 9004 : 2000, Diretrizes para melhoria do desempenho da organizao e
satisfao dos clientes e das outras partes interessadas, cancelou e substituiu a
NBR ISO 9004-1 : 1994, a NBR ISO 9004-2 : 1999 e a NBR ISO 9004-3 :
1999;
v. a nova verso apresentou a norma ISO 19.011 : 2000, Diretrizes sobre auditoria
de Sistemas de Gesto da Qualidade e Ambiental, embora tenha mantido a NBR
ISO 14.000 : 1999;




35


vi. na nova verso, apenas a ISO 9001 : 2000 certificadora, ou seja, o que
certificado o Sistema de Gesto da Qualidade em comparao ao estabelecido
anteriormente.
22

No entanto, como a Associao Brasileira de Normas Tcnicas (ABNT),
enquanto representante da ISO no Brasil, constituda como uma organizao no-
governamental e sujeita s intempries do mercado, a mesma tambm passa por
momentos difceis, s vezes. Foi o que ocorreu recentemente quando o pas perdeu o
direito de voto na organizao que cuida das normas mundiais de qualidade por falta
de pagamento. Seu faturamento, no entanto, foi de R$ 10 milhes (dez mihes de
reais) em 2001. No obstante, possua uma equipe com 76 (setenta e seis)
colaboradores fixos, 1.235 (mil duzentos e trinta e cinco) associados, 53 (cinqenta e
trs) comits tcnicos e 10.980 (dez mil novencentas e oitenta) normas em vigor. Ela
ainda sobrevive da venda dessas normas, o que representou um faturamento
considervel, uma vez que foram vendidas cerca de seis mil normas que custavam
entre R$ 14,40 (quatorze reais e quarenta centavos) para a norma acstica, e R$ 139,30
(cento e trinta e nove reais e trinta centavos) para a norma sobre equipamentos
eletromdicos. Alm disso tudo, a organizao j emitiu 2,5 milhes de certificados
desde a sua fundao para produtos, sistemas e servios e participava em 108 (cento e
oito) comits tcnicos e 322 (trezentos e vinte e dois) subcomits tcnicos na
International Organization for Standization (ISO).
23

H na ABNT, realmente, normas para tudo. H, inclusive, uma norma que versa
sobre o contrapeso que todo fogo deve ter, a fim de evitar que uma criana abra a

22
Cf. TREINAMENTO TECNOLGICO: Gesto da Qualidade Total e Certificao ISO 9000 : 2000. So
Paulo, 2002, p. 100.
23
Cf. KNAPP, Laura. Brasil saiu da ISO por falta de pagamento. In Jornal O Estado de S. Paulo, 2002, p. A11.




36


porta do forno, suba nela e o fogo inteiro tombe em cima dela. H regras sobre como
devem ser montados playgrounds em edifcios residenciais ou como instalar fiao
eltrica. Ao todo, so 10.980, com j dito. Mas, essas normas no so leis, apesar de
que alguns advogados interpretem que, depois do Cdigo do Consumidor, poderiam
ser consideradas como tal.
No entanto, em relao s normas da Srie ISO 9000 : 2000, h uma seriedade
maior, apesar da polmica instalada em torno desses certificados da ISO. Comenta-se
que teria havido uma certa banalizao para sua concesso. No Brasil, alm da ABNT,
como j demonstrado, outras 97 (noventa e sete) organizaes podem emiti-los. O que
ocorre, na verdade, que o certificado mal usado e muitas vezes as organizaes
fazem propaganda enganosa, ou seja, dizem que o obtiveram, mas no verdade.
Segundo o diretor-geral da ABNT, entrevistado por Laura Knapp em 2002,

Ao contrrio do que parece, exibir um ISO 9001 : 2000 no significa
que o produto ou que a empresa seja de qualidade. Significa apenas
que o sistema de gerenciamento da empresa foi certificado. Por
exemplo, que ela acompanha seus procedimentos e pode rastrear onde
ocorreu algum problema.
24


Por outro lado, e como aludido anteriormente, muitas organizaes pleiteiam
essa certificao. Inclusive, h entidades, como a Associao Brasileira das Empresas
de Servios Terceirizveis e de Trabalho Temporrio (Asserttem) e o Sindicato das
Empresas de Prestao de Servios a Terceiros, Colocao e Administrao de Mo-

24
KNAPP, Laura. Brasil saiu da ISO por falta de pagamento. In Jornal O Estado de S. Paulo, 2002, p. A11.




37


de-Obra e de Trabalho Temporrio no Estado de So Paulo (Sindesprestem), que se
organizaram para lanar em abril de 2003 um programa inovador para a certificao de
suas organizaes associadas e filiadas s entidades. Diz a chamada:

O Projeto ISO 9001 Compartilhada pretende viabilizar o sistema pelo
mtodo de compartilhamento, que consistir em consultorias e
treinamentos, coletivos e individuais, por um perodo de nove meses.
Grupos de dez empresas participaro, primeiramente, de workshops
acerca das exigncias da norma ISO 9001 : 2000, a fim de que
elaborem os seus procedimentos de qualidade. Uma vez por ms, cada
um receber, ento, consultoria individual para monitoramento do
processo de implantao dos requisitos expostos nos workshops.
Tambm faro parte do programa treinamentos obrigatrios
ministrados aos profissionais que cada empresa escolher como
multiplicadores. Ao final dos nove meses da implantao do Sistema
de Gerenciamento da Qualidade, as empresas j podero receber a
auditoria de certificao, a ser realizada pelo rgo certificador
escolhido e contratado por elas.
25


Nesse contexto aludido, percebe-se claramente que apenas as grandes
organizaes conseguiam o Certificado da srie ISO 9000, hoje ISO 9001 : 2000.
Como elas possuem muitos fornecedores, principalmente em se tratando de
montadoras de automveis, comearam a exigir dos mesmos essa certificao. Para
manterem-se no mercado e serem competitivas, essas pequenas e mdias organizaes

25
Cf. JORNAL DE SERVIOS. In Jornal O Estado de S. Paulo, Caderno de Clasificados Empregos, 2003, p. 9.




38


fornecedoras iniciam seus projetos de GQT, em busca do Certificado de Qualidade da
srie ISO 9000. Esbarram, porm, em dificuldades essencialmente ligadas ao nvel de
escolaridade de seus colaboradores, j que isso notrio. Para resolver o impasse,
investem em educao e exigem dos mesmos o retorno aos bancos escolares. Mas a
GQT exige muito mais. Os colaboradores tm de entender e aplicar os diversos
conceitos que acompanham a implantao e a manuteno da GQT.
Uma das primeiras etapas da implantao da GQT a elaborao do Manual da
Qualidade. Esse manual geralmente redigido por consultores e/ou por especialistas
da prpria organizao que no seguem normas tcnicas preconizadas pela
terminologia. Dessa forma, a tendncia que haja uma maior dificuldade para os
colaboradores, pois so exigidos dos mesmos relatrios em que essas UCEs devam ser
utilizadas corretamente e, nesse sentido, sintomtico o comentrio de um dos
usurios j transcrito.
necessrio acrescentar, neste momento, que o objetivo da pesquisa relaciona-se
apenas com a recolha e a definio das UCEs que compem a gesto pela qualidade total em
servios. Como pertencente a uma rea do conhecimento diversa daquela do objeto da
pesquisa, ou seja, a Tese destina-se obteno do ttulo de Doutor em Letras, no se pretende
aqui encerrar o assunto. Trata-se apenas de um pesquisador que identificou no tema a
oportunidade de uma aplicabilidade terica dentro de uma especializao terminolgica.
Dessa forma, a justificativa pela escolha do tema acadmica e o seu interesse est
relacionado ao mundo do trabalho empresarial.
O objetivo especfico da Tese elaborar uma pesquisa terminolgica monolnge
descritiva acerca das UCEs relacionadas a uma rea especfica da lngua portuguesa
denominada gesto pela qualidade total em servios, por meio da organizao desses




39


elementos em um Dicionrio Terminolgico.
Essa questo de apresentao de UCEs ligadas a uma rea de conhecimento
especializado insere-se em um contexto mais abrangente desenvolvido sob superviso da
Profa. Orientadora e que j foi mencionado. Tal fato, em termos gerais, est ligado ao
processo desencadeado pela globalizao econmica que colocou em pauta as lnguas
utilizadas por pases considerados emergentes devido influncia da lngua inglesa,
principalmente, sobre elas. Haveria, por parte desses pases, inteno ou mesmo motivao
para o desenvolvimento de equipes que pudessem trabalhar na harmonizao dessas novas
noes que vieram juntamente com a influncia tcnico-cientfica que esse processo
desencadeou?
Na lngua geral, os falantes comearam a adotar esses novos vocbulos da forma como
so vinculados pela grande imprensa e pela mdia em geral, os assim denominados corpora de
divulgao. Por esse motivo, uma polmica instalou-se a ponto de se abordar o problema
tendo em vista a preservao da lngua portuguesa diante da imposio dos estrangeirismos e
dos emprstimos lingsticos, uma vez que houve excessos. Nas grandes metrpoles, por
exemplo, j seria considerado um avano se os falantes passassem a utilizar a unidade lxica
entrega rpida em vez de delivery.
Na realidade, o problema do emprstimo lingstico no se resolve com atitudes
reacionrias, com o estabelecimento de barreiras ou cordes de isolamento entrada de
palavras e expresses de outros idiomas. Resolve-se com o dinamismo cultural, com o gnio
inventivo do povo e com as resolues para suprir as necessidades dos especialistas das mais
diferentes reas do conhecimento. Povo que no forja cultura dispensa-se de criar unidades
lexicais com energia irradiadora e tem de conformar-se, queiram ou no queiram os seus
gramticos, condio de mero usurio de criaes alheias. E isso tem sido realizado pela




40


equipe da qual o ps-graduando participa, com produes de glossrios e anlises
lexicolgicas das mais diversas reas do conhecimento humano.
Nos estudos terminolgicos, essa questo inicialmente foi resolvida com a admisso
de estrangeirismos para fazer frente s necessidades das diversas lnguas de especialidade.
Com o passar do tempo, tericos e especialistas das mais diversas reas iniciaram um trabalho
de cooperao no sentido de viabilizar tradues dessas UCEs para suas lnguas. Da a
existncia, hoje, de um nmero considervel de dicionrios bilnges que buscam harmonizar,
na rea de conhecimento especfica, as solues propostas por especialistas e estudiosos da
terminologia.
No Brasil no foi diferente. Tendo como lngua oficial a lngua portuguesa, o pas se
ressentia da dificuldade comunicacional que essa lngua trazia, principalmente na
comunicao empresarial. Dadas as dificuldades de fomento pesquisa no pas, o Portugus,
como lngua oficial do Brasil, sempre foi considerado menos importante do que o Ingls, por
exemplo, em se tratando de criao neolgica e neonmica j que, de um lado, decorreu um
sentimento, partilhado por muitos, de que a lngua portuguesa menos apta para exprimir
todas as noes cientficas ou tcnicas que proliferam no mundo contemporneo, noes
essas, na maioria das vezes, criadas nos Estados Unidos da Amrica, pas cuja lngua oficial
a Lngua Inglesa e, de outro lado, uma espcie de passividade diante da invaso do
vocabulrio especializado desse idioma, importado ao mesmo tempo em que vm as
novidades tcnico-cientficas. Ainda nesse item, cite-se uma realidade sciopoltica
internacional: apesar de seus milhes de falantes, o Portugus nunca foi um meio de
comunicao privilegiado e s agora, aps a entrada de Portugal na Comunidade Econmica
Europia (CEE), que o idioma comea a possuir uma importncia para os negcios




41


globalizados. Desses fatos, conclui-se que h uma razo coerente para que palavras do ingls
estejam disseminadas no Pas, principalmente em relao s lnguas de especialidade.
Com o desenvolvimento dos trabalhos terminolgicos, a partir de meados da dcada
de 80, esse quadro comeou a mudar. Inicialmente como uma preocupao das universidades,
os trabalhos terminolgicos chegaram s organizaes, onde a comunicao tratada como
prioritria e estratgica. Nesse mbito empresarial, a terminologia tem sido praticada, com
finalidade normativa, entre os membros das Comisses de Terminologia criadas pela
Associao Brasileira de Normas Tcnicas (ABNT), subsidiria no Brasil da International
Organization for Standardization (ISO) com sede em Genebra, na Sua. Esse trabalho tem
auxiliado os empresrios a adequarem suas terminologias s normas cientficas internacionais,
o que facilita a exportao de seus produtos.
Diferente da comunicao feita por jornalistas especializados, que banalizam a
linguagem para melhor atender ao grande pblico, a comunicao cientfica pura, segundo
Ribeiro, carrega uma assimetria no processo interativo entre o cientista e a sociedade. A
linguagem tcnico-cientfica complexa, especializada e composta por termos especficos que
buscam a preciso conceptual de forma a no apresentar dupla interpretao.
26

Nas lnguas de especialidade, o universo terminolgico constitui um sistema aberto e
em estado permanente de evoluo, apesar da impresso de estabilidade terminolgica. Ainda
segundo Ribeiro, h, portanto, um movimento com inovaes terminolgicas que decorrem
da necessidade de nomear novas unidades referenciais correspondentes a novos recortes
conceptuais e propicia a renovao do acervo lexical disponvel ao falante.
27

O surgimento de um novo conceito leva a uma nova denominao. Nesse sentido, so
levantadas aqui as seguintes questes que sero respondidas nesta pesquisa:




42


1. Ser que isso ocorreu com a terminologia da gesto pela qualidade total em
servios, ou seja, surgiram novos conceitos que levaram a novas
denominaes?
2. A lngua portuguesa conseguiu adaptar essas unidades de conhecimento
especializado oriundas de traduo, uma vez que o provvel surgimento se deu
em pases de lngua inglesa e japonesa?
3. Como teriam ocorrido essas adaptaes ou quais processos formadores foram
utilizados para que a terminologia pudesse ser considerada de lngua
materna?
Essas respostas s sero dadas ao trmino desta pesquisa, mas antes haver uma
contextualizao desse objeto de pesquisa, pois, como j foi dito, ele no se encontra inserido
na rea de Letras, mas sim na rea de Administrao de Empresas, e necessrio esclarecer
alguns pontos sobre essa rea de especialidade.


I.3. Histria e contextualizao da gesto pela qualidade total em manufatura
A histria da gesto pela qualidade total em manufatura ser apresentada
inicialmente e individualmente, pois ela se confunde com a histria de um americano
tenaz e forte. Seu nome William Edwards Deming, que teve a idade deste sculo,
enquanto viveu, embora outros tericos tenham contribudo em muito para o
desenvolvimento dessa Filosofia Administrativa aplicada s organizaes. Isso se faz
necessrio porque uma das hipteses desta Tese caracterizar a GQT em manufatura
com especificidades inerentes em relao GQT em servios, como tambm servir de

26
RIBEIRO, Rosa M. A. Terminometro, 1988, p. 52.




43


apoio para que o leitor se situe nessa rea de especialidade. Mas, para a caracterizao
da primeira, necessrio relatar a histria desse especialista.
Ele nasceu em 14 de outubro de 1900, em uma propriedade de Sioux City no
Estado de Iowa, EUA. Seu pai era formado em Direito e sua me estudou Msica.
Recebeu o nome de ambos, pois o pai chamava-se William Albert Deming e a me
Pluma Irene Edwards.
Logo aps o nascimento de W. E. Deming, o pai mudou-se para Cody, no
Estado de Wyoming, onde montou uma organizao com um advogado. Nessa poca, o
casal tinha dois filhos, William e Robert, sendo o ltimo um ano mais novo do que o
primeiro.
Em 1906, a famlia mudou-se para perto de Powell, no Estado de Wyoming.
Essa cidade havia sido escolhida para um projeto de recuperao e estava aberta a
colonos. Nela estava sendo construda uma represa de 100 metros de altura ao lado do
Rio Shoshone. Essa represa era considerada a mais alta do mundo, na poca, e o pai
requereu a concesso de uma propriedade de 40 acres na extremidade da cidade.
A famlia era detentora de poucas posses. Com o crescimento da cidade, o pai
abriu uma outra organizao que vendia aplices de seguro, imveis e prestava
servios jurdicos. Mesmo assim, W. E. Deming trabalhava duro no hotel da cidade
acendendo os cinco lampies de gasolina da rua com um salrio de dez dlares por
ms.
Em 1909, nasce uma filha do casal que recebe o nome de Elizabeth. Com o
tempo, os negcios do pai comearam a prosperar e eles foram atingindo um nvel
socioeconmico mais satisfatrio.

27
RIBEIRO, Rosa M. A. Op. Cit., p. 52.




44


O jovem Deming dessa poca, chamado de Edwards para se distinguir do pai,
era uma criana bem comportada e estudiosa, apelidada de professor por sua
diligncia. Suas paixes eram acampar e pescar.
Em 1917, W. E. Deming foi at Laramie para iniciar seus estudos superiores na
Universidade de Wyoming, chegando com vrios dias de antecedncia para encontrar
um emprego. Depois de formado, em 1921, prosseguiu seus estudos de Matemtica e
ensinou Engenharia. Tambm ensinou Fsica no ano seguinte no Colorado School of
Mines onde, depois, matriculou-se em um curso de Mestrado em Matemtica e Fsica
na Universidade do Colorado e se casou com uma jovem professora chamada Agnes
Belle, em 1923, e adotaram uma filha, Dorothy.
Em 1924, um professor animou-o a continuar seus estudos em Yale, onde fez
seu Ph. D. em Fsica. Nessa poca, trabalhava com transmissores nas antigas
instalaes da Western Eletric em Chicago, local onde um pesquisador de Harvard
havia feito suas experincias sobre a relao entre condies de trabalho e
produtividade. Essa experincia influenciou-o na formulao de suas idias, pois ali os
operrios recebiam por pea produzida e eram descontados se a pea fosse rejeitada na
inspeo.
Em 1927, o Dr. Deming rejeitou propostas de emprego feitas pela indstria
privada, inclusive uma da Bell Laboratories, para trabalhar com o Ministrio da
Agricultura dos Estados Unidos, no laboratrio permanente de nitrognio, onde um
trabalho pioneiro havia sido feito durante a I Guerra Mundial. Estava fascinado diante
da oportunidade de estudar o nitrognio e analisar seu efeito sobre as colheitas.
Aps sete anos de seu primeiro casamento, em 1930, sua esposa Agnes Deming
faleceu. Casa-se, dois anos depois, com Lola Shupe, uma matemtica que veio




45


trabalhar com ele no Ministrio da Agricultura. Juntos, foram autores de diversos
artigos sobre as propriedades fsicas dos gases. Sua segunda filha, Diana, nasceu em
1934 e a terceira, Linda, em 1942.
Enquanto estava no Ministrio da Agricultura, o Dr. Deming foi apresentado a
Walter A. Shewhart por um colega. Shewhart,

...um estatstico do Bell Laboratories em Nova York, era um estudioso
de fala mansa, porm profunda, que tinha desenvolvido tcnicas para
introduzir o que chamava de controle estatstico nos processos
industriais. Tinha definido os limites da variao aleatria para
qualquer aspecto do trabalho de um operrio, estabelecendo pontos
altos e baixos aceitveis, de modo que quaisquer pontos fora daqueles
limites pudessem ser detectados e suas causas estudadas. Os operrios
poderiam ser treinados para eles mesmos prepararem esses grficos, o
que lhes permitiria um maior controle sobre seu trabalho e ajustes por
conta prpria.
28


A genialidade desse controle estatstico estava em reconhecer quando se deveria
agir e quando no se deveria interferir em um processo. Essas teorias de Shewhart se
tornariam a base do trabalho de Deming.
Ainda nessa poca e em outra rea do governo, o servio do censo, estava sendo
travado um debate sobre as novas tcnicas estatsticas de amostragem que estavam


28
Cf. WALTON, Mary. O mtodo Deming de administrao, 1989, p. 2.




46


sendo aplicadas nas reparties federais. O Dr. Deming j era ento reconhecido como
um especialista da rea, pois havia estudado com Ronald Fisher, um famoso professor
ingls, e tinha procurado outros estudiosos para fazer conferncias para ele e seus
colegas.
O censo de 1940 aproximava-se. No anterior, todas as pessoas tinham entrado
na contagem-processo. Mas a idia da amostragem era extraordinariamente
controvertida. Os conservadores do servio do censo no confiavam nela, mas outros
faziam presso por uma quantidade de informaes maior do que a que poderia ser
obtida com levantamentos de 100% do universo.
29
Os inovadores venceram o debate e
o Dr. Deming foi convidado para ser o encarregado do novo programa de amostragem.
Ele aceitou o convite imediatamente.

No desempenho de sua funo, criou tcnicas de amostragem que
foram aplicadas pela primeira vez no censo de 1940. margem, e
aplicando o que tinha aprendido com Shewhart, o Dr. Deming tambm
conseguiu demonstrar que se poderiam aplicar controles estatsticos
tanto no trabalho de escritrio quanto no de fbrica. Poder-se-ia
mostrar, por exemplo, que o ndice de erro dos perfuradores de cartes
baixava significativamente com treinamento e especializao,
tornando-se necessrio inspecionar apenas um tero do seu trabalho.
30


Essa histria, apesar de parecer um pouco longa, interessante. Em 1942,
durante a II Guerra Mundial, um professor da Universidade de Stanford de nome W.

29
Cf. WALTON, Mary. Op. Cit., p. 7.
30
Cf. WALTON, Mary. Op. Cit., p. 7.




47


Allen Wallis, que mais tarde seria Subsecretrio de Estado, procurou os servios de
Deming incentivando-o a contribuir de alguma forma para o esforo de guerra. Sua
resposta veio em forma de uma proposta de quatro pginas para ensinar os mtodos de
Controle Estatstico da Qualidade (CEQ) de Shewhart a engenheiros, inspetores e
outros profissionais que trabalhassem em organizaes dedicadas produo voltada
para a guerra. A proposta foi aceita e o Dr. Deming e outros colaboradores deram
cursos para 31.000 (trinta e um mil) participantes. O sucesso foi tanto que a nfase em
escala nacional na qualidade levou formao da Sociedade Americana de Controle da
Qualidade em 1946, que o condecorou com a Medalha Shewhart.
Ainda nesse ano de 1946, Deming saiu do servio do censo para trabalhar por
conta prpria como consultor estatstico. Entrou para o corpo docente da Universidade
de Nova Iorque, como professor da Escola de Administrao de Empresas, onde
ensinou amostragem e controle de qualidade.
Terminada a guerra, os servios do Dr. Deming comearam a ser solicitados no
exterior. Em 1946, foi duas vezes Grcia como observador das eleies gregas, em
nome do Departamento de Estado. Em 1947, visitou a ndia e foi at o Japo, onde foi
convidado a fazer parte de uma misso estatstica para planejar o censo japons de
1951.
Nos Estados Unidos, a indstria voltou aos tempos de paz, produzindo bens de
consumo para os quais havia uma procura sem paralelo e nenhuma concorrncia. No-
afetadas pela guerra, as indstrias produziam de tudo para as reas de expanso urbana
do ps-guerra.





48


A empresa americana tinha cumprido a promessa da administrao
cientfica, feita por um influente engenheiro industrial chamado
Frederick Winslow Taylor h mais de 30 anos. Taylor tinha sustentado
que o desempenho humano poderia ser definido e controlado por
padres e regras de trabalho. Defendia o uso de estudos de tempos e
movimentos para dividir as tarefas em etapas simples e separadas a
serem executadas repetidas vezes e sem desvios por empregados
diferentes. A minimizao da complexidade maximizaria a eficincia,
embora o trabalho acima das metas fosse to mau quanto o abaixo das
metas numa linha de montagem de Taylor.
31


Essa administrao cientfica propagada por Taylor e seus seguidores evoluiu
em uma poca de imigrao em massa onde os operrios, sem qualificao e instruo,
conseguiam seus empregos porque o que interessava era a quantidade. Tambm essa
teoria evoluiu em uma poca de conflitos trabalhistas e Taylor acreditava que seu
sistema reduziria o conflito e eliminaria o uso arbitrrio do poder, porque tanto
operrios quanto supervisores ficariam com uma faixa discricionria muito pequena.
32

Fazia parte ainda dessa corrente a crena de que a administrao era uma cincia que
podia ser estudada e aplicada. Da a evoluo da estrutura empresarial americana,
presa a regras e com uma cpula pesada, com seu quadro de administradores
profissionais. Esse sistema produzia grandes quantidades, mas era embaraoso e
rgido, alm de ajustar-se lentamente s condies do mercado.

31
Cf. WALTON, Mary. Op. Cit., p. 8.
32
Cf. WALTON, Mary. Op. Cit., p. 9.




49


Nesse contexto quantitativo, a produo numrica vinha antes da qualidade. Se
houvesse defeitos e retrabalho, seriam detectados no fim da linha de produo com a
inspeo, mas ainda assim haveria lucros para cobri-los. Desse modo, as tcnicas
ensinadas pelo Dr. Deming s indstrias ligadas defesa nacional eram agora, via de
regra, consideradas demoradas e desnecessrias e caram em desuso.
Estas tcnicas devem ser consideradas como posteriores aos primrdios do
controle da qualidade que surge, portanto, da produo em massa de diferentes
componentes de um produto e de sua montagem em linha, ou seja, da necessidade de
se fabricar peas padronizadas e intercambiveis.
Segundo James Teboul,
33
isso se diferencia enormemente do tipo de produo
artesanal, caracterstica da Idade Mdia, onde o arteso ou o aprendiz fabricava um
objeto, um mvel, por exemplo, para um cliente especfico, e ajustava as peas umas
nas outras, sem se preocupar muito com a padronizao. O cliente, que julgava a
qualidade final e, eventualmente, podia intervir, estava em contato prximo com o
arteso.
Por outro lado, a revoluo industrial e a produo em massa levaram a
indstria a uma lgica monodimensional de diviso de trabalho e de produtividade.
Produzir mais, utilizando um nmero menor de pessoas. O taylorismo e a organizao
cientfica do trabalho, como mostrado, afastavam as organizaes do mercado. Os
produtos se padronizaram para serem fabricados em grande quantidade e o controle da
qualidade nasce da preocupao necessria e fundamental de assegurar a possibilidade
de intercmbio das peas produzidas em grandes lotes.

33
Cf. TEBOUL, J. Op. Cit., p. 13-20.




50


Esta corrida inexorvel em direo reduo de custos por economia de escala
provoca a separao entre operrios e funcionrios responsveis pela execuo e os
engenheiros projetistas, de mtodo e planejamento. Simples executores, julgados pela
quantidade e pelo rendimento, como os operrios poderiam ser responsveis pelo
controle da qualidade do que produziam? No incio, o contra-mestre que toma a si tal
responsabilidade, mas, no conflito entre a produtividade e a qualidade, ele se torna
simultaneamente juiz e ru. Da o surgimento do controle da qualidade que incluir
instrumentos, aparelhos de medio e mtodos cada vez mais sofisticados, aumentando
progressivamente suas responsabilidades.
A partir da dcada de 30 do sculo XX, os mtodos estatsticos de amostragem
comearam a se desenvolver para enfrentar quantidades cada vez maiores. Nos
laboratrios da companhia Bell Telephone, Shewart cria os mtodos de controle do
processo de produo, aqueles ensinados a Deming, por meio de cartas de controle da
mdia e da amplitude. Dodge e Roming criam os mtodos de controle de recepo,
com base na qualidade mdia fornecida: quando os lotes recebidos so inspecionados
por amostragem, os que so recusados so separados para que se retirem os elementos
defeituosos.
Mais uma vez, a guerra exercer a funo de acelerador da histria! O controle
estatstico no recebimento ou na inspeo final se desenvolve de maneira decisiva sob
o impulso do exrcito americano durante os esforos de guerra da dcada de 40.
Procedimentos denominados military standard formalizam um mtodo que ser
difundido lentamente ao restante da indstria e tambm na Europa. Os military
standard baseiam-se no AQL, de Average Quality Limit (limite mdio de qualidade),
que foi traduzido no Brasil como Nvel de Qualidade Aceitvel (NQA): trata-se da




51


porcentangem mxima de elementos defeituosos que pode ser considerada satisfatria,
como caracterstica mdia da qualidade apresentada. Entra-se assim na civilizao do
1% de defeito, pois o mtodo no permite ir alm de 1%.
O desenvolvimento e a sofisticao dos materiais eletrnicos utilizados pelo
exrcito e, logo em seguida, tambm pela agncia espacial nos anos 50 do sculo XX
criaram um problema extra. Os custos de operao e de manuteno so bem
superiores ao custo de compra, e o tempo de bom funcionamento de alguns radares s
vezes ridicularmente curto, no ultrapassando algumas horas. Foi assim que nasceu,
no final dos anos 50, uma nova disciplina: a confiabilidade, que estuda a probabilidade
que um dispositivo cumpra uma funo pr-especfica sob certas condies de
utilizao, durante um perodo de tempo determinado.
Observa-se com isso que o chefe de departamento passa a ter mais
responsabilidades, chegando s vezes ao mbito da produo e participando do comit
de direo. Mas, na realidade, a qualidade no suscita muito interesse dentro da
organizao, onde continua a ser vista como um mal necessrio, uma taxa parasita,
cujos custos todos tentam diminuir.
O nvel de qualidade final fica em torno de 1% nesta poca aps a inspeo,
apesar de os nveis anteriores a ela parecerem catastrficos hoje em dia, situando-se
entre 15% e 30% de defeitos nos processos internos de fabricao. O filtro da inspeo
no permite ultrapassar esse nvel de 1%, levando-se em conta tanto os limites dos
mtodos estatsticos de amostragem empregados quanto o compromisso entre o custo
de inspeo, rapidamente proibitivo, de se pretender ser abrangente e individual, e o
custo de defeitos aceito pelo cliente.




52


Este compromisso impedir o abandono desta viso ocidental, esta cultura do
1%, instituda ento pela gesto da no-qualidade.
Evidentemente, quando o defeito grave, deve-se recorrer a mtodos de
inspeo de 100%. Mas, uma inspeo individual sem ser automatizada no 100%
segura e pode exigir um segundo controle.
necessrio observar que este nvel de 1% ainda suportvel, pois ele
corresponde norma do conjunto de indstrias e de seus concorrentes. adotada,
ento, uma atitude defensiva, alinhada concorrncia, que a UCE garantia da
qualidade ilustra perfeitamente bem. No entanto, esta prudncia durar pouco e logo
aparecero outras determinaes mais ofensivas.
Foi o que ocorreu durante a dcada de 60 do sculo XX, quando surgiu uma
mudana de atitude a partir da tomada de conscincia dos custos cada vez mais
elevados do departamento de controle da qualidade que se fortalecia de maneira
espetacular para tentar assumir e assegurar um nvel suficiente de proteo nas
indstrias mais sensveis, como a aeronutica, a espacial e a nuclear. Em 1965,
Feigenbaum publica uma primeira resposta em seu livro Total Quality Control
Controle da Qualidade total
Para sair do dilema precedente, o custo do defeito contra o custo de inspeo,
necessrio introduzir uma terceira UCE: a preveno. A qualidade deve ser construda
e fabricada desde o incio, pois a inspeo sempre aparece tarde demais e se resume
apenas, na maioria dos casos, a um atestado de bito. melhor prevenir do que
remediar. J. M. Juran, outro importante terico da qualidade, havia tido uma inspirao
semelhante quando criou a espiral da qualidade, na qual todos os departamentos




53


participam da qualidade final, sem falar de Deming, ardente defensor do controle
estatstico em cada um dos processos de produo.
O departamento de qualidade o primeiro a responder a esta misso de
preveno, coordenando a garantia da qualidade em cada uma das etapas. O
departamento passa a se chamar garantia da qualidade e estabelece mtodos, sistemas,
procedimentos s vezes pesados e caros para englobar toda a empresa.
Mesmo no sendo isenta de imperfeies, esta nova disposio apresenta um
progresso inegvel: a garantia da qualidade tenta intervir em conjunto com os
diferentes processos de concepo e produo. A preveno passa a assumir o lugar da
inspeo.
O departamento de garantia da qualidade tem uma funo essencial de
coordenao e de fechamento, porm esta funo continua ambgua, pois ele continua
a ser um ouvinte. Se o departamento ultrapassar sua funo e se o antagonismo
persistir entre os que fabricam e os que controlam, chega-se a um impasse. A mudana
decisiva s poder ocorrer quando a administrao tomar conscincia de sua
responsabilidade em relao qualidade, responsabilidade esta que lhe pertence de
fato e no pode ser delegada a outro setor, por mais especializado que ele seja! Da
mesma forma que s se ganha uma guerra com os civis (e nunca contra ou sem eles), a
qualidade uma funo que no pode ser delegada. A qualidade importante demais
para ser confiada apenas aos especialistas!
E como convencer a administrao desta responsabilidade? Enfatizando o
ncleo do combate, falando em termos financeiros (Juran) e no em termos de coisas e
tcnicas. Em outras palavras, mostrando a ela que um nvel melhor de qualidade reduz
os custos, aumenta a produtividade e traz vantagens em termos competitivos.




54


Na dcada de 50 do sculo XX, Deming, o campeo dos mtodos estatsticos de
controle de processos (statistical process control, CEP em portugus do Brasil), recusa
a inspeo em massa e insiste sobre a responsabilidade dos prprios produtores em
obter a qualidade dos produtos fabricados. necessrio eliminar a nvoa que envolve e
esconde o processo. Deve-se tornar a administrao responsvel, a longo prazo, pelo
controle e pelo aperfeioamento dos processos que esto sob sua responsabilidade.
Trinta anos depois, sua mensagem fica ainda mais direta: "A causa principal da doena
da indstria americana e do desemprego que dela resulta reside, essencialmente, na m
gesto dos nossos capites da indstria".
34

Juran, muito cedo tambm, reconheceu o papel primordial da administrao
para criar um aperfeioamento constante da qualidade. O aperfeioamento feito
projeto a projeto, graas a um mtodo experimental sistemtico que vai dos sintomas
s causas, das causas s solues e, depois, das solues a uma nova prtica e
conservao do que foi aprendido. Cada diretor, cada responsvel, deve se
responsabilizar em levar adiante os projetos de aperfeioamentos e integr-los em um
plano global para obter a adequao dos produtos s necessidades dos clientes. No
incio, o custo da no-qualidade serviu de guia escolha dos projetos. Agora, pode-se
comear por atacar os pontos mais importantes da mina da no-qualidade, segundo o
princpio de Pareto que Juran tornou popular: comear por resolver os problemas mais
essenciais.
Mas, no Ocidente, as coisas evoluem lentamente, e as mensagens de Deming ou
de Juran camearam a ser ouvidas apenas nos anos 70-80 do sculo XX. E claro que
a sua aura e o seu pblico aumentaram medida que ficou claro o sucesso japons.

34
DEMING, W. E. Qualidade: a revoluo da administrao, 1990, p. 17.




55


Voltando aos primrdios dessa histria, ela se encontra na dcada de 60, nesta
cultura de 1% de defeito mantida pela prpria limitao dos mtodos e pelos custos da
amostragem. Mas, a organizao Martin, fabricante dos msseis Pershing, no aceita
esta fatalidade. Graas a uma conscientizao e a uma mudana de atitude por parte da
direo, aliada a um esforo de equipe de todos os colaboradores, ela consegue
fabricar, a partir de 1961, um mssel operacional e sem defeitos, de primeira! a
aurora do movimento Zero Defeito, que vai basear-se em uma mudana radical de
atitude e em uma mobilizao dos colaboradores em direo ao nico padro aceitvel:
o ZD, ou seja, Zero Defeito.
Na Martin, trabalha um certo Philip Crosby, que se sente muito inspirado com
esta experincia, a ponto de estabelecer sua abordagem da qualidade sobre o zero
defeito relacionado s exigncias do cliente. Para acertar de primeira, necessrio
organizar a preveno e mudar de atitude. Isto significa acrescentar ao primeiro
compromisso (o custo de deteco versus o custo de defeito) uma terceira UCE, at
ento ignorada: o custo de preveno.
Entre um defeito evitado eliminando-se um mau componente no momento da
fabricao e um defeito evitado na inpeo final ou quando o produto j se encontra
nas mos do cliente, a relao pode ir de um a mil. Entre um erro evitado ao se redigir
um documento ou no momento da criao de um programa, e um erro in loco no
momento de sua utilizao, a relao pode ser ainda maior. O investimento na
preveno , portanto, muito rentvel. uma demonstrao simples e clara de que a
qualidade sai de graa.
Dessa forma, ao se lanar o seguinte desafio ao presidente de uma organizao:
o seu custo de obteno da qualidade representa 20% do seu volume de negcios e ele




56


pode ser dividido por dois em cinco anos, qualquer consultor da qualidade tem certeza
de obter a ateno de seu ouvinte e tambm de obter... uma ordem de servio. O ponto
principal desse mtodo consiste em formar todos os colaboradores na questo da
qualidade, porque ela da responsabilidade da administrao e todos esto
interessados nela. Dado o impulso, os olhos fixos no zero defeito, cada pessoa dever
encontrar os instrumentos e meios para atingir o objetivo.
Apesar da extenso desse item do captulo, pode-se observar que o esforo e a
moblizao at aqui so internos, voltados para a produo e a medio de defeitos e
erros. Em relao ao exterior e aos clientes, a atitude continua defensiva, protetora.
Trata-se de minimizar os problemas, diminuir os menos e fazer uma espcie de seguro.
Trata-se de fazer bem feito aquilo que foi proposto, obtendo como prmio a vantagem
da reduo dos custos e o aumento da produtividade. Garante-se ao cliente o
cumprimento dessa promessa graas qualidade assegurada e reduo progressiva e
permanente dos seus problemas, suas reclamaes, daquilo de que ele no gosta,
daquilo sobre o que ele reclama.
Mas, seria possvel planejar melhor e visar satisfao do cliente? A qualidade
tambm o que faz vender, aquilo que o cliente deseja, aquilo que faz a diferena.
Esta lgica de diferenciao traz dentro de si uma exigncia de mobilidade, de
evoluo. As conquistas so feitas para serem ultrapassadas. Primeiro controlada, em
seguida assegurada, a qualidade dever ser inserida dentro de uma autntica dinmica
ofensiva.
O terceiro estgio de desenvolvimento da qualidade se inscreve dentro da
trajetria precedente, incluindo a responsabilidade de cada um e o progresso
permanente em direo realizao do produto sem defeito, porm acrescentando uma




57


atitude externa no mais defensiva e sim ofensiva. A qualidade no deve mais ser vista
negativamente (como custosa, inesperada ou ausente) pelo cliente, ao contrrio, ela
deve ser considerada como legtima, esperada, desejada. A qualidade deve ser vista e
pensada de forma positiva. Na verdade, o que o cliente procura no produto, o que ele
encontra e o que o faz diferenciar aquele produto de todos os outros no deve ser mais
sobrecarregado com preocupaes sobre defeitos ou erros. A qualidade torna-se uma
arma estratgica que pode vencer a concorrncia. A qualidade torna-se mais do que a
simples satisfao do cliente, UCE esta um pouco neutra, incolor e tcnica, a
qualidade dever, por fim, seduzir e encantar o cliente.
Portanto, necessrio partir do cliente, daquilo que ele gosta, e transmitir
horizontalmente a voz do cliente dentro da organizao. A qualidade construda
horizontalmente e deve ser inscrita na estratgia da organizao. a qualidade que vai
procurar participaes no mercado, a fidelidade do cliente, vantagens e protees a
longo prazo, na condio, claro, de manter sua dinmica.
Mas, as necessidades do cliente flutuam, sobretudo sob a influncia da
concorrncia. preciso fazer com que os objetivos da qualidade evoluam e alinhar
rapidamente o resto da organizao a esses objetivos. Este o discurso dos anos 80 do
sculo passado, sobretudo no que segue os argumentos de Taguchi em relao ao
desenvolvimento das funes da qualidade.
Dando prosseguimento a essa histria e contextualizao da gesto pela
qualidade total em manufatura, faz-se necessrio narrar os acontecimentos ocorridos
no Japo a partir da chegada de Deming a esse pas, bero da aplicao inicial dessa
Filosofia Administrativa em larga escala.




58


Ela comea, segundo relato de Kaoru Ishikawa ou Masaaki Imai, reproduzida
em James Teboul,
35
no perodo de 1946-1950, anos de tentativas de redirecionamento
da indstria de guerra japonesa para a exportao de produtos manufaturados. Tal
estratgia de exportao de fato essencial para esse pas que no possui recursos
naturais ou energticos e que importa a maior parte dos alimentos destinados sua
populao. Mesmo se a qualidade dos produtos manufaturados naquela poca era
medocre, inferior a dos produtos fabriados no Ocidente, o Japo hoje navega nas
mesmas correntes tecnolgicas e dispe de uma mo-de-obra abundante, educada e
barata.
O JUSE (Japanese Union of Science and Engineers Sindicato Japons de
Cincia e Engenharia), sociedade que rene engenheiros e cientistas japoneses, foi
criado em 1947 para participar da reconstruo do Japo. Em 1950, o JUSE convidou
um especialista em qualidade formado na escola do controle estatstico de processos, o
Dr.Deming, que organizou, a partir de 1950, uma srie de seminrios sobre o que se
chamaria de controle estatstico de processos (SPC Statistical Process Control).
Cada um responsvel pelo aperfeioamento de seu processo de produo segundo o
ciclo ou a roda de Deming, o PDCA (Plan, Do, Check, Act Planejar, Fazer,
Verificar, Agir). Ele insiste desde o incio sobre a prioridade a ser dada qualidade,
isto , satisfao do cliente. Em 1951, foi criado o prmio Deming para recompensar
as organizaes mais bem estruturadas no campo da qualidade. Deming tornou-se uma
personagem lendria no Japo, onde o ano de 1950 considerado o ano zero da
qualidade.

35
Cf. TEBOUL, J. Op. Cit., p. 20-24.




59


Apenas como ilustrao, Deming, que nos Estados Unidos s interessava aos
chefes de departamentos de controle da qualidade, e por isso continuava a ser
relativamente ignorado em seu prprio pas, viria a ter como pblico, no Japo,
durante os seus seminrios, os presidentes das organizaes e os membros do primeiro
escalo do Ministrio da Indstria.
Como explica o prprio Deming:

O Sr. Ichiro Ishikawa, presidente do Kei-Dan-Ren (uma associao de
executivos japoneses) e do JUSE, compreendeu a importncia de
chamar a ateno e convencer os dirigentes das empresas. Ele enviou
telegramas e todos vieram. Fiz vrias conferncias no vero de 1950, e
em vrias outras viagens realizadas no ano de 1951 e subseqentes.
Durante essas conferncias, eu explicava a importncia da
responsabilidade e do compromisso permanentes da direo para
melhorar o sistema em todos os estgios da produo, desde o
momento da compra at os estudos de mercado... O esforo de
aperfeioamento deve ser total, pois ele diz respeito a cada uma das
atividades em nvel de empresa, em nvel da nao...
36


No incio, trata-se sem dvida de estatstica, mas de estatstica de controle de
processos e no de mtodos de amostragem do tipo military standard. Desde o incio, a



36
DEMING, W. E. apud TEBOUL, J. Op. Cit., p. 21. (Grifos nossos entre parnteses.)




60


tica do cliente levada em considerao e o cliente no gosta de arriscar, mesmo em
nome da estatstica. Quando ele compra 100 peas, quer que todas estejam perfeitas.
Rapidamente, o objetivo zero defeito se impe, mesmo se o caminho longo e se, no
incio, for necessrio pagar um alto preo pela inspeo final, antes de se conseguir
dominar o processo.
Em 1954, Juran vai ao Japo convidado pelo JUSE. Ele coloca a qualidade
como um instrumento essencial da administrao. A qualidade se constri e progride
em espiral com a participao de todos os departamentos, desde a criao at o servio
de venda de sobressalentes. Trata-se, portanto, de formar todos os executivos da
organizao dentro dos conceitos e mtodos do aperfeioamento da qualidade.
J que, desde o incio, patres e executivos so responsveis, o departamento de
controle da qualidade jamais assumiu no Japo a importncia que teve nos pases do
Ocidente. Na verdade, o departamento de garantia da qualidade existe, mas um
departamento discreto, com poucos colaboradores, pois a qualidade colocada como
responsabilidade de cada colaborador, desde o da linha de produo no cho de fbrica
at o diretor presidente.
At o incio dos anos 60 do sculo XX, as organizaes de exportao
formavam seus executivos para ter como objetivo a qualidade e, como efeito domin,
tambm os fornecedores. Em novembro de 1960, criado o ms nacional da qualidade.
Nos anos seguintes, a formao desce em direo gerncia e aos
colaboradores ou operrios. Em abril de 1962, o JUSE lana a revista Oficina e
Controle da Qualidade Quality Control for the Foreman, editada pelo Dr. Kaoru
Ishiwaka. E, naquele ano, os primeiros ciclos da qualidade tornam-se operacionais. A
formao dos operadores deve-se basear sobre a prtica, um trabalho de equipe sobre




61


um problema local no mbito da oficina, um crculo da qualidade. A organizao deve
poder acolher todas as iniciativas, at as provenientes dos confins da oficina ou da
seo.
Dessa forma, a qualidade assume rapidamente uma dimenso importante de
administrao, tanto dentro da organizao colaborao de todos, liderana, cultura
aberta de progresso , quanto fora dela uma arma poderosa de conquista dos
mercados externos. Melhor ainda, ela obtm um avano de alguns anos, difcil de ser
igualado, pois menos do que um progresso tecnolgico, trata-se de uma nova atitude
por parte da administrao e uma profunda mudana da cultura organizacional, de
atitudes, portanto mudanas difceis de serem adotadas.
No caso das organizaes de exportao, a qualidade no ser um problema, um
mal a ser corrigido, mas uma resposta, uma soluo e, obviamente, uma arma contra a
concorrncia.
O JUSE tem um papel muito importante na difuso desses mtodos, sob a
iniciativa do seu chefe, Kaoru Ishikawa.
Nos anos 60 e 70 do sculo passado, a formao macia baseia-se na estatstica,
nos mtodos de soluo de problemas e no controle dos processos. Nos anos 70 e 80, a
qualidade passa do processo de produo ao projeto. no momento da criao de um
novo produto que se deve pensar em sua qualidade final. Deve-se dedicar mais tempo
aos prottipos, pensar nos problemas que possam vir a surgir, testar, testar novamente,
facilitar e simplificar o trabalho do fabricante.
Taguchi, um grande terico e divulgador da filosofia Deming, ao desenvolver
mtodos simples de experimentao por planos de experincia, os populariza nos
escritrios de consultoria. S falta reconectar as necessidades do cliente s




62


especificaes, por meio de instrumentos do tipo demonstrao das funes da
qualidade ou os mtodos de otimizao de desempenhos e tolerncias de Taguchi.
Esta rpida passagem pela histria permite constatar que a responsabilidade da
administrao e a importncia estratgica da qualidade impem-se rapidamente no
Japo, levando a uma dinmica da qualidade mais rpida do que aconteceu nos pases
do Ocidente.
Foram necessrios 25 anos de esforos constantes para que o Japo alcanasse o
Ocidente. Da mesma forma, sero necessrios vrios anos para que as organizaes
que desejam atingir um nvel de qualidade total possam ver seus esforos darem
resultados. A vantagem competitiva obtida pela qualidade uma vantagem que se
consolida e se amplifica por meio de sua prpria dinmica.
Muitas organizaes em concorrncia direta com os produtos japoneses
precisam fazer um vigoroso esforo de retomada, para no desaparecerem. As que
tiverem sucesso so a prova de que a gesto pela qualidade total um mtodo
universal e um modelo que pode ser adotado em qualquer lugar do mundo.
O Japo, ento, transformou-se. Essa transformao deveu-se, em parte, ao Dr.
Deming e sua Filosofia da Qualidade. Estranhamente, porm, de volta aos EUA,
nenhum de seus feitos causou grande impacto naquela poca. Em seu pas, ele era
reconhecido menos pelo seu trabalho no Japo do que como estatstico renomado.
Mas isso mudou em 1980. Aps 30 anos de ele ter ensinado pela primeira vez
seus mtodos aos japoneses, o Dr. Deming foi redescoberto nos EUA. Quem o
redescobriu foi uma produtora de programa de televiso chamada Clare Crawford-
Mason, uma reprter experiente que havia ajudado no lanamento da revista People.
Em 1979, estava produzindo um documentrio para a NBC intitulado Que foi que




63


aconteceu com a velha engenhosidade ianque? O tema era sobre a posio
subitamente precria em que se encontrava a indstria americana diante da ameaa
econmica do Japo. Depois de ouvir vrios economistas que no tinham uma histria
para contar, ouviu falar, de um professor da American University, de que havia um
"cara" chamado Deming, morador da American University Park, que havia trabalhado
e muito no Japo.
O Dr. Deming foi solcito e contou-lhe sua experincia no Japo. Aps
certificar-se de que a Filosofia Deming estava sendo aplicada nos EUA, na Nashua
Corporation, em Nashua, Estado de New Hampshire, Crawford-Mason acabou
produzindo um dos documentrios de maior xito da histria da televiso. Se o Japo
pode... por que no podemos? foi ao ar s 21h30min do dia 24 de junho de 1980, e o
Dr. Deming passou a ter uma agenda superlotada, tendo de habituar-se a estar em
vrios Estados americanos e em outros pases sempre que solicitado por seus clientes.
Apesar dos compromissos assumidos com vrias organizaes americanas, o Dr.
Deming, nessa poca, ainda encontrava tempo para ministrar, junto com sua equipe, o
chamado Seminrio Os quatro dias de Deming. Esse seminrio era dado a executivos
de vrias organizaes conceituadas e era sempre organizado por uma associao
local. As grandes e pequenas organizaes enviavam seus executivos, pois estavam
precisando de respostas. Esses quatro dias podiam ser resumidos assim: no primeiro, o
Dr. Deming apresentava a filosofia que revolucionou o Japo. O mago dessa filosofia
est consubstanciado em seus Quatorze Pontos e nas Sete Doenas Mortais. Na tarde
do segundo dia, ele fazia uma experincia com contas, que ilustra que os colaboradores
no tm como mudar o sistema no qual trabalham. Grande parte do terceiro e do quarto




64


dias se destinava a exemplos de como podem ser aplicados mtodos estatsticos como
base para se agir ou no, conforme o caso.
Esse sistema aludido pelo Dr. Deming no primeiro dia consubstancia-se na base
de sua Filosofia Administrativa. Seria incompatvel com o objetivo do captulo, apesar
de sua extenso, se o mesmo no fosse aqui registrado. Aps esse registro, e para
encerrar esse terceiro item do Captulo I, sero apresentados dois exemplos da
aplicabilidade desse sistema. Pela ordem, o que ocorreu com o produto televiso e com
o produto motocicleta depois que o Japo comeou a produzi-los em escala planetria.
Agora, a Filosofia Administrativa do Dr. Deming.
O Dr. Deming iniciou o seu trabalho ensinando mtodos estatsticos para os
americanos durante a I Guerra Mundial e para os japoneses anos depois. Esses mtodos
desapareceram da indstria americana depois da guerra e ele percebeu que no
bastavam apenas mtodos estatsticos. Ponderou sobre o que poderia ter provocado
aquele fracasso e como ele poderia ser evitado no futuro. Foi, aos poucos, chegando
concluso de que o que era preciso era uma filosofia bsica de administrao, com a
qual os mtodos estatsticos fossem compatveis. J tinha novos princpios quando foi
ao Japo em 1950 e continuou aperfeioando e ampliando estes princpios nos trinta
anos que se seguiram at ser redescoberto nos EUA.
Batizou-os como os Quatorze Pontos. Segundo ele, nem sempre houve
quatorze pois quando os formulou pela primeira vez h vinte anos, havia dez ou
menos. Com o incio de sua atuao nos EUA, precisou acrescentar alguns que no
eram compatveis com a nao japonesa, mas que se enquadravam perfeitamente na
nao americana como o Nono Ponto acabar com o medo ou o Dcimo Segundo
Ponto remover as barreiras ao orgulho da execuo. As Sete Doenas Fatais




65


parte de sua Filosofia de Administrao tambm surgiram nos EUA alguns anos
depois e podem ser identificadas na administrao ocidental como um todo.
Posteriormente, foram reformuladas com Doenas novas sendo acrescentadas e outras
rebaixadas para uma condio menos importante, uma nova categoria chamada
Obstculos que sero aqui enumerados. Inicialmente, os quatorze pontos do Dr.
Deming:

1. Estabelecer a constncia de propsito para melhorar o produto ou o
servio: o Dr. Deming prope uma nova definio no papel de uma
organizao. Ao invs de ganhar dinheiro, seu papel ficar no ramo e oferecer
empregos por meio de inovao, pesquisa, aperfeioamento constante e
manuteno.

2. Adotar a nova filosofia: os americanos so muito tolerantes com o mau
desempenho e o servio mal feito. Precisam de uma nova filosofia na qual os
erros e o negativismo sejam inaceitveis.

3. Acabar com a dependncia da inspeo em massa: as organizaes
americanas em geral inspecionam um produto quando ele sai da linha de
produo ou em etapas principais. Os produtos com defeitos so jogados fora ou
refeitos; ambos os procedimentos so desnecessariamente caros. Na verdade,
uma organizao paga aos colaboradores para fazerem defeitos e, depois, para
corrigi-los. A qualidade fruto no da inspeo, mas do aperfeioamento do




66


processo. Com instruo, os colaboradores podem ser chamados a participar
desse aperfeioamento.

4. Cessar a prtica de avaliar as transaes apenas com base nos preos: os
departamentos de compras funcionam com ordem de procurar o fornecedor que
oferea o preo mais baixo. Muitas vezes isso leva aquisio de materiais de
baixa qualidade. O que eles devem procurar a melhor qualidade e tentar
consegui-la com um nico fornecedor para qualquer item, num relacionamento
de longo prazo.

5. Ir melhorando sempre o sistema de produo e servio: a melhora no
um esforo feito apenas uma vez. A administrao obrigada a estar sempre
buscando novas formas de reduzir os desperdcios e melhorar a qualidade.

6. Instituir o treinamento: muitas vezes, os colaboradores aprendem o
trabalho com outro colaborador que nunca teve treinamento apropriado. So
obrigados a seguir instrues ininteligveis. No podem fazer o trabalho porque
ningum lhes diz como faz-lo.

7. Instituir a liderana: o trabalho de um supervisor no dizer s pessoas o
que fazer ou puni-las, mas liderar. Liderar consiste em ajudar as pessoas a fazer
um trabalho melhor e em perceber, com mtodos objetivos, quem tem
necessidade de ajuda individual.





67


8. Afastar o medo: muitos colaboradores tm medo de fazer perguntas ou
tomar uma posio, mesmo quando no compreendem o trabalho ou o que est
certo ou errado. As pessoas continuaro fazendo as coisas da maneira errada, ou
no as faro. A perda econmica causada pelo medo espantosa. necessrio,
para conseguir melhor qualidade e maior produtividade, que as pessoas se
sintam seguras.

9. Eliminar as barreiras entre as reas de apoio: muitas vezes, as reas de
apoio departamentos, unidades, o que quer que seja competem entre si ou
tm objetivos conflitantes. No trabalham como uma equipe para poderem
resolver ou prever problemas. E, o que pior, os objetivos de um departamento
podem causar dificuldades para outro.

10. Eliminar slogans, exortaes e metas para os colaboradores: isso nunca
ajudou algum a fazer um bom trabalho. preciso deixar as pessoas
trabalharem com seus prprios slogans.

11. Eliminar as cotas numricas: as cotas s levam em conta nmeros, no
qualidade ou mtodos. So, em geral, uma garantia de ineficincia e custo
elevado. Uma pessoa, para manter o emprego, atinge uma cota a qualquer custo,
sem levar em considerao os danos para a organizao.

12. Remover as barreiras ao orgulho da execuo: as pessoas fazem questo
de realizar um bom trabalho e ficam aflitas quando no o conseguem. muito




68


comum serem atrapalhadas por supervisores mal-orientados, equipamentos com
defeitos e materiais defeituosos. Essas barreiras tm de ser removidas.

13. Instituir um slido programa de educao e retreinamento: tanto a
administrao quanto os colaboradores tero de ser educados nos novos
mtodos, inclusive no trabalho em equipe e nas tcnicas estatsticas.

14. Agir no sentido de concretizar a transformao: preciso uma equipe de
administrao superior especial com um plano de ao para cumprir a misso da
qualidade. Os colaboradores no podem fazer isso por conta prpria, nem os
administradores. Um conjunto crtico de pessoas da organizao tem de
entender os Quatorze Pontos, as Sete Doenas Fatais e os Obstculos.

As Sete Doenas Fatais que emperravam a produtividade americana foram
descritas pelo Dr. Deming da seguinte maneira:

1. Falta de constncia de propsito: uma organizao sem constncia de
propsito no possui planos a longo prazo para continuar no ramo. A
administrao insegura, o mesmo acontecendo com os colaboradores.

2. nfase no lucro a curto prazo: a busca do aumento dos dividendos
trimestrais prejudica a qualidade e a produtividade.





69


3. Avaliao pelo desempenho, por notas de mrito ou pela verificao
anual do desempenho: os efeitos dessas prticas so ruinosas o trabalho em
equipe destrudo, promovendo-se a rivalidade. As notas de desempenho
semeiam o medo, deixando as pessoas amargas, desanimadas e abatidas.
Tambm estimulam a mobilidade da administrao.

4. Mobilidade da administrao: administradores que vivem mudando de
emprego nunca entendem as organizaes para as quais trabalham e nunca
permanecem nelas o tempo suficiente para acompanhar as mudanas de longo
prazo necessrias para a qualidade e a produtividade.

5. Dirigir uma organizao apenas com base em nmeros visveis: os
nmeros mais importantes so desconhecidos e impossveis de conhecer o
efeito multiplicador de um fregus satisfeito, por exemplo.

Essas cinco Doenas Fatais podem ser identificadas em qualquer organizao de
qualquer parte ou porte. O Dr. Deming, porm, acrescenta mais duas que ele diz
referirem-se apenas aos Estados Unidos. So elas:

6. Os custos exagerados de assistncia mdica.

7. Os custos exagerados de garantia.





70


Alm dessas doenas, o Dr. Deming, ao encerrar seus pensamentos, ainda
identifica uma categoria menor de obstculos que inibem a produtividade. Entre eles,
esto o pouco caso com o planejamento a longo prazo, a confiana na tecnologia
para resolver os problemas, a busca de exemplos a serem seguidos ao invs de se
criarem resolues e desculpas, como nossos problemas so diferentes.
Como se pode perceber, essa filosofia pode vir a provocar fortes reaes e nem
todas elas positivas. O certo, porm, que se a administrao considerar efetivamente
suas falhas e se envolver plenamente com essa filosofia de Deming, ela ter ganhos de
produtividade e lucros jamais imaginados. Nesse sentido, os exemplos dados a seguir
servem para mostrar a temvel eficincia da estratgia japonesa que comeou a se
afirmar a partir de 1975, ano considerado como ponto de mutao, aps ter sido
forjada com base na filosofia administrativa de William Edwards Deming, introduzida
por ele, com auxlio de J.M. Juran, nos anos 50 do sculo XX.
Em relao aos exemplos, vale mencionar o caso da televiso em cores que
constituiu uma das primeiras batalhas assumidas pela exportao japonesa. Durante o
perodo de latncia de 1965 a 1975, desenvolve-se no Japo, em um mercado
relativamente protegido, dois ou trs concorrentes que colocaro no mercado produtos
de alto nvel e confiveis, com uma qualidade de conformidade que visa ao zero
defeito e fluxos de produo estabilizados em just-in-time. Os custos caem e se
uniformizam, graas a uma mo-de-obra barata, criando assim uma formidvel
vantagem competitiva. As fronteiras japonesas so abertas e os aparelhos de televiso
invadem os mercados externos. a estratgia do casulo, que protege a indstria local e
abre-se no momento em que ela est preparada para eliminar a concorrncia
internacional. A televiso foi inventada no Ocidente, mas o Japo soube desenvolver




71


mtodos eficientes de produo e controle da qualidade que deram frutos, sempre a
partir de 1975, de acordo com os prognsticos de Deming e Juran.
O outro exemplo diz respeito s motocicletas e ainda mais surpreendente.
Talvez o leitor ainda se lembre das motocicletas inglesas, to bonitas, mas sempre com
defeitos. A partir da dcada de 70, a produo foi interrompida, no momento em que as
Honda comearam a invadir os mercados americano e europeu. Em 1983, os
fabricantes japoneses passaram a deter 93% do mercado ingls de motocicletas! o
que os motoqueiros denominaram de contragolpe do pedal! Os mesmos que s
concebiam uma moto sob o aspecto de regulagem permanente, agora s juram pelos
motores nos quais no mais possvel mexer, por causa do nvel de eletrnica e
sofisticao que possuem....
Mas, se a GQT deu to certo com os produtos manufaturados, ser que o mesmo
ocorreu com os servios? Inicialmente, ser apresentada uma caracterizao desse
setor e tecidas consideraes acerca de suas especificidades.


I.4. Histria e contextualizao da gesto pela qualidade total em servios
As informaes precedentes deram conta de que, apesar de no ser uma rea de
conhecimento plena, como a Economia, o Direito, a Medicina e a Qumica, por exemplo, a
gesto pela qualidade total em manufatura pode ser considerada uma terminologia
consolidada que, ao surgir da rea de conhecimento da Administrao de Empresas, com
contribuies da Engenharia de Produo, criou uma nova lngua de especialidade e uma nova
vertente terminolgica, pois o que Deming e outros tericos fizeram foi reinventar a prtica
administrativa a partir de uma oposio ao taylorismo, inaugurando uma nova filosofia que




72


pudesse garantir nveis timos de produtividade na indstria manufatureira e lucros cada vez
maiores, principalmente pela diminuio dos custos de produo e do retrabalho. No entanto,
com o advento do setor de servios, cuja existncia inegvel, responsvel que por quase
60% da ocupao da mo-de-obra ativa do Brasil, e devido s mudanas tecnolgicas havidas
na produo, a administrao das organizaes pertencentes a este setor teve tambm de ser
reinventada. Mas, ser que houve o mesmo percurso e esta nova filosofia administrativa
tambm tenha se adaptado ao setor? Ser que j h uma terminologia da gesto pela qualidade
total em servios? Se houver, e o item do captulo provar que h, essa terminologia j se
encontra consolidada ou ainda uma rea de conhecimento em constituio? Como se pde
perceber, o prprio Deming, quando enumerou seus quatorze pontos, o fez trazendo os
servios juntamente com a manufatura. Para tentar responder a uma das questes levantadas
nesta pesquisa, se procurar agora desenvolver algumas caractersticas administrativas que
realmente fazem a distino entre a GQT em manufatura e a GQT em servios, mostrando
algumas diferenas entre as duas, com o intuito de provar suas especificidades.
Apesar de fazer essa juno entre manufatura/servios em relao gesto pela
qualidade total na descrio dos 14 princpios, o prprio Deming
37
reconhece que uma
importante diferena entre as duas que um operrio de produo no tem apenas um
emprego: ele sabe que est fazendo sua parte para fabricar algo que algum ver, sentir e
usar de alguma forma, ou seja, ele tem alguma idia do que seja seu trabalho, e alguma idia
da qualidade do produto final. Visualiza o consumidor final satisfeito ou no com o produto



37
Cf. DEMING, W. E. Op. Cit., p. 139.




73


de sua organizao. Em contrapartida, em muitas organizaes de servios, as pessoas que l
trabalham tm apenas uma funo. Elas no sabem que tm um produto e que este produto o
servio; que bons servios e clientes satisfeitos mantm sua empresa no ramo e geram
empregos; que um cliente insatisfeito pode causar a perda de um negcio e de seu emprego.
Outra diferena que a maioria dos estabelecimentos de servios tem um mercado cativo,
pois dificilmente as mesmas precisam competir ombro a ombro com uma organizao
multinacional. Ainda outra diferena entre servios e produo que uma organizao de
servios no gera novos materiais para o mercado internacional. Uma empresa transportadora,
por exemplo, pode apenas transportar o que outros produzem. No pode gerar materiais para
transportar.
Segundo este autor, a maioria das indstrias de servios oferece:

1. Transaes diretas com massas de pessoas.
2. Grandes volumes de transaes, nas principais reas de vendas.
3. Grande volume de papel envolvido nas reas principais dos negcios.
4. Grande quantidade de processamento.
5. Muitas transaes com pequenas quantias e/ou valores imensos.
6. Um nmero extremamente grande de maneiras de cometer erros.
7. Manuseio e remanuseio de grandes quantidades de pequenos itens.
38






38
DEMING, W. E. Op. Cit., p. 140.




74


Esta tendncia de separao na rea administrativa entre os dois setores vem
ocorrendo h algumas dcadas, principalmente desde os anos 80 do sculo XX, dada a
necessidade de maior profissionalismo na administrao das operaes de servios nas
organizaes. Tem-se procurado adaptar as tcnicas de administrao industrial,
originalmente desenvolvidas para o setor de manufatura, s condies do ambiente de
produo de servios. Este movimento lento e constante teve como conseqncia um aumento
na tendncia de procura de profissionais com formao em Administrao Industrial, por
parte de organizaes de servios, como instituies financeiras, administradoras de cartes
de crdito, empresas varejistas e atacadistas, entre outras. Mais recentemente, na dcada de 90
daquele sculo, ao mesmo tempo em que o prprio setor de manufatura reconheceu a
inadequao de algumas metodologias tradicionais de administrao da produo, e buscou
novos conceitos, com vistas adaptao ao novo ambiente econmico mundial, o setor de
servios necessitou desenvolver conceitos e metodologias adequados, tanto aos novos tempos
quanto s especificidades de suas operaes, o que teoricamente se constituiu em uma nova
vertente terminolgica, possvel j de ser denominada como gesto pela qualidade total em
servios, em constituio, ainda aliada, em alguns aspectos, gesto pela qualidade total em
manufatura.
De acordo com Gianesi & Corra,

...parece evidente, portanto, a importncia de se desenvolverem conceitos e
tcnicas de administrao para as operaes de servios, pelo menos com a
mesma nfase que tem sido dada manufatura, para que no se corra o risco




75


de ter a economia dominada por um atividade pouco produtiva e vulnervel
competio internacional.
39


J. M. Juran
40
, por sua vez, responsvel pelo texto dos autores citados abaixo, coloca
que a classificao convencional de uma economia nacional em indstrias inicia-se a partir da
seguinte subdiviso: i. manufatura, significando, principalmente, o processamento de
materiais em mercadorias acabadas durveis e no durveis; ii. no-manufatura, ou seja, as
demais indstrias que, por sua vez, so divididas em indstrias de servios e no-prestadoras
de servios, como as indstrias de minerao, agricultura e construo.
Do ponto de vista da qualidade, as indstrias no-prestadoras de servios tm muitos
pontos em comum com relao s indstrias de fabricao, j que se dedicam ao
processamento de materiais e freqentemente produzem produtos acabados. A categoria
indstrias de prestao de servios inclui, principalmente, transporte, utilidades pblicas,
marketing, finanas, imobilirias, restaurantes, hotis, imprensa, comrcio, sade, consertos e
governo.
Por outro lado, o mesmo autor estabelece caractersticas prprias ao setor de servios.
Segundo ele,

Uma organizao de prestao de servios um sistema organizado de
tcnicas e recursos especiais. (A UCE organizao utilizada aqui num
mbito genrico, incluindo rgos governamentais e outras organizaes
sem fins lucrativos criadas para a prestao de servios, bem como firmas

39
GIANESI, I. G. N. & CORRA, H. L. Administrao estratgica de servios: operaes para a satisfao do
cliente, 1996, p. 21.
40
Cf. ZIMMERMAN, C. D. III & ENELL, J. W. Indstrias de Servios. In JURAN, J. M. & GRYNA, F. M.
Controle da qualidade: qualidade em diferentes sistemas de produo, 1991, p. 305-306.




76


comerciais.) Ela oferece a seus clientes os benefcios de seu sistema de
diversas formas, como, por exemplo:
- uso de recursos, como viagens de nibus, ligaes telefnicas;
- leasing de recursos, como aluguel de automveis, apartamentos;
- aconselhamento profissional, por exemplo, mdico;
- manuteno da sade, como hospitais, laboratrios mdicos;
- espetculos visuais ou sonoros, como teatro, televiso, rdio;
- distribuio de conhecimento, como cursos, treinamento;
- substituto do self-service, como servios de restaurantes.
41


Quanto qualidade propriamente dita, o autor assevera que, como no caso da
qualidade do produto, o conceito de qualidade do servio comea com adequao ao uso.
Organizaes de servios dedicam-se inteiramente a servir aos seres humanos. O
relacionamento construtivo somente se os servios satisfizerem as necessidades do cliente
quanto a preo, prazo de entrega e adaptabilidade sua proposta. Assim, a adequao ao uso
nada mais do que a capacidade que um servio tem de corresponder satisfatoriamente s
necessidades do cliente quando esse servio lhe prestado.
Os itens bsicos que permitem a adequao ao uso so denominados caractersticas da
qualidade. So essas as caractersticas identificveis ou atributos de um servio necessrios
para a adequao ao uso:

1. Psicolgicas, por exemplo, beleza do ambiente, conforto,
reconhecimento de clientes regulares.

41
ZIMMERMAN, C. D. III & ENELL, J. W. Op. Cit., p. 306-307.




77


2. Baseadas no tempo, por exemplo, tempo de espera na fila, quanto tempo
um conserto demorar.
3. Contratual, por exemplo, garantia de servio satisfatrio.
4. tica, por exemplo, honestidade da loja prestadora de servios,
colaboradores com conduta corts e baseada em princpios, verdade na
propaganda.
5. Tecnolgica, por exemplo, clareza do tubo de imagem da televiso.
42


Embora as indstrias de prestao de servios apresentem caractersticas de todas as
categorias acima mencionadas, as mais importantes para os consumidores so a psicolgica e
as que envolvem tempo e tica. A partir do momento em que a organizao prestadora de
servios identifica as caractersticas da qualidade que tm maior valor para seus clientes, ela
passa a planejar a qualidade de seu projeto e a qualidade da conformidade.
Ainda seguindo as argumentaes deste autor, interessante mencionar que o mesmo
disponibiliza um Programa da Qualidade em Servios, o que auxilia no sentido de
caracterizao dessa rea de conhecimento como independente, embora com algumas
conexes, em relao GQT em manufatura.
Segundo o autor, para um melhor controle da qualidade do servio, necessrio
especificar o nvel aceitvel de cada caracterstica da qualidade, analisar o desempenho atual,
observar desvios das metas epecficas e buscar e corrigir suas causas. As caractersticas do
Programa da Qualidade dos Servios so:


42
ZIMMERMAN, C. D. III & ENELL, J. W. Op. Cit., p. 311-312.




78


1. Projeto e especificao dos servios: para satisfazer as necessidades do
cliente quanto adequao ao uso e para tornar possvel a conformidade
diria s especificaes.
2. Estabelecimento de pontos de controle durante o processo: para
assegurar que os servios esto sendo prestados de forma correta,
consistente e dentro do prazo.
3. Controle do processo: para monitorar e ajustar o processo do servio de
forma que a produo esteja de acordo com os requisitos.
4. Sistema para identificao e correo de erros espordicos: a fim de
descobrir, investigar as causas e eliminar picos nos defeitos do servio.
5. Coleta de dados estatsticos: para documentar a acurcia do processo ou
do prprio servio e sua adequao ao uso.
6. Processo de correo: para prevenir a ocorrncia de prestao de
servios insatisfatrios s exigncias do cliente ou para oferecer recursos
quando os servios no apresentem bons resultados.
7. Feedback: para ajustar o processo ou as especificaes mantendo-os de
acordo com as exigncias do cliente.
8. Aperfeioamento da qualidade: para oferecer treinamento, ferramentas e
acertos organizacionais para a identificao de problemas crnicos
importantes, buscando suas causas e sua eliminao.
43






43
ZIMMERMAN, C. D. III & ENELL, J. W. Op. Cit., p. 319-320.




79


Estas caractersticas, se no todas ao menos algumas, so identificveis tanto em
manufatura quanto em servios. No entanto, em busca das especificidades de um e de outro,
necessrio partir de algum ponto. Tomando-se por base que na GQT o mais importante o
cliente, faz-se necessrio mencionar que a qualidade sentida por ele quando do fornecimento
de um servio diferencia-se da qualidade de conformidade de um produto manufaturado,
devido interao direta que h entre o cliente e o servio durante a prestao do mesmo. No
entanto, os servios, s vezes, so acompanhados, por um lado, de um aporte fsico, tangvel,
fabricado em outro lugar, como a refeio preparada na cozinha de um restaurante e, por outro
lado, a qualidade do servio no um elemento insignificante na venda de um produto
industrial. Onde se situa a diferena, ento, se ela realmente existe? Ao se delimitar essa
diferena, necessrio elaborar uma definio prtica dos servios, suficientemente pertinente
para poder deduzir as conseqncias que existem sobre a ao de prestao de servios e
tambm para poder trafegar da dimenso industrial dimenso dos servios.
Os servios, de acordo com Teboul,

...caracterizam-se essencialmente pela sua interface, isto , o local de
interao entre o usurio ou o cliente e um sistema de produo. Nessa
interface, o usurio est fisicamente presente e a produo e o consumo
ocorrem simultaneamente. Esta simultaneidade coloca de imediato o
consumidor dentro do processo de produo. A interface com freqncia
sustentada por um setor de suporte, que vai elaborar os processamentos
fsicos e acompanhar a prestao: a confeco de documentos, transaes,
tratamentos de dossis, anlises de laboratrios, preparao de refeies...
Fazendo um paralelo com a produo industrial, alguns autores denominam




80


este conjunto um servio, estranho cruzamento entre servio e produo
que evoca ao mesmo tempo seduo e servido.
44


Na verdade, qualquer que seja a transao realizada com um cliente, servios ou
produto manufaturado, sempre ser encontrada esta separao interface/suporte. Entretanto,
no caso dos servios, o tratamento do cliente ser realizado essencialmente na interface,
enquanto que, no caso de um produto industrial, o papel do suporte da fbrica, ou seja, do
processo industrial separado do cliente, fundamental. Sendo assim, a diferena entre
prestao de servios e produto industrial apenas de grau, pois o suporte em um produto
manufaturado maior do que na prestao de um servio, onde o espao da interface mais
importante. Como assevera Teboul, gerir um servio sobretudo gerenciar a interface. Gerir
um produto manufaturado sobretudo gerenciar as atividades de suporte.
45

Eis alguns exemplos: todo restaurante composto de uma sala, a interface, local de
entrega e de consumao do servio, e de uma cozinha, o suporte, local da fabricao dos
pratos; uma sala com uma forte orientao para o cliente e uma cozinha com uma forte
orientao para a produo e a racionalizao dos fluxos e dos meios, ou seja, duas lgicas
com prioridades diferentes que se cristalizam com freqncia em um patente antagonismo.
Segundo o segmento da clientela visada e a frmula escolhida, o sistema de produo
interface-suporte tomar feies diferentes.
Ao se fazer um exame, pode-se tomar como exemplos trs modelos para esclarecer o
j dito. O primeiro deles o restaurante benihama. Aqui, h um aumento da interface, uma
transferncia de suporte em direo interface para dar mais visibilidade interao, portanto

44
TEBOUL, J. Op. Cit., p. 197.
45
TEBOUL, J. Op. Cit., p. 198.




81


mais servio. Os clientes que esperam no bar vo para a sala em grupos de oito pessoas, ao
redor de uma mesa hibachi. Os cozinheiros servem a refeio diretamente na sala e cada um
responsvel por duas mesas de oito pessoas. A cozinha reduzida, pois a preparao
relativamente simples e padronizada.
O segundo exemplo refere-se a um restaurante clssico. Aqui, pode-se observar o
conflito entre os garons na sala, orientados para a satisfao dos clientes, e o chefe de
cozinha e sua equipe, mais preocupados com a organizao da produo. Todos j sentiram o
resultado desse conflito, no mesmo?
Como ltimo exemplo, que tal o caso de um restaurante do tipo McDonalds? H,
aqui, um movimento inverso. A padronizao do produto acompanha a padronizao e a
simplificao da interface, que diminui de maneira relativa. No suporte, encontra-se a lgica
industrial que conduz cadeia de produo, assim que o produto se torna padronizado. V-se,
pois, claramente, a diferenciao de duas lgicas: uma de interface e de personalizao e outra
de suporte e de padronizao. A sala simples, mas limpa, podendo a interface ser muito
reduzida no caso de um drive-in. Por outro lado, na cozinha, encontram-se diversas linhas de
produo muito organizadas. Um modelo to simples e til que transformou essa rede de fast-
food em um fenmeno mundial, capaz at de ser um parmetro de cmbio em relao a seu
produto mais famoso, o big-mac.
Alm dos restaurantes, pode-se exemplificar com a questo dos bancos. Em seu
guich, o colaborador oferece alguns servios. Estes so consumidos imediatamente, por
exemplo, a entrega de talonrios, os depsitos, as informaes, etc. a interface. No
entanto, nem todas as transaes so realizadas quando do contato entre o cliente e o caixa do
banco. A demanda do cliente muitas vezes transformada em formulrio, um documento
intermedirio, que passar aos servios de suporte, parte de trs do banco, no sentido mesmo




82


e figurado. E, ento, o processamento da informao passa a ser feito do modo clssico,
muitas vezes recorrendo ao terico Taylor, j citado, com postos de trabalho bem definidos e
estoques intermedirios.
Em relao a um outro servio muito utilizado, o transporte areo, no momento em
que um avio efetua um vo entre So Paulo e Maring, por exemplo, o passageiro est
dentro do avio, no instrumento que produz o transporte. Ele consome a viagem no momento
em que a companhia o produz. Uma defasagem no tempo entre a produo e o consumo
sequer concebida: o passageiro encontra-se, durante a viagem, diretamente ligado ao
processo de produo. Alis, seja dentro do avio ou no aeroporto, o passageiro adivinha a
existncia de suportes que substituiro os sistemas interativos, quais sejam, o transporte de
malas, a manuteno, o controle do trfego areo, a preparao das refeies, entre outras.
Esses exemplos mostram claramente que a parte interativa, a interface, pode variar de
maneira considervel. Da, a afirmativa de que tudo uma questo de nvel, pois necessrio
abandonar o nvel demasiadamente genrico de setor de atividade, onde a definio de um
servio obscura, e substitu-lo pelo nvel de operaes, na qual a definio dada permite
estabelecer uma tipologia mais til para a ao.
Ainda uma vez, vale citar Teboul, que diz que

... qualquer setor de atividade parte servio ou interface e parte produo
ou suporte. o peso relativo de cada um desses blocos em uma certa
atividade que far com que ela tenha um aspecto de servio, mais ou menos
caracterizado. Seria at possvel imaginar um indicador que fizesse a ligao
entre os dois blocos, ou seja, a intensidade do servio seria o custo da
interface dividido pelo custo total. Com o desenvolvimento da padronizao




83


e da automatizao de seus produtos, algumas empresas industriais voltam-
se mais claramente para o setor de servios.
46


Como se pode perceber pelas informaes arroladas, no fcil caracterizar o setor de
servios. Nesse sentido, uma das hipteses vai ao oposto disso, pois foi aventada a
possibilidade de que ele pode ser caracterizado e, alm disso, pode trazer uma srie de UCEs
que o caracterizaria como uma rea de conhecimento e uma lngua de especialidade com uma
terminologia especfica.
Para prosseguir a discusso, o que salta aos olhos o conceito de interface, que
distinguiria o setor de servios do setor de produo de produtos manufaturados. sobre esse
conceito que o texto deste item do Captulo se ocupar agora.
A especificidade da UCE interface no setor de servios est no fato de que a produo
e o consumo so simultneos. A conseqncia disso que o produto o processo e esse, por
sua vez, o prprio produto. A diferena latente que o servio no estocvel como o
produto manufaturado. Um servio no consumido um servio perdido. o caso de um
quarto de hotel ou de um lugar vazio no avio. Se a capacidade for grande demais, a parte
inutilizada est inexoravelmente perdida. Se ela for insuficiente, deve-se estocar o cliente sob
forma de fila de espera, o que ocasiona uma srie de problemas. O principal, talvez, nesse
caso, seja a da utilizao da capacidade oferecida e, ento, entra a questo de ela ser oferecida
com qualidade.
Um dos aspectos mais importantes para que isso ocorra relaciona-se com a sucesso
de momentos de verdade. Ainda de acordo com Teboul,


46
TEBOUL, J. Op. Cit., p. 202.




84


... cada um desses momentos feito de mltiplas interaes, difceis de
serem controladas do exterior. O colaborador, por exemplo, mestre nico a
bordo. Ele deve acertar de primeiro e eventualmente fazer alguns ajustes
durante a interao, pois quando o servio termina difcil voltar atrs para
consert-lo. Nesse caso, tambm, o conserto uma arte difcil de ser
manejada e muitas vezes sai caro tentar faz-lo.
47


Os servios, por essas razes, possuem uma variedade e uma volatilidade das
expectativas do cliente. difcil proteg-los com uma patente, como no caso de um produto
manufaturado, ou mesmo passar adiante as suas propriedades. Da mesma forma, suas
demonstraes no so evidentes.
Quanto ao cliente, suas expectativas podem variar de um para o outro, assim como
um mesmo cliente pode mudar de opinio de uma hora para outra, dependendo da
oportunidade oferecida ou da intensidade da interao. Os servios, em resumo, so

... o resultado do conjunto dos momentos de verdade vividos pelo cliente,
cuja satisfao expressa-se de forma global: a loja onde gosto de fazer
minhas compras, ou ento no gostei... Da o interesse, no ltimo caso, de se
colocar a questo do <por qu?>, de modo a se estabelecer a origem da
insatisfao. Muitas vezes, um detalhe pode abalar a impresso de conjunto e
tanto a primeira como a ltima impresso tm uma funo importante na
composio dessa imagem global.
48



47
TEBOUL, J. Op. Cit., p. 203.
48
TEBOUL, J. Op. Cit., p. 204.




85


Para resolver essa questo, o cliente pode ser levado a participar. Ao participar, ele
pode usar sua experincia ou seu know-how. Ele tambm pode querer controlar a situao ou
ganhar tempo. Por isso, o cliente pode ser considerado um colaborador. A participao do
cliente introduz uma fonte de incerteza extra, mas permite reduzir os custos de pessoal.
Para encerrar, na questo dos servios, no existe uma rede de distribuio como no
caso de um produto fsico em uma fbrica, muitas vezes localizada distncia do local da
entrega. A prestao do servio feita onde o cliente se encontra. para isso que existem
essas redes de agncias de viagens, ou seja, vrios estudos e desenvolvimentos tcnicos
objetivam melhorar a capacidade dos servios em serem transportados.
Aps essa incurso na rea de administrao de empresas relacionada a servios, com
o intuito de caracteriz-la como uma rea de conhecimento que produziu uma terminologia,
resta, ainda, tecer algumas consideraes sobre os fatores objetivos desta pesquisa, ou seja,
possvel, lingstica e terminologicamente, vislumbrar uma lngua de especialidade
relacionada gesto pela qualidade total em servios?
Essa questo factvel ao se enveredar pela questo da gesto pela qualidade total na
interface, conceito que se distingue de suporte, presente esse tambm na produo de um
produto manufaturado, como tambm nos servios internos de um banco, de um exame de
laboratrio ou mesmo da preparao de uma refeio na cozinha. Tudo isso se refere ao
conceito clssico de qualidade em relao a um produto manufaturado. Mas, como seria essa
qualidade total na parte de um servio puro? Para iniciar, vale buscar a definio de Teboul,
que a de encontrar essa dupla articulao definicional: posicionamento timo da oferta de




86


servio sobre o segmento ou segmentos cobertos com uma busca de vantagem concorrencial,
por um lado e, por outro, o desenvolvimento interno e fabricao dentro da conformidade.
49

Quanto ao posicionamento do servio e qualidade da concepo, h que se
mencionar que a definio do seguimento homogneo dos clientes-alvo apia-se nas
caractersticas da populao estudada, caractersticas socioprofissionais clssicas, mas
tambm caractersticas de localizao e de oportunidade de usar tal ou qual servio, por
exemplo, trabalho ou lazer, caractersticas essas locais, resultando realmente da presena
fsica do cliente. Dessa forma, necessrio definir as necessidades comuns e especficas desse
alvo, a comear pela natureza dessas necessidades. Aqui, no apenas o desempenho procurado
importante, mas tambm o modo de realizao e de fornecimento essencial, uma vez que
h a simultaneidade do consumo e da produo.
Essas necessidades podem assim ser classificadas: necessidade primria, necessidade
de segurana, necessidade de pertencer a um grupo, autovalorizao, auto-realizao.
possvel ainda dividi-las segundo as quatro facetas da interao no momento da contratao
do servio: interao com o processo de realizao do servio, interao com a tecnologia
utilizada, interao com os colaboradores e interao com os outros clientes. Assim, para
atingir o objetivo determinado, o responsvel pelo marketing seleciona algumas
caractersticas finais que vo definir a oferta. Algumas dimenses, como a segurana
(transporte areo) ou o preo, so bvias. So as chamadas dimenses importantes. Por outro
lado, h dimenses que vo permitir estabelecer uma diferena em relao concorrncia.
So as dimenses determinantes, o algo mais que o cliente procura e que so responsveis
pela venda, mesmo que paream secundrias.

49
TEBOUL, J. Op. Cit., p. 205.




87


Para resumir, a qualidade de concepo resulta, antes de mais nada, de um bom ajuste
em relao s necessidades do segmento: dar o que necessrio, o servio de boa qualidade, o
que interessa ao cliente e que ser notado por ele. Dessa forma, a gesto pela qualidade total
em servios pressupe que no se deva dar ao cliente o que no lhe parea necessrio, pois ele
no notar isso, como uma necessidade, e os custos aumentaro. Essa qualidade tambm o
algo mais que faz a diferena, a vantagem competitiva. Antes de tudo, no entanto,
necessrio cumprir o prometido. o que se denomina qualidade da conformidade: fazer um
servio bem feito, como deve ser feito.
Como j mencionado, a questo do setor de servios diferencia-se basicamente do
produto manufaturado pelo fato de que o processo o produto e o produto o processo. Dessa
forma, ao se tentar delimitar como a GQT pode ser inserida nesse contexto, necessrio
mencionar algumas estratgias que cobriro da melhor maneira possvel o seguimento
escolhido.
A primeira delas a estratgia de concepo da oferta. Esta, por sua vez, possui alguns
princpios que vo gui-la. O primeiro princpio focalizar o processo. Quanto mais
homogneo, mais o processo de realizao ser simples e controlvel. Por isso, importante
designar misses claras para o processo de realizao, com uma certa flexibilidade e
aceitando uma padronizao maior do fornecimento. O segundo princpio obter uma
frmula global e coerente. Como o produto o processo, necessrio conceber
simultaneamente o servio e o seu modo de fabricao. Dever haver uma coerncia do
conjunto, construda a partir de formas simples, facilmente compreendidas e comunicadas. O
terceiro princpio saber jogar com a interface e o suporte, ou seja, mesmo sendo mais
complexo obter-se um bom nvel de qualidade na interface, ela permite satisfazer o cliente de
maneira mais ampla e completa. O quarto princpio a descentralizao e a flexibilidade de




88


adaptao. Apesar do cuidado com a seleo e a educao dos clientes, sempre resta uma
certa imprevisibilidade de comportamento, que acrescentada s variaes naturais do
tratamento, devido s mltiplas interaes possveis. Por outro lado, o cliente muitas vezes
deseja uma personalizao do servio e uma certa espontaneidade na reao do colaborador.
E, quando surge um problema eventual, este dever poder reagir rapidamente sem ter de subir
toda a linha hierrquica para obter uma aprovao. Por isso, importante comunicar objetivos
mensurveis e claros, de acordo com as escolhas que presidiram definio da oferta. O
ajuste feito mais a partir dos objetivos ligados necessidade do cliente, do que a partir das
normas e regulamentos vindos de cima. O ltimo princpio dessa estratgia a anlise do
valor e a reduo do custo da interface, pois aumentar a interface criar mais servio. Ela
custa mais caro do que o suporte devido personalizao da prestao, da interao direta
com um colaborador e da m utilizao das capacidades. Para se reduzir estes custos,
necessrio seguir algumas diretrizes, como dar mais valor ao cliente, pelo menor preo,
melhor distribuio dos recursos caros, automatizar as tarefas padronizadas, entre outras.
A segunda estratgia aquela da preparao das expectativas e ajustes da demanda.
Basicamente, consiste em definir a oferta que ser comunicada ao cliente e que criar
expectativas. Se essas forem superiores percepo, surgir uma decepo ou, inversamente,
se elas forem baixas, surgir uma satisfao mais forte, com a particularidade de que o cliente
s poder conhecer o servio se o experimentar. Portanto, ele procurar todos os indcios
possveis para se decidir ou se tranqilizar. O prestador do servio, por sua vez, deve se
utilizar de alguns meios possveis para levar essas informaes ao cliente, entre elas, utilizar a
mdia tradicional, comunicar acerca dos preos, enquanto indicador do nvel do servio,
utilizar a experincia anterior e a informao boca a boca, localizar o servio prximo ao




89


cliente, pois a localizao tem uma funo importante no ajuste da demanda, ou seja, a
promessa de servio corresponde s condies normais de explorao.
A terceira e ltima estratgia chamada de ajuste da percepo. Por meio dela, a
qualidade se instalar no servio ofertado, podendo ser descrita a partir de alguns parmetros.
O primeiro deles levar em considerao o mapa perceptivo, ou seja, cada um o possui j que
o mesmo se organizou com o passar dos anos, resultado da cultura e das experincias vividas.
Este mapa apresenta uma geografia especfica e, como a gua que se junta no vale e corre
para o rio, as impresses correm de acordo com certos esquemas adquiridos, segundo uma
geografia traada pela experincia. O mapa perceptivo tem uma funo de filtro que deve ser
conhecido e levado em considerao. Um outro parmetro reduzir a percepo de risco e
incerteza, como se houver prazo de espera, explicar que esta normal e est sob controle. Um
outro parmetro, ainda, ter cuidado especial com a primeira impresso e a reputao. A
partir do momento em que a imagem ou uma impresso tenha sido formada, ela fica
solidamente impregnada e as indicaes posteriores a reforaro ainda mais. Se a expectativa
for a de uma boa prestao de servios, h tendncia a minimizar a parte negativa. por isso
que, no caso de um servio, a imagem, a repetio, o primeiro contato e a primeira impresso
so essenciais. Um quarto parmetro diz respeito a no esquecer que a percepo global e,
por isso, necessrio prestar ateno em todos os detalhes, por exemplo, a blusa suja do
mdico contrabalana negativamente com as maravilhosas referncias que o cliente teve dele
ou mesmo as poltronas desagradveis deixam uma impresso negativa, apesar da boa
qualidade do filme. Ainda um outro parmetro encaixa-se nessa estratgia. a questo de
reforar a percepo tornando o servio tangvel. Como j mencionado repetidas vezes, o
servio continua em parte intangvel, por causa da simultaneidade da produo e do consumo
e alguns ndices materiais vo ter um papel importante, justamente por serem fsicos, porque




90


trazem uma percepo tangvel e permitem antecipar a qualidade da prestao. Por ltimo,
necessrio reforar a participao do cliente ou a margem de ajuste do colaborador. Ao
participar da elaborao do servio, da sua realizao ou do seu controle, o cliente pode usar o
seu conhecimento tcnico e influenciar o processo. Da mesma forma, a margem de variao
de comportamento permitida aos colaboradores pode influenciar a percepo.
A partir do momento em que um servio de boa qualidade tenha sido definido, a oferta
deve ser realizada como manda a regra, sem defeito. Isto ser ainda mais fcil porque a
frmula inicial simples, facilmente comunicvel, segundo todas as diretrizes da interao.
Sem defeito no significa perfeio. Trata-se de realizar a oferta em conformidade com os
padres anunciados, manter a transparncia, pelas dimenses bvias que so oferecidas pelo
conjunto da profisso, evitando especialmente as insatisfaes quanto s dimenses que
fazem a diferena.
Deve-se, ainda, observar que um defeito, uma retratao em relao promessa ou
expectativa pode ter um impacto bem maior do que o algo mais, que foi criado para vencer a
concorrncia. Todos as realizaes negativas em relao promessa oferecida vo ser
contabilizados no mapa perceptivo do cliente e anular o algo mais obtido em outros pontos.
Pode ser uma expectativa decepcionada, uma experincia inferior promessa inicial, como
tambm um defeito de fabricao, uma falta de conformidade, etc.
Como se pde perceber pelos dados arrolados, perfeitamente factvel mencionar uma
diferenciao entre o setor de manufatura e o setor de servios em relao GQT. Com base
nesses dados, uma das hipteses j encontrou acolhida na teoria administrativa, ou seja, h
realmente uma possibilidade de caracterizar o setor de servios como uma rea de
conhecimento. Por conta disso, ser dado prosseguimento pesquisa trazendo um exemplo de
organizao de prestao de servios que implementou essas idias, como feito em relao




91


histria e contextualizao da GQT em manufatura. O exemplo escolhido refere-se a uma
organizao bancria que ser denominada de Banco E, conforme exposio de Ricardo
Cintra de Almeida, que justifica a no-identificao da instituio pelo fato de ter apresentado
um trabalho isento, sem interesse de comprometer a mesma. Esclarece, porm, que essa
organizao detentora, no Brasil, do Certificado ISO 9002, o mais completo da srie para a
prestao de servios. Eis o relato:

"Errar humano, mas absolutamente dispensvel." (Excerto de texto sobre
reduo de erros, presente em material impresso elaborado pelo banco).
Seis dias aps expedio do pedido de entrevista, recebeu-se resposta
positiva. Na data agendada, feitas as apresentaes, entrevistado e
entrevistador dirigiram-se sala de reunies, que fora reservada para o
encontro. Estava ocupada. Aps consulta a uma funcionria, aparentemente
encarregada das reservas de salas (entre outras funes), anfitrio e visitante
seguiram para outra sala. Antes que se passassem cinco minutos, outra
funcionria chegou porta, surpreendeu-se com as duas presenas que
constatou e disse: "Eu reservei esta sala!" No havia o que fazer, a no ser ir
para a outra sala a terceira em menos de 15 minutos. Nessa ltima,
finalmente, foi possvel realizar a entrevista (contando-se com extrema
colaborao do entrevistado). A sucesso de equvocos representou uma
ocorrncia que, alm de inconveniente, rarssima: falha no atendimento a
clientes interno e externo, simultaneamente e durante um mesmo evento (o
encontro entre os dois para uma reunio).
Iniciada a entrevista, a primeira observao foi muito positiva e surgiu logo
na apresentao do Programa de Qualidade Total (conhecido internamente




92


como PQT e iniciado h cinco anos). Segundo o entrevistado, constitui o
objetivo desse Programa: "Disponibilizar produtos e servios financeiros que
excedam as necessidades e expectativas [que encantem!] dos nossos clientes,
gerando diferencial mercadolgico em relao aos concorrentes [!]."
A leitura atenta da ltima citao permite identificar duas idias nucleares: i.
o encantamento do cliente um objetivo institucional; ii. a qualidade
tratada como instrumento de crescimento da empresa, pois, quando buscam
o "diferencial mercadolgico", evidenciam a meta de ampliao do market
share e conseqente ampliao de receitas.
Partindo-se do princpio de que bancos visam ao lucro, tem-se que o Banco
E considera Qualidade como um dos caminhos para obt-lo ou aument-lo.
O entendimento de que um Sistema de Garantia da Qualidade deve estar
inserido em um Programa de Qualidade clarssimo nesse banco. Referido
Programa vem sendo realizado em trs fases: i. implementao de um
sistema de gesto voltado para a obteno da qualidade; ii. instalao do
SGQ (trs anos depois de iniciada a primeira fase); utilizao de um sistema
que objetiva a "fidelizao dos clientes." A interpretao no pode ser outra
seno a de que a direo do banco somente pensou em sistemas de garantia
da qualidade aps ao planejada visando a preparar solo frtil para a
Qualidade.
Fase 1: esforos para a transformao cultural
Duas das mais rduas misses do administrador comprometido com a
Qualidade so erigir os pilares da cultura da Qualidade e disponibilizar o
ferramental inicial para que a Qualidade floresa. Em maro de 1997, o
Presidente do Conselho de Administrao do Banco E afirmou em entrevista
a um jornal da empresa: i. "Infelizmente, temos um Programa de Qualidade,




93


mas no desenvolvemos uma Cultura da Qualidade [cinco anos depois de
iniciado o Programa!]"; "Aqueles que julgam que caminhamos muito so
perigosos..."; "Para mudar a cultura de nossa empresa, preciso ter um
mnimo de obsesso e disciplina."
So palavras de um administrador cauteloso, talvez, at excessivamente
parcimonioso na anlise, mas a viso crtica sempre muito bem-vinda.
Durante a pesquisa, foi possvel observar que referido executivo est
comprometido com a Qualidade e exige o mesmo de seus colaboradores.
Posiciona-se claramente contrrio Qualidade superficial (a Qualidade-
modismo, por exemplo).
Fase 2: sistemas de garantia da qualidade ISO 9000
Somente aps trs anos de esforos iniciais, preparando o ambiente, o Banco
E iniciou o tratamento dos SGQ, segundo os preceitos dos documentos ISO
9000 Segunda fase do Programa. Em um folder destinado aos executivos
(para efeitos do PQT, chamados de gestores) e explicativo do SGQ,
encontrou o seguinte trecho: "Quando se analisa a necessidade de
implantao do Sistema da Garantia da Qualidade e se avalia o tipo de
certificao [interna ou externa], devem ser considerados os seguintes
aspectos: i. a estratgia do banco; ii. o grau de impacto no cliente externo; iii.
a adequao dos processos da rea em relao aos requisitos fundamentais
da Norma ISO 9000; iv. a relao custo/benefcio da implantao[!]."
Tem-se, aqui, pontos de extrema relevncia para este livro, a saber: i.
evidente que a implantao de um sistema desses dever ser considerada
dentro de um contexto estratgico do banco, avaliando-se a eficcia e
exigindo-se a adequao ao padro ISO 9000; ii. pela primeira vez na
pesquisa em que se baseia este livro, observou-se meno explcita




94


necessidade de avaliao de custos envolvidos na implantao e benefcios
esperados. Deve ser notado o carter imperativo dessa anlise que, em
nenhum momento, tem sua exeqibilidade questionada no banco.
A empresa decidiu implantar SGQ ISO 9000 em sua rede de agncias. Em
maio de 1997, certificou a primeira, de acordo com o modelo ISO 9002.
Justificando a deciso, o banco elaborou um texto intitulado Agora a vez
das agncias, em que se l: "Afinal, elas so locais em que a qualidade
percebida de forma mais visvel. (...) justamente por isso que a ISO est
chegando Rede." Concorda-se com o pensamento e comemora-se a
iniciativa que poder fazer surgir diversos processos de certificao de
agncias bancrias, a mdio e longo prazos, por todo o Pas. Na poca em
que foram atualizadas essas anotaes, maio de 1998, ainda no havia outra
agncia bancria certificada no Brasil.
O assunto agncias ainda no acabou. A empresa pretende, ainda em 1998,
instalar e certificar SGQ em agncias de Corporate (destinadas ao
atendimento de pessoas jurdicas que negociam volumes mais expressivos
em modalidades operacionais mais sofisticadas) e Private (especializadas no
atendimento aos clientes pessoas fsicas que exigem, pelo volume e natureza
de suas necessidades operacionais, atendimento diferenciado).
O cuidado com a sade das finanas est presente e facilmente
perceptvel, mesmo para um observador externo, a todo momento. Exemplo
do que se afirma o comentrio (tambm presente em jornal da empresa) a
respeito dos resultados obtidos por certo grupo de trabalho: "Ao longo de seu
trabalho de anlise, (...) identificou despesas que estavam sendo alocadas
incorretamente e, uma vez corrigidas, representam uma economia anual de
nada menos de R$ 4 milhes."




95


Alm do citado, existem vrios exemplos de mesma natureza no Banco E. A
organizao atribui ao esforo pela Qualidade os reflexos financeiros
positivos que se aproximaram, em 1997, dos R$ 8.000.000,00. Nmero
interessante, no? Principalmente se assumido que os custos envolvidos
tiveram menor expresso, naturalmente.
Fase 3: fidelidade ao cliente
A terceira fase do PQT ocupa-se de elevar continuamente o grau de
reteno de clientes (ou grau de fidelidade). Sobre isso, tambm,
considerem-se as palavras do Presidente do Conselho de Administrao:
"Sabemos que um cliente que est h mais tempo no Banco mais rentvel
do que aquele que entrou ontem."
Interessado em ter clientes cada vez mais fiis, o banco empreendeu parceria
com a TARP, empresa norte-americana de consultoria, conhecida em todo o
mundo por ter desenvolvido um sistema denominado Technical Assistance
Research Program (cujas iniciais identificam a empresa), que objetiva
fornecer s empresas meios de administrar a exposio ao risco da evaso de
clientes. Em comunicao interna, o banco leva a todos os seus funcionrios
algumas informaes bem conhecidas nos crculos acadmicos, mas
freqentemente desconhecidas por funcionrios de posio hierrquica mais
modesta (que no so, por isso, menos importantes) em outras empresas.
Constata-se, assim, o interesse de manter o funcionalismo bem informado.
Vejam-se, pois, algumas dessas informaes: i. "(...) apenas um em cada 27
clientes que experimentaram um mau servio formaliza a sua reclamao."
[O objetivo da observao foi alertar para os perigos representados pela
invisibilidade da insatisfao.]; ii. "(...) consumidores insatisfeitos expressam
sua insatisfao para uma mdia de 22 pessoas." [O que ameaa um dos




96


indicadores de satisfao mais utilizados pelos bancos: a disposio de
recomendar os servios.]; iii. "(...) custa seis vezes mais caro conquistar
clientes do que os manter."
Ainda referindo-se didaticamente metodologia de pesquisa TARP, e
tentando resumir seus objetivos, o banco afirma, em texto dirigido aos
funcionrios, que aquela pesquisa: "Analisa lealdade dos clientes (...).
Realiza simulaes a respeito da dimenso dos lucros em risco de serem
perdidos em funo de problemas encontrados."
Fica claro, portanto, que alm de proceder ao gerenciamento da fidelidade de
seus clientes, o banco gerencia as ameaas ao lucro, ou seja, reafirma a
perspectiva de melhoria dos resultados a partir da Qualidade.
Qualidade de vida e controle estatstico: aes essenciais para o PQT.
"Quando temos chance de fazer algo de que realmente gostamos, a satisfao
cresce em todos os aspectos." As palavras acima foram atribudas a uma
funcionria e extradas de um texto do banco sobre o "bem-estar de seus
funcionrios no trabalho e em casa" e trazem tona o tema qualidade de
vida. So feitas tmidas referncias a esse item. No se percebeu cuidado
maior em enfatiz-lo, nem na entrevista, tampouco no material escrito
coletado. Considera-se imprescindvel a maior divulgao de aes nessa
direo (desde que existam, claro), mas no se pode deixar de considerar a
possibilidade de algum erro cometido pelo autor na observao desse
particular.
Dentro de Programa de Qualidade, ou, em escala menor, dentro de um
Sistema de Garantia da Qualidade, o controle estatstico imprescindvel, o
que justifica a importncia dos indicadores (desde os estudos para a sua
definio). No foram obtidas informaes detalhadas a respeito, fato que




97


no surpreendeu, haja vista a caracterstica de diferencial estratgico de que
so revestidos os indicadores de qualidade ou a combinao deles. Todavia,
amplamente divulgada, em material didtico do banco, a quantidade de
indicadores existentes em 31/12/96: eram 383, entre os de aplicao geral
(caso dos indicadores aplicveis rede de agncias) e os de aplicao
especfica de cada rea.
Neste momento do texto, julga-se oportuno resgatar a idia reinante no
Banco E, de que os Sistemas de Garantia da Qualidade, nos moldes ISO
9000, so grandes contribuintes para o atingimento das metas de Qualidade.
Interessante notar, ainda, que os custos sobre implantao dos referidos
sistemas so realizados por demanda. Assim, os executivos manifestam seu
interesse na adequao dos processos que gerenciam s citadas normas e,
desde que sejam atendidos os critrios da empresa, recebero adequado
treinamento.
Finalmente, das observaes realizadas no Banco E, depreendeu-se que:
i. o banco trata dos Sistemas de Garantia da Qualidade e de sua
certificao de conformidade com os padres ISO 9000 como
componente extremamente importante de um conjunto de aes para
atingir a Qualidade Total;
ii. atribuda grande importncia ao investimento na implementao de
tais sistemas;
iii. o lucro da empresa no assunto pouco importante, muito menos
esquecido, quando o banco cuida de seus sistemas, ou, mais
genericamente, de seu programa da qualidade. Ao contrrio, existem
aes no sentido de preservar e aumentar a lucratividade da empresa;




98


iv. a cultura da empresa propcia concretizao dos ideais da
Qualidade, mas apresenta consistncia aqum da desejvel. Tal fato
uma ameaa em ambiente interno, no que se refere a planejamento
estratgico;
v. os custos representam alvos de observao e gerenciamento. H
esforos empreendidos e com significativos resultados a favor dos
interesses dos clientes, funcionrios e acionistas;
vi. mantido o comprometimento da administrao superior (que se
manifesta em discursos e aes) claramente demonstrado, podem-se
esperar reflexos positivos nas finanas da empresa.
50


Aps esse exemplo, ser iniciada a discusso terica acerca da cincia da
Terminologia, buscando-se, inicialmente, apresentar as vrias perspectivas da pesquisa
terminolgica seguida da importncia dessa cincia no mundo atual. Depois, ser especificada
a modalidade dessa pesquisa terminolgica. Ser dado, na seqncia, um apanhado histrico
sobre a tipologia de dicionrios a fim de se explicar porque da opo no ttulo de dicionrio
terminolgico e no glossrio. Como parte dessa estratgia, ser elaborada uma parte que
contemple as informaes pertinentes acerca da macroestrutura, microestrutura e o sistema de
remissivas de um dicionrio como esse. Ser buscado, ainda, um suporte terico que permita a
caracterizao dessa lngua de especialidade, a partir da apresentao de seu mapa conceptual,
como complementao ao j realizado em relao teoria administrativa. Para finalizar esta



50
ALMEIDA, R. C. de. Bancos, sistemas da qualidade e resultados: um estudo no Brasil, 1998, p. 70-77.




99


parte terica, sero apresentadas as possibilidades de formao de UCEs oriundas de traduo
que a lngua portuguesa oferece a seus usurios especializados e ser tocada a questo do
texto definicional. O Captulo III apresentar os aspectos metodolgicos utilizados nesta
pesquisa e, em seguida, no Captulo IV, ter vez o dicionrio propriamente dito, denominado
de parte prtica desta pesquisa. Sero retomadas, no Captulo V, todas as questes levantadas
durante a exposio da pesquisa com suas respectivas respostas e, para encerrar, sero trazidas
as referncias bibliogrficas.





















100


II. FUNDAMENTOS TERICOS
II.1. As vrias perspectivas da pesquisa terminolgica
O pensar terminolgico surge em um sentido pleno a partir da primeira metade do
sculo XX. O marco inicial desta cincia deve ser atribudo ao engenheiro austraco E. Wster
(1898-1977), considerado como o maior representante de um grupo de estudiosos dessa
disciplina, a Escola de Viena, que, em 1931, apresenta Universidade Tcnica de Stuttgart, na
Alemanha, sua Tese de Doutorado intitulada A normalizao internacianal da terminologia
tcnica. Neste estudo, Wster demonstra preocupaes metodolgicas e normativas, expe os
princpios que devem presidir os trabalhos relativos ao estudo das UCEs e esboa as grandes
linhas da metodologia referentes aos bancos de dados terminolgicos.
51
Estas idias, e outras
desenvolvidas em trabalhos posteriores, vieram a constituir a Teoria Geral da Terminologia
(TGT), que at hoje influencia a elaborao de trabalhos terminolgicos e produtos
terminogrficos.
Esta primeira perspectiva da pesquisa terminolgica foi fundada em princpios que
poderiam corresponder a uma disciplina autnoma, e definida como um campo prprio de
relao entre as cincias das coisas e outras disciplinas como a lingstica, a lgica, a
ontologia e a informtica, cuja vocao est associada misso de controlar e harmonizar os
usos terminolgicos em mbito global. Conseqentemente, assume um carter metodolgico,
de natureza prescritiva e normalizadora, em detrimento da apreenso quanto aos modos de
funcionamento dos lxicos especializados.
Embora preocupadas com a preciso conceitual, a Escola de Viena e a TGT no
deixaram de reconhecer a face lingstica da terminologia. Tanto assim que, alm da cincia

51
Cf. ALVES, I. M. Terminologia: um percurso histrico, 2000, p. 2.




101


da linguagem integrar a interdisciplinaridade com que Wster concebeu essa rea do
conhecimento, tambm a considerou como um ramo da Lingstica Aplicada. Tal
reconhecimento, como assevera Krieger,
52
"reflete-se no quadro de apreenso dos
mecanismos de funcionamento dos termos, em especial, quando faz referncia s noes de
monovalncia ou de univocidade". De acordo com Wster, citado por ela:

...um termo unvoco ou monovalente um termo que, em um contexto de
discurso determinado, apenas tem um significado atual, embora possa ser
polissmico. Por contexto de discurso preciso entender, ou bem o contexto
da frase, ou bem a situao de discurso determinada pelas circunstncias. A
distino entre, por uma parte, a monossemia, e por outra, a monovalncia,
ou univocidade em sentido estrito, permite limitar a exigncia terica da
monossemia em terminologia a uma nica condio econmica: que os
termos sejam monovalentes, sem serem necessariamente monossmicos.
53


Estas concepes so produtivas para se reconhecer o estatuto terminolgico de uma
unidade lexical, um dos maiores problemas com que se defronta a pesquisa terminolgica.
Nesse sentido, inegvel a contribuio da TGT para o estabelecimento dos princpios
iniciais que permitiram o desenvolvimento dos estudos tericos e aplicados da rea em
questo. No entanto, a TGT no ampliou seu poder explicativo, consolidando-se somente
aquelas orientaes metodolgicas necessrias produo terminogrfica: a essncia dos
conceitos e da formao dos conceitos, as caractersticas dos conceitos, as relaes dos
conceitos dentro dos sistemas conceituais, a descrio dos conceitos (mediante definies), a

52
Cf. KRIEGER, M. da G. Terminologia revisitada. In: Temas de terminologia, 2001, p. 49.
53
KRIEGER, M. da G. Op. Cit., p. 49.




102


atribuio de UCEs e conceitos ou bem de conceitos e UCEs, a essncia das UCEs e a sua
formao.
Da mesma forma, se sobrepuseram as concepes normativas que auxiliaram a
expandir e a consolidar a organizao internacional da terminologia, sob a feio de uma
linguagem normatizada e, no por acaso, as regras da International Organization for
Standardization (ISO), determinadas por seu Comit Tcnico de Terminologia, o Comit
Tcnico 37, denominado Terminologia: princpios e coordenao, nascem sob a influncia e
mantm-se em consonncia com os propsitos dessa primeira perspectiva da pesquisa
terminolgica, ou seja, a Teoria Geral da Terminologia.
Por mais que esta teoria possa ser criticada, uma vez que seus limites expressam o
apagamento dos aspectos comunicativos e pragmticos, inerentes aos lxicos das linguagens
especializadas, o que caracteriza um forte reducionismo diante do funcionamento da
linguagem, sua importncia inegvel, pois, a partir dela, outras perspectivas puderam ser
formalizadas tanto terica como pragmaticamente.
Com base nesta possibilidade, a partir da dcada de 60 do sculo XX, ocorre a
estruturao do trabalho terminolgico, devido, entre outras razes, ao desenvolvimento da
informtica, que possibilitou a criao dos primeiros bancos de dados terminolgicos, incio
de projetos de planificao lingstica em vrios pases ou comunidades lingsticas,
desenvolvimento crescente das cincias e das tcnicas e incremento das relaes
internacionais, o que levou organismos de diferentes naturezas busca de cooperao e de
intercmbios.
Em relao a esses aspectos, ser abordado aquele referente planificao lingstica,
como exemplo de uma outra perspectiva da pesquisa terminolgica. Entre os vrios pases que




103


passaram ou passam por essa experincia, ser dada especial ateno ao que ocorreu no
Canad, o que acabou gerando a chamada Escola Canadense de Terminologia.
Segundo Anna Maria Becker Maciel,
54
antes de ser propriamente uma corrente que
desenvolve pesquisa epistemolgica original, a Escola Canadense de Terminologia constitui-
se em um conjunto de bases terico-metodolgicas que, postas em prtica na coleta e
divulgao de terminologias, foi gradativamente se modificando e assumindo uma feio
prpria. Esta transformao decorreu da reflexo terica e da investigao cientfica
empreendida por ncleos de estudo localizados principalmente nas universidades de Montral
e Laval, na Provncia do Qubec e na Universidade de Moncton, na Provncia de Nova
Brunswick.
De uma atividade essencialmente pragmtica, visando satisfazer exigncias da prtica
profissional do tradutor, transformou-se em atividade cientfica de uma rea multidisciplinar
de estudos, voltada para a pesquisa lingstica. Como acontece em todos os pases em que se
desenvolve a terminologia como rea de estudos, no Canad essa atividade fruto da
conjugao de vrios fatores, relacionados ao contexto da situao sociopoltica particular de
um pas oficialmente bilnge, no qual uma lngua minoritria, o francs, luta pela
sobrevivncia.
O desenvolvimento dessa pesquisa, portanto, deu-se por meio da traduo de uma
lngua para outra, no caso, do ingls para o francs e vice-versa. A traduo no pas
imperiosa, no s para a realizao das atividades econmicas, como para a administrao e o
bom entendimento dos cidados em todos os setores da vida pblica. Decorre da urgncia da


54
Cf. MACIEL, A. M. B. A terminologia canadense na viso de uma pesquisadora brasileira. In: Terminologia e
ensino de segunda lngua: Canad e Brasil, 2001, p. 45-53.




104


traduo de textos dos mais diversos ramos e especialidades diferentes. Tais textos so
sempre ricos em UCEs especficas, muitas vezes no existentes na lngua alvo. Essas lacunas
determinaram a criao de neologismos de tal sorte que a pesquisa neolgica e a investigao
lingstica relativa ao uso dos formantes de UCEs novas era atividade prioritria dos
laboratrios de terminologia.
Nesse contexto, pode-se distinguir na terminologia canadense duas fortes tendncias.
Nos primeiros desenvolvimentos, predominou a orientao normativa com base na primeira
perspectiva descrita aqui. Atualmente, a abordagem social privilegia a viso comunicativa. A
fase pioneira dos anos 70 do sculo XX caracterizava-se pela perspectiva tradutria, onde a
grande preocupao era encontrar, na lngua alvo, a UCE equivalente quela da lngua de
partida. A dcada seguinte foi marcada pela poltica lingstica. De maneira especial, o
planejamento lingstico estimulou o desenvolvimento da pesquisa em terminologias.
Finalmente, nos ltimos anos, a socioterminologia comea a florescer. Em todas as fases, no
entanto, sempre uma razo pragmtica: primeiro a traduo, depois a poltica, agora a prpria
comunicao revela-se predominante, regendo a pesquisa e determinando seus rumos.
Continuando com a descrio, aporta-se na dcada de 80 do sculo anterior, dcada
essa em que ocorre o interesse dos lingistas pela terminologia. Anteriormente a esse perodo,
lexiclogos j se dedicavam descrio neolgica das UCEs de uma lngua de especialidade,
porm, seguiam a metodologia dos estudos lexicolgicos, ou seja, elas eram descritas
morfolgica e semanticamente.
A partir de meados da dcada de 80 daquele sculo, lexiclogos e tambm tradutores e
documentalistas passam a debruar-se sobre a UCE, a unidade da terminologia, agora no
mbito de uma perspectiva propriamente terminolgica. Em cima de proposies relacionadas
a ela, foi se constituindo uma nova perspectiva da pesquisa terminolgica denominada




105


socioterminologia, j citada em relao ao Canad, mas que merece uma abordagem mais
pormenorizada.
O que se configurou foi que Wster, em seus trabalhos, enfatizava que a lingstica e a
terminologia concebiam de maneira distinta seus objetos de estudo. Assim, de acordo com os
princpios da TGT, no mbito de uma rea de especialidade deve existir uma relao unvoca
entre a UCE e seu respectivo conceito. Ela deveria ser denotativa e desprovida de relaes
sinonmicas e polissmicas.
Paralelamente a essa vertente normalizadora que preconiza, de acordo com Ieda Maria
Alves,
55
de maneira idealstica, uma relao unvoca entre a UCE, a unidade de conhecimento
especializado das lnguas de especialidade, e o conceito, o significado dessa unidade,
contrape-se uma perspectiva de carter descritivo, em que a variao e a mudana lingstica
so observadas e respeitadas. Nessa perspectiva, a relao unvoca entre uma UCE e um
conceito, pregada pela TGT, deixa de ser um pressuposto necessrio para garantir a eficcia
da comunicao. A prtica do trabalho terminolgico tem mostrado que, contrariamente ao
que prega a Escola de Viena, no existe esta relao unvoca entre UCE e conceito. A UCE,
signo lingstico, est sujeita a variaes como as demais unidades da lngua e tece relaes
de carter sinonmico, antonmico e polissmico com outras UCEs.
Essa ltima vertente ou perspectiva trabalha com a observao dos dados e considera
que, tanto quanto na lngua geral, as lnguas de especialidade so sujeitas a variaes e a
relaes sinonmicas e polissmicas. Um mesmo conceito pode ser expresso por UCEs que


55
Cf. ALVES, I. M. Op. Cit., p. 4.




106


apresentam variaes no apenas morfolgicas ou grficas, mas tambm regionais e
socioprofissionais. Assim, a terminologia torna-se, na verdade, uma socioterminologia, que
retrata a relao que a terminologia estabelece com a sociolingstica.
Dessa forma, Teoria Geral da Terminologia tem-se oposto a terminologia de carter
variacional, relativa tanto ao conceito quanto UCE, que tambm leva em conta a dimenso
textual e discursiva das UCEs. So propostos, nesta perspectiva terica, alguns princpios e
fundamentos que geraram a chamada Teoria Comunicativa da Terminologia (TCT), cujo
maior exponte Maria Teresa Cabr, da Escola Ibrica de Terminologia. Estes princpios so
os seguintes:

1. A TCT no concebe a terminologia como uma matria autnoma; ao
contrrio, concebe-a com carter interdisciplinar, que deve ser
explicitado dentro de uma teoria da linguagem que, por sua vez, insere-
se na teoria da comunicao e do conhecimento. Essa teoria da
linguagem inclui aspectos propriamente lingsticos, cognitivos e
sociais.
2. A TCT deve explicar a interdisciplinaridade das unidades de
conhecimento especializado e dar conta da diversidade de vises que
dela tm os diferentes especialistas implicados. Por isso, concebe as
unidades terminolgicas como unidades polidricas integradas pelos trs
aspectos disciplinares (lingsticos, cognitivos e sociais) que as
descrevem.
3. Deve dar conta de como um conceito pode fazer parte da estrutura
conceitual de distintas disciplinas, o que no desconsidera o fato de que
um termo pode ser inicialmente empregado no mbito de uma




107


especialidade ou transferido de uma rea de especialidade para outra ou
ainda da lngua geral para uma lngua de especialidade.
4. Assume o carter polissmico dos termos, de modo que considera a
possibilidade de divulgao de unidades especializadas em um
determinado momento, de terminologizao contnua de unidades da
lngua geral e ainda de entrada constante de termos de um mbito de
especialidade em outro mbito (pluriterminologizao).
5. Admite a sinonmia como um fenmeno real dentro da comunicao
especializada.
6. Deve levar em conta que as unidades terminolgicas processam-se de
maneira natural no discurso e, conseqentemente, apresentam uma
projeo sinttica que vai alm dos limites denominativos e variam em
funo do discurso.
7. Contempla a variao do discurso e estabelece as variveis que
descrevem essa variao no mbito da comunicao em geral e da
comunicao especializada, em particular.
56


Com base nesses princpios, a TCT vem abrindo caminhos consistentes para o fazer
terminogrfico, a partir dessa inovao no pensar terminolgico, assumindo necessariamente
a diversificao discursiva em funo da temtica, do tipo de emissor, dos destinatrios, do
nvel de especializao, do grau de formalidade, do tipo de situao, da finalidade, do tipo de
discurso, entre outros.
Embora distantes, vale mencionar ainda, como outras perspectivas da pesquisa
terminolgica, a chamada Escola Alem de Terminologia, que tem se preocupado em

56
ALVES, I. M. Op. Cit., p. 4-5.




108


pesquisar a linguagem especializada em conjunto com a lingstica textual, com o intuito de
levantar aspectos textuais, sintticos e lexicais e outros fatores extralingsticos, e a Escola
Russa de Terminologia, que estabelece relaes entre lexis e logos. De qualquer forma, vale
mencionar que a cincia da Terminologia encontra-se em um perodo de renovao e que
novas perspectivas ainda podero surgir para dar conta das complexas relaes que
acompanham o mundo globalizado atual.
No Brasil, de maneira anloga ao que ocorreu em vrios pases, a Terminologia
comeou a desenvolver-se e a ser praticada de maneira sistemtica a partir de meados da
dcada de 80 do sculo XX. Embora ainda no tenha produzido uma teoria prpria relativa s
especificidades de um pas em desenvolvimento, o Brasil tem participado ativamente de
comisses e associaes internacionais, como a Subcomisso de Terminologia do Mercosul, a
Rede Iberoamericana de Terminologia (RITerm) e a Rede Panlatina de Terminologia
(Realiter).
Internamente, do ponto de vista da formao em Terminologia, alguns cursos
dedicados ao ensino da traduo j introduziram essa disciplina; no entanto, sobretudo nos
Cursos de Ps-Graduao em Lingstica e em Filologia e Lngua Portuguesa que ela tem
encontrado seu espao. Incialmente introduzida em universidades onde as disciplinas
Lexicologia e Lexicografia eram ministradas, como a Universidade de So Paulo, a
Universidade de Braslia, a Universidade Federal do Rio Grande do Sul, a Universidade
Estadual Paulista de Araraquara e a Universidade Federal de Pernambuco, posteriormente,
aps a formao dos propagadores, a mesma passou a ser oferecida tambm na Universidade
Estadual do Cear, na Universidade Federal de Uberlndia, na Universidade Estadual Paulista
de Assis e So Jos do Rio Preto, entre outras.




109


Internamente tambm, agora do ponto de vista dos diversos setores profissionais,
movidos pela necessidade de comunicao mais eficaz, a Terminologia tem sido praticada
entre tradutores e documentalistas, nas indstrias e nos servios. Os produtos resultantes dessa
necessidade so diversos e apresentam-se sob diversas formas para atenderem a diferentes
objetivos. De acordo com Danilo Alves da Cunha,
57
no mbito empresarial, a Terminologia
tem sido praticada, com finalidade normativa, entre os membros das comisses de
terminologia criadas pela Associao Brasileira de Normas Tcnicas (ABNT). Essas normas,
juntamente com as normas de procedimento, de especificaes, de mtodo de ensaio, de
padronizao, de simbologia e de classificao integram o conjunto de normas elaborado
pelos especialistas das mais diversas reas vinculadas aos comits da Associao.


II.1.1. A importncia da terminologia no mundo atual
No item I.1. desta Tese, quando foi abordada a questo referente escolha do tema, foi
citado um depoimento de um usurio que se dizia contente por ter disposio as informaes
disponibilizadas no website (vide p. 19-20) que teriam para ele uma grande aplicabilidade. Ele
dizia que iria elaborar uma cartilha bsica com as informaes do primeiro dicionrio l
apresentadas que seriam teis para o treinamento/conscientizao de seus colaboradores. Esse
relato voltou novamente, pois a inteno aqui tecer algumas consideraes sobre a
importncia da terminologia no mundo atual.
Desde o advento dessa cincia e, principalmente, a partir de sua estruturao nos anos
80 do sculo XX no Brasil, o mundo tem passado por situaes contraditrias com grandes

57
Cf. CUNHA, D. A. da. Aspectos do trabalho terminolgico na empresa. Cad. de terminologia, 1996, p. 47-56.




110


avanos tecnolgicos. A cincia e a tecnologia no se restringem mais a grandes laboratrios,
mas, ao contrrio, esto presentes em nosso dia-a-dia, nos mais diferentes matizes, ou seja,
desde informaes tcnicas sobre a exploso de um nibus espacial, passando por uma
terminologia forjada no bojo da guerra, at questes difceis de serem entendidas, como a
preveno que deve ser realizada para se evitar a contaminao de uma nova pneumonia que
surgiu na sia e tem se alastrado pelo mundo globalizado devido, mais uma vez, aos milhes
de cidados que atravessam fronteiras diariamente. Isso sem mencionar as possibilidades
fantsticas que o mundo virtual disponibiliza por meio da Internet.
Dessa forma, a cincia e a tecnologia tomam parte de nossa existncia. Com essa
interferncia direta, a lngua deve estar apta para nomear novos referentes e novos conceitos,
a ponto de ser eficaz comunicativamente. As lnguas especializadas, por sua vez, juntamente
com o suporte prtico e terico da Terminologia, passam a ser importantes para legitimar a
funo real de uma lngua como um veculo de comunicao tambm em situaes
especializadas.
fato, pois, que em um uso informal da linguagem, no h essa preocupao com a
preciso terminolgica; no entanto, tratando-se de uso especializado, essa preciso
fundamental, ainda mais em relao aos contatos entre cidados de pases cujas lnguas sejam
diferentes. De acordo com Francis Henrik Aubert:

...no caso especfico do trabalho terminolgico, a criao neolgica e o
reordenamento conceptual e denominativo que caracterizam os esforos de
padronizao das linguagens de especialidade fazem-se possveis com base
nas virtualidades do cdigo lingstico e na instabilidade desses mesmos
cdigos. Esses dois fatores facultam no apenas a criao por assim dizer




111


nativa, isto , empregando elementos presentes no prprio cdigo, como
tambm a insero de elementos de origem externa a esse cdigo
(emprstimos, decalques e tradues literais a partir de outras matrizes
lingsticas: ingls, francs, grego, latim, etc.) Mas os aspectos atinentes
natureza scio-histrica das lnguas colocam o problema da aceitabilidade
dessa criao e desse reordenamento. A comunidade de usurios das
linguagens de especialidade, tanto quanto a comunidade e a lngua em geral,
no constitui um todo uniforme, mas se subdivide em grupos variados, com
necessidades, pressupostos e motivaes tambm variados.
58


Com esta constatao, esses avanos cientficos e tecnolgicos precisam ser nomeados
apropriadamente. As UCEs constituintes de uma rea especializada refletem a estrutura
conceitual dessa rea e so a base da comunicao especializada. Tratando-se de nveis
socioculturais divergentes, o produto terminogrfico pode preencher a lacuna e facilitar a
propagao dessas novas unidades lxicas forjadas pelas necessidades de seus usurios
especializados, facilitando, assim, os intercmbios econmico e tecnolgico. Ainda de acordo
com Aubert,
59
observa-se, com efeito, uma crescente necessidade de maior preciso no
trabalho terminolgico, visto que as terminologias constituem a base: i. do ordenamento do
conhecimento; ii. da transferncia de conhecimentos; iii. da formulao e disseminao de
informaes especializadas; iv. da transferncia de textos cientficos para outros idiomas; v.
da armazenagem e recuperao de informao especializada.

58
AUBERT, F. H. Lngua como estrutura e como fato histrico-social: conseqncias para a terminologia.
Cadernos de terminologia, 1996, p.13.
59
Cf. AUBERT, F. H. Introduo metodologia da pesquisa terminolgica bilnge. Cadernos de terminologia,
1996, p. 25.




112


Portanto, a utilizao de terminologias sistematizadas contribui para a eficcia da
comunicao entre especialistas, que deve ser concisa, precisa e adequada. Por outro lado, a
necessidade de sistematizar ou harmonizar terminologias deve partir do prprio grupo de
especialistas. De acordo com Gladis Barcellos Almeida,

A vontade de entender o outro e de fazer-se entender condicionada
necessidade de comunicar-se de maneira unvoca e rigorosa, sobretudo em
situaes em que a preciso mais importante que a expressividade (Cabr,
1996a, p. 13), faz com que determinado domnio de especialidade,
representado por grupos de especialistas, busque solues para tornar mais
eficaz a comunicao. Tais solues podem ser:
a) a confeco de glossrios ou vocabulrios, muitas vezes disponibilizados
na internet;
b) a integrao desses especialistas em comits de normalizao da
Associao Brasileira de Normas Tcnicas (doravante ABNT);
c) a tentativa dos prprios especialistas de traduzirem dicionrios da rea j
existentes em outros idiomas;
d) ou vrias dessas solues simultaneamente.
60


Sistematizar terminologias significa criar UCEs confiveis de forma a facilitar a tarefa
do tradutor, como tambm demonstrar que a lngua portuguesa est apta para nomear
conceitos tcnicos e cientficos, o que se tentar provar aqui em relao GQT em servios.
Assim, necessidade de natureza lingstica soma-se outra de natureza poltica, uma vez que
os fatos poltico-econmicos tm demonstrado a importncia da integrao no mundo atual,

60
ALMEIDA, G. M. de B. Teoria comunicativa da terminologia (TCT): uma aplicao, 2000, p. 22.




113


haja vista o surgimento de uma srie de blocos econmicos existentes e que viro a existir e
propostas de cooperao tcnica e cientfica entre os mais diferentes pases, como o Brasil e a
China em relao ao lanamento de satlites de comunicao.
Este tipo de cooperao remete questo do nacionalismo em oposio globalizao,
igualmente importante para a cincia da Terminologia e preocupao da planificao
lingstica. Ainda de acordo com Gladis B. de Almeida,

Nacionalismo porque, justamente pelo fato de a integrao homogeneizar
muitas marcas culturais, o desejo de manter o que se tem de mais genuno,
mais autntico, aflora com mais veemncia; e como a lngua o meio mais
perceptvel de expressar e afirmar uma cultura, a lngua passa a ser um bem
de preservao.
E globalizao porque, a despeito das diferenas culturais, h a necessidade
de as naes relacionarem-se economicamente e de participarem do mercado
mundial. E, neste aspecto, a lngua uma pea indispensvel, j que
atravs dela que ocorrem os intercmbios econmicos e tecnolgicos. Neste
sentido, a lngua passa a funcionar como veculo de difuso.
61


Entendendo-se a lngua como bem de preservao e como veculo de difuso, a
importncia da pesquisa terminolgica crucial, alm de til e eficaz. De acordo com Enilde
Faulstich,

...na base da internacionalizao das trocas polticas e econmicas
encontram-se os grandes Mercados e natural que estes exeram um

61
ALMEIDA, G. M. de B. Op. Cit., p. 23-24.




114


impacto real na dinmica das lnguas. Um dos sistemas mais permeveis s
modificaes o lexical, seja na lngua comum, seja nas lnguas de
especialidade. Sob a perspectiva do uso social da lngua, as lnguas de
especialidade so campos frteis para a criao e a difuso ou para a adoo
e difuso de terminologias.
62


justamente neste aspecto que se pode caracterizar a importncia da Terminologia no
mundo atual, ou seja, trata-se de criar e/ou adotar e difundir as linguagens especializadas.
Nesse sentido, cabe destacar que, com o advento das vrias perspectivas da pesquisa
terminolgica, esta importncia est relacionada terminologia descritiva em oposio
terminologia normativa, pois apenas aquela possui mtodos de trabalho capazes de dar conta
do desafio que se apresenta: sistematizar terminologias com o intuito de facilitar a
comunicao intra e interlnguas, ao mesmo tempo em que se preocupa em criar mecanismos
que preservem e difundam a lngua nacional.


II.2. Modalidades do trabalho terminolgico
II.2.1. Tipologia de dicionrios
O dicionrio sempre o produto de uma investigao lexicogrfica ou
terminogrfica. Essa prtica muito antiga em se tratando de lngua geral. No mbito
da lngua de especialidade, relativamente recente, pois apenas surge conscientemente
quando preciso denominar um conjunto de conceitos para conhecer, reconhecer e

62
Cf. FAULSTICH, E. Terminologia: cooperao e intercmbio. In: Jornada Panllatina de Terminologia, 1996,
p. 38.





115


manipular fatos lingsticos. Nesse sentido, so nos pases desenvolvidos ou em
desenvolvimento que essa necessidade mais premente.
Pode-se distinguir formas diferentes de dicionrios: o dicionrio como obra e o
dicionrio como instrumento. Os mais antigos so denominados glossrios e serviram
para a compreenso de textos bem determinados com vistas ao entendimento dos
mesmos. Em seguida, pode-se estabelecer uma distino entre dicionrios monolnges
e bilnges, para a aprendizagem de uma lngua estrangeira. Pode-se contar tambm
com os dicionrios plurilnges que, normalmente, apresentam apenas a
correspondente unidade lexical na lngua de chegada. O dicionrio monolnge surgiu
no sculo XVII e visava finalidade de reduzir os mltiplos dialetos de uma
determinada lngua com base em seus autores clssicos literrios. Sculos aps,
percebe-se que esses dicionrios tornaram-se to normativos e importantes que foram
denominados dicionrios de autoridade, publicados pelas Academias dos diversos
pases europeus a partir do Renascimento.
Ainda na Europa, o sculo XVIII pode ser caracterizado como o sculo das
grandes enciclopdias, que visavam a uma informao exaustiva e podiam ser
consideradas como dicionrios de coisas se os demais fossem nomeados como
dicionrios de palavras. A produo foi to intensa que seria exaustivo mencion-la
por completo. Fica registrado, no entanto,

...que essas obras no eram s destinadas ao Iluminismo, mas ainda
para satisfazer s crescentes necessidades de classificao das cincias
em florescimento. Evidentemente, nestas enciclopdias no s se
explicam coisas e fatos, mas ainda palavras e conceitos, pelo que




116


registramos, na nossa pequena histria dos dicionrios, o dicionrio
enciclopdico como um tipo prprio.
63


No sculo XIX, com o surgimento da lingstica, originou-se uma nova
motivao no campo dos dicionrios. Surge o que se pode nomear de dicionrio
histrico que se destinava a mostrar a lngua como um organismo que se desenvolve,
ao modo de um ser vivo, desde a origem at o presente. Esse tipo de dicionrio
originou, por sua vez, os chamados dicionrios histrico-filosficos.
No sculo XX, surge a maior empresa, a mais volumosa e custosa de toda a
histria dos dicionrios.

o chamado dicionrio-tesouro que, pela sua concepo, corresponde
com toda a evidncia aos grandes dicionrios de corpus das lnguas
clssicas e guarda tambm uma certa relao de tradio com o tipo do
dicionrio histrico-filosfico, mas encarna simultaneamente, e em
boa tradio francesa, o tipo do dicionrio autoritativo.
64


Apesar de empreitada to trabalhosa, no este o tipo de dicionrio
representativo do sculo XX. necessrio, para tal, que ele d toda uma srie de
indicaes referentes pronncia, gramtica e ao significado das palavras,
constituindo no seu conjunto um dicionrio muito conciso e compacto, capaz de
satisfazer assim a todas as necessidades de seu usurio final, seja em qual nvel de
entendimento ele esteja.

63
HEINREICH, H. Problemas de lexicologia e lexicografia, 1979, p. 318.
64
HEINREICH, H. Op. Cit., p. 318.




117


Depois dessa curta retrospectiva em que j foram comentados os dicionrios de
autoridades, enciclopdicos, histrico-filosficos, dicionrio-tesouro, a inteno,
agora, tentar inferir o que vem a ser a carga significativa desta unidade de
conhecimento especializado dicionrio e os critrios que possam auxiliar em sua
tipologia no apenas semntica.
No h ainda uma unanimidade quanto designao dos produtos
lexicogrficos e terminogrficos e suas caractersticas intrnsecas, pois fala-se em
dicionrio, vocabulrio e glossrio sem as necessrias distines. O que h, na
verdade, uma pluralidade de denominaes para um mesmo conceito de obra e,
inversamente, pluralidade de conceitos para uma mesma denominao. O que se
buscar, agora, tentar inverter esta tendncia e, na medida do possvel, desfazer a
confuso que se deve, entre outros aspectos, ao uso arbitrrio destas denominaes por
parte dos distintos autores ou editoras e, at certo ponto, moda das distintas pocas.
De acordo com a Norma ISO 1087, citada por Maria Aparecida Barbosa,
65
os
repertrios de UCEs so assim definidos:

6.2.1. dictionary: Structured collection of lexical units with linguistic
information about each of them/6.2.1. dictionnaire: rpertoire
structur d'units lexicales comportant des informations linguistiques
sur chacune d'entre elles;
6.2.1.1. terminological dictionary (admitted term: technical
dictionary): Dictionary (6.2.1.) containing terminological data
(6.1.5.) from one or more specific subject fields (2.2.)/6.2.1.1.

65
Cf. BARBOSA, M. A. Dicionrio, vocabulrio, glossrio: concepes. In: ALVES, I. M. (Org.). A
constituio da normalizao terminolgica no Brasil, 1996, p. 23-45.




118


dictionnaire terminologique (terme tolr: dictionnaire technique):
Dictionnaire (6.2.1.) qui comprend des donns terminologiques
(6.1.5.) relatives un ou plusieurs domaines (2.2.) particuliers;
6.2.1.1.1. vocabulary (admitted term: glossary: Terminological
dictionary (6.2.1.1.) containing the terminology (5.1.) of a specific
subject field (2.2.) or of related subject fields and based on
terminology work (8.2.)/vocabulaire: Dictionnaire terminologique
(6.2.1.1.) bas sur un travail terminologique (8.2.), qui prsente la
terminologie (5.1.) particulire ou de domaines (2.2.) associs.
66


No entanto, instalada pela Associao Brasileira de Normas Tcnicas (ABNT) e
pelo Instituto Brasileiro de Informao em Cincia e Tecnologia (IBICT), em 26 de
junho de 1992, estes mesmos verbetes foram assim traduzidos por um dos Grupos da
Comisso de Estudo Especial Temporria de Terminologia (CEETT), que tinha como
objetivo desenvolver normas sistmicas de terminologia, de acordo com a orientao
do TC 37 da International Organization for Standardization (ISO):

6.2.1. Dicionrio: Repertrio estruturado de unidades lexicais
contendo informaes lingsticas sobre cada uma dessas unidades.
6.2.1.1. Dicionrio terminolgico (termo tolerado: dicionrio
tcnico): Dicionrio (6.2.1.) que compreende dados terminolgicos
(6.1.5.) relativos a um ou a vrios domnios (2.2.) particulares.

66
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION. Terminologie - vocabulaire: (ISO
1087), 1990.




119


6.2.1.1.1. Vocabulrio: Dicionrio terminolgico (6.2.1.1.) baseado
num trabalho terminolgico (8.2.) que apresenta terminologia (5.1.) de
um domnio (2.2.) particular ou de domnios (2.2.) associados.
67


Houve, aps essa publicao, uma reviso conceitual realizada pela Comisso
que alterou, entre outros conceitos, o 6.2.1.1.1., que, de vocabulrio, passou a
glossrio, com o termo tolerado sendo vocabulrio.
J para Boutin-Quesnel et al., tambm citado por Maria Aparecida Barbosa, as
UCEs examinadas foram definidas da seguinte forma:

3.1.1. dictionnaire Rpertoire d'units lexicales que contient des
informations de nature smantique, notionnelle, rfrentielle,
grammaticale ou phontique.
3.1.1.1. dictionnaire de langue Dictionnaire que contient des
informations smantiques, grammaticales et phontiques sur les units
lexicales d'une langue.
3.1.1.1.3. dictionnaire spcial Dictionnaire de langue qui dcrit des
units lexicales slectionnes pour certaines de leurs caractristiques.
Ex.: dictionnaire de synonymes; dictionnaire d'argot, dictionnaire
phontique. (...)
3.1.1.7. dictionnaire terminologique Dictionnaire qui prsente la
terminologie d'un ou de plusieurs domaines. Note - Un dictionnaire
terminologique qui traite d'un seul domaine comporte gnralement un
haut degr d'exhaustivit.

67
BARBOSA, M. A. Op. Cit., p. 27.




120


3.1.2. vocabulaire Rpertoire qui inventoi les termes d'un domaine, et
qui dcrit les notions dsignes par ces termes au moyen de
dfinitions ou d'illustrations. (...)
3.1.4. glossaire Rpertoire qui dfinit ou explique de termes anciens,
rares ou mal connus.
68


Por outro lado, em Maria Teresa da Fonseca Lino, mais uma vez citada em
Maria Aparecida Barbosa, encontram-se as seguintes definies:

2. DICIONRIO I dictionary F dictionnaire
Classificao: Lexicografia Terminografia
Definio: Repertrio estruturado de unidades lexicais, contendo
informaes lingsticas de natureza semntica, nocional, referencial,
gramatical ou fontica, sobre cada uma delas.
DICIONRIO TERMINOLGICO I terminological dictionary F
dictionnaire terminologique Sinnimo dicionrio tcnico
Classificao: Lexicografia Terminografia
Definio: Dicionrio que apresenta os dados terminolgicos relativos
a um ou vrios domnios (Idem).
GLOSSRIO I glossary F glossaire
Termos relacionados: dicionrio vocabulrio
Classificao: Lexicologia Lexicografia
Definio: Denomina-se glossrio um dicionrio que contm, sob


68
BARBOSA, M. A. Op. Cit., p. 29.




121


forma de simples definies (ou tradues), as significaes das
palavras raras ou pouco conhecidas. (Idem).
2. VOCABULRIO I vocabulary F vocabulaire
Classificao: Terminologia Terminografia
Definio: Dicionrio terminolgico, baseado num trabalho
terminolgico que apresenta a terminologia de um domnio particular
ou de domnios associados. (Idem).
VOCABULRIO CIENTFICO I - F vocabulaire scientifique
Termos relacionados: lngua cientfica, lngua de especialidade,
terminologia
Classificao: Lexicologia Lexicografia
Definio: Conjunto de unidades lexicais (ou termos), prprias a um
domnio cientfico, que so utilizadas por um grupos sociocultural e
profissional. (Idem).
69


Boulanger, por sua vez, ao ser citado em Maria Aparecida Barbosa, prope as
seguintes definies:

2. Le dicitionnaire "Dfinition gnrale Rpertoire de signes, prsent
dans une, deux ou plusieurs langues, rangs dans un ordre convenu
(alphabtique, systmatique, mixte) et donnant une srie
d'informations linguistiques de nature fonctionnelle (prononciation,
orthographe, sens...) ou une srie d'informations de nature
conceptuelle sur les units-signes qui sont l'objet d'une entre". (...)

69
BARBOSA, M. A. Op. Cit., p. 30.




122


*Vocabulaire "Dictionnaire terminologique monolingue, bilingue ou
multilingue qui inventorie les termes essentiels relatifs un
technolecte (science, technique, art...), qui les prsente en ordre
alphabtique, systmatique ou autre, et dont la caractristique
principale est de toujours comporter une dfinition pour chaque entre
rdige dans une, deux ou plusieurs langues."
2.2. Le dictionnaire de langue (DL)
2.2.1. Le dictionnaire gnral nonolingue (DGM)
Le DGM recense des informations linguistiques fonctionnelles
(phontiques, lexicales, historiques, smantiques, grammaticales,
syntaxiques...) sur les mots d'une langue. (...)
2.2.1. Le dictionnaire spcial (DS) Le DS recense des units lexicales
selectionnes pour faire valoir une ou deux caractristiques
spcifiques au plan fonctionnel ou smantique. L'information fournie
est toujours du mme type, contrairement au DGM et au DL.
70


Para finalizar, Enilde Faulstich, tambm citada em Maria Aparecida Barbosa,
assim se posiciona em relao concepo desses tipos de obras, do ponto de vista da
socioterminologia:

8.13. vocabulrio Repertrio que inventoria os termos de um domnio
e que descreve os conceitos designados por esses termos por meio de
definies ou de ilustraes

70
BARBOSA, M. A. Op. Cit., p. 31.




123


8.21.1. glossrio Repertrio que define termos de uma rea cientfica
ou tcnica, dispostos em ordem alfabtica, podendo apresentar ou no
remissivas.
8.21.2. Repertrio em que os termos, normalmente de uma rea, so
apresentados em ordem sistemtica, acompanhados de informao
gramatical, definio, remissivas, podendo apresentar ou no contexto
de ocorrncia.
8.21.3. Repertrio em que os termos so apresentados em ordem
alfabtica ou em ordem sistemtica seguidos de informao gramatical
e do contexto de ocorrncia.
71


Dessa forma, aps todas as citaes feitas, percebe-se claramente que so
tnues as fronteiras entre um e outro tipo de texto lexicogrfico ou terminogrfico e
que no h uma relao biunvoca entre conceitos e termos, ainda que sejam
considerados numa rea bem delimitada. Segundo Maria Aparecida Barbosa,

Esses elementos parecem confirmar que, no raras vezes, obras da
mesma natureza e funo so classificadas de maneira diversa,
segundo os critrios adotados por este ou aquele autor, fato que
conduz existncia de numerosas denominaes para o mesmo ncleo
conceptual obra lexicogrfica/terminogrfica. Parece confirmar, ainda,
de outro ponto de vista, a existncia de conceitos muito diferentes
para uma mesma denominao. Da decorre, complementarmente, que
um mesmo tipo de obra seja definido de modo diverso por diferentes

71
BARBOSA, M. A. Op. Cit., p. 32.




124


autores e, ao mesmo tempo, tipos distintos de obras no sejam
adequadamente explicitados por um mesmo autor.
72


Nesse sentido, quanto aos trs tipos de obras acima apontadas, este trabalho
assim se posiciona: i. os chamados dicionrios de lngua processam as unidades
lexicais da lngua geral; ii. os dicionrios terminolgicos processam unidades lexicais
especializadas de uma determinada lngua de especialidade, podendo ser denominados
tambm por vocabulrios (quando a coleta no se mostrar exaustiva de uma dada rea
de especialidade) ou glossrios, como sinnimo.
A organizao de um dicionrio pode ser de carter formal (dicionrio
alfabtico) ou semntico (dicionrio conceitual). Ele um objeto cultural com uma
finalidade didtica, apresentando o lxico de uma, duas ou mais lnguas. Contm
vrios tipos de informaes culturais sobre as palavras e tem um campo semntico
muito vasto.
Quanto aos critrios para se formalizar uma tipologia dicionarstica, pode-se
adotar o critrio lingstico, mas se chegaria concluso de que apenas existe um
dicionrio que corresponda de maneira ideal a um tipo puro, dando-se com mais
freqncia tipos mistos. Se fosse adotado o critrio histrico-cultural, chegaria-se
concluso de que a criao dos diferentes tipos de obras lexicogrficas, assim como
suas denominaes, foram condicionadas pela evoluo sociocultural, por modas e
gostos, mais que por critrios terico-lingsticos. Resta, ento, que para a distino
dos diferentes tipos de dicionrios, o mais indicado seja perguntar-se, de modo

72
BARBOSA, M. A. Op. Cit., p. 32.




125


pragmtico, quais so as caractersticas que esto presentes nestas obras, aplicando-se
uma srie de critrios prticos, a saber:

... formato e extenso da obra lexicogrfica; seu carter lingstico,
enciclopdico ou misto; o sistema lingstico no qual se baseia;
nmero de lnguas; seleo do lxico (vocabulrio geral ou parcial,
codificao exaustiva ou seletiva, critrios cronolgicos, carter
prescritivo ou descritivo); ordenao dos materiais; finalidades
especficas dos dicionrios; dicionrio tradicional ou dicionrio
eletrnico.
73


Um critrio externo de classificao das obras lexicogrficas, que tem uma
importncia prtica considervel, o seu formato e extenso e, condicionado por estes,
o nmero de entradas que ter. Pode-se ter, ento, desde um glossrio de poucas
pginas at um thesaurus de muitos tomos. H dicionrio de bolso, dicionrio
enciclopdico, mas em muitos casos a finalidade de um dicionrio implica, de
antemo, uma limitao quanto sua extenso. Desse modo, pode haver dicionrios e
glossrios de formato grande com poucas pginas e outros mais reduzidos com muitas
pginas. Para se ter uma idia exata de uma obra lexicogrfica, h que se indicar seu
formato (por exemplo, 20 cm x 15 cm), o nmero de tomos, o nmero de pginas de
toda a obra (ou de cada tomo) e o nmero de entradas registradas.
74

Quanto ao carter lingstico ou enciclopdico, pode-se citar a existncia de
uma lexicografia lingstica e de uma outra denominada enciclopdica, assim como as

73
HAENSCH, G. La lexicografia. De la lingistica terica a la lexicografia prctica, 1982, p. 126.
74
HAENSCH, G. Op. Cit., p. 127.




126


possveis interferncias entre elas, a mista. A principal funo dos dicionrios
enciclopdicos consiste em informar sobre uma matria especfica e neles predomina a
informao sobre o mundo extralingstico. Eles tm, no entanto, um elemento comum
com muitos dicionrios de lngua:

Os dois do, em primeiro lugar, uma definio da voz que objeto do
artigo em questo (o lema), mas logo muda o desenvolvimento do
tema. O dicionrio de lngua d indicaes sobre todas as
peculiaridades lingsticas da voz, enquanto o dicionrio de coisas
(enciclopdico) amplia a informao sobre matrias, s vezes em
artigos bastante extensos. (...) Os dicionrios de lnguas ou dicionrios
lingsticos so repertrios de signos lingsticos cuja natureza,
significado, valores de uso e relaes paradigmticas ou sintagmticas
com outros elementos do lxico so explicados mediante uma
metalngua.
75


De qualquer modo, as interferncias entre os dois tipos so mais freqentes do
que se imagina. s vezes, quase impossvel estabelecer uma separao tangente entre
os dicionrios de lngua e os de coisas, j que o lexicgrafo tambm necessita de
informaes sobre as coisas, sobre a matria, para poder redigir dicionrios de lnguas,
sobretudo quando se trata de definir unidades de conhecimento especializado que



75
HAENSCH, G. Op. Cit., p. 129.




127


forosamente poderiam figurar em um dicionrio geral. Em outros casos, os
dicionrios lingsticos do definies enciclopdicas onde se espera uma definio
lingstica. Da poder-se falar de uma forma hbrida.
Em relao ao critrio prtico que diz respeito ao sistema lingstico em que a
obra lexicogrfica se baseia, pode-se

...distinguir aquelas em que a descrio semntica do vocabulrio
baseia-se no sistema lingstico individual do autor ou de uma equipe
de autores e outras em que a descrio semntica depende da
informao que se rene mediante o aproveitamento de um corpus
(citao de textos ou transcries de gravaes) e que , portanto,
independente do sistema lingstico individual do autor.
76


Nesse sentido, tm-se, como exemplo, para o primeiro caso, os dicionrios
feitos por equipes/editoras e, no segundo, os dicionrios de autoridades, realizados
pelas academias institucionais de um pas. Por isso, nos dicionrios terminolgicos
especializados, deve constar o sistema lingstico em que esto baseados e quais fontes
foram aproveitadas, como tambm quem criou ou utilizou primeiro uma UCE que
venha a ser normalizada. Assim, pois, tm-se, como critrios de classificao, as
fontes em que se baseiam as obras lexicogrficas e os tipos de exemplos que trazem:
exemplos documentados ou inventados.
Um outro critrio prtico de classificao das obras lexicogrficas o nmero
de lnguas que se levou em considerao na organizao do dicionrio. Produz-se,

76
HAENSCH, G. Op. Cit., p. 133.




128


ento, o dicionrio monolnge (de uma s lngua), o dicionrio plurilnge, que
subdividido em bilnge (de duas lnguas) e multilnge (com mais de duas lnguas).
Muitos dos dicionrios plurilnges no do uma descrio metalingstica e sim
apenas os equivalentes das unidades lxicas em outras lnguas.
Em relao ao critrio que diz respeito seleo do lxico, necessrio
esclarecer que apenas no ser mencionado o dicionrio terminolgico, uma vez que o
mesmo ser objeto do item posterior deste Captulo. Portanto, sero colocadas agora
algumas questes sobre o dicionrio geral.
O objeto de um dicionrio geral poderia ser a codificao do lxico de um
sistema lingstico em sua totalidade o que, reconhece-se, seria impossvel. Nem
mesmo o dicionrio geral mais volumoso poderia conter a soma de todos os
dicionrios especializados. A esse respeito, temos em Haensch:

Os grandes institutos lexicogrficos deveriam, sem dvida, aspirar a
ter um fichrio ou banco de dados eletrnico, que reunisse o mximo
de todos os vocabulrios particulares que existem. Muitos dicionrios,
ainda que no sejam integrais ou exaustivos, recolhem uma
porcentagem to elevada e, ao mesmo tempo, uma seleo to
representativa do vocabulrio mais usual de uma lngua, que se
chamam com razo dicionrios gerais. (...) Ao referirmo-nos ao
vocabulrio geral, oposto ao vocabulrio parcial, temos que ter
conscincia de que este vocabulrio geral no nem pode ser o
vocabulrio total de uma lngua.
77


77
HAENSCH, H. Op. Cit., p. 137.




129


Assim, como existe este tipo de dicionrio geral que se ope ao dicionrio
parcial, necessrio se valer dele e procurar melhor-lo. Ao vocabulrio geral como
objeto de codificao lexicogrfica opem-se os vocabulrios parciais. Para defini-los,
poder-se-ia partir dos grupos de falantes de uma lngua, Como sugere o autor:

...grupos estes que correspondem a uma rea limitada (vocabulrio
com marcao diatpica, ou seja, de um subsistema geogrfico em
relao lngua geral como diasistema), a uma profisso (vocabulrio
com marcao diatcnica), a um grupo de autores, a um autor ou a
uma obra.
78


Todos os critrios acima alocados vislumbram a compreenso dos vocabulrios
parciais e sobre eles a pesquisa se ocupar mais adiante.
Para encerrar este estudo sobre a tipologia dicionarstica, necessrio recorrer
ao critrio lingstico e, mais precisamente, aos distintos modos de ser da lngua e aos
distintos aspectos da descrio lingstica. Por este caminho, podem ser encontradas

...codificaes lexicogrficas cujo objeto constitui discursos
individuais que so os glossrios, dicionrios ou vocabulrios de obras
literrias. Codificaes lexicogrficas do discurso coletivo so os
chamados thesaurus que registram todas as palavras e outras unidades



78
HAENSCH, G. Op. Cit., p. 138.




130


lxicas que se apresentam nos textos de certas pessoas representativas
da lngua de uma coletividade humana em uma poca determinada.
Quando, em um dicionrio, se codificam determinados sistemas
lingsticos individuais, tem-se a base do atlas lxico. Com
freqncia, se codificam to somente os elementos lxicos que, dentro
de um sistema, so caractersticos de um determinado subsistema. o
caso dos dicionrios de regionalismos e dos dicionrios de grias.
79


A maior parte das codificaes lexicogrficas levam em conta ou o papel do
emissor lingstico ou do receptor. Se o importante for o papel do emissor poderia-se
mencionar outras tipologias dicionarsticas. o caso dos dicionrios onomasiolgicos
(ideolgicos, por matrias ou por conceitos), os quais j foram referidos como
dicionrios conceptuais, onde se parte de conceitos, indicando-se o significante
lingstico que lhes correspondam. Um outro caso o chamado dicionrio por imagem
(ou dicionrio pictrico), em que se parte da idia de um elemento da realidade que se
representa plasticamente para buscar em seguida um significante que lhe corresponda.
Quando um dicionrio se preocupa com a pronncia das unidades lexicais, tm-se os
denominados dicionrios ortopicos. Se a preocupao for com a grafia, os dicionrios
ortogrficos a estaro representados. So dicionrios que possuem uma orientao
fortemente normativa. H, ainda, dicionrios que informam sobre os diferentes
aspectos da combinao dos significantes. So os dicionrios de formao de palavras,
os dicionrios de construo e regime e os dicionrios de colocao. Se a preocupao
for expor as dificuldades individuais de um falante em relao sua lngua, tm-se os
dicionrios de dvidas tambm fortemente orientados para a norma.

79
HAENSCH, G. Op. Cit., pg. 97.




131


Se, por outro lado, se tomar o papel do receptor lingstico, tem-se uma outra
tipologia dicionarstica. A lexicografia semasiolgica parte do significante lxico para
indicar contedos realizados ou virtuais. O significante indicado pela ortografia
vigente em determinada lngua, mas pode ser transcrita a partir de gravaes onde
predomina a fala. Neste campo, h os dicionrios de fraseologia, dicionrios de
modismos, dicionrios de refres. Nesta categoria de dicionrios semasiolgicos, ainda
se encontram os dicionrios de neologismos e os dicionrios de palavras estrangeiras.
Enquanto os dicionrios onomasiolgicos so em geral monolnges, os dicionrios
semasiolgicos so plurilnges.
Um tipo de dicionrio que tem pouca reao com os papis do processo de
comunicao o dicionrio inverso, que utilizado quase que exclusivamente pela
investigao lingstica e permite, mediante uma ordem alfabtica inversa dos
significantes, conhecer paralelismos formais de monemas e sinonemas de um sistema
lingstico e efetuar um apanhado de tipos de significantes. So bastante teis em
lnguas que tm certa importncia a sufixao e a composio de monemas.
Pode-se encontrar, ainda, dicionrios de freqncias ou dicionrios estatsticos.
Eles se baseiam na freqncia dos significantes lxicos no discurso individual ou
coletivo do falante. J as relaes estruturais dentro do lxico de um sistema
lingstico esto codificadas nos dicionrios de sinnimos e nos dicionrios de
antnimos. O emissor lingstico pode deles se utilizar para obter indicaes prticas
em casos especiais. O dicionrio de sinnimo combina-se com o dicionrio ideolgico
se considerada a funo do interlocutor dentro do processo de comunicao. O mesmo
ocorre com o dicionrio de estilo, que representa uma mistura de dicionrio de
sinnimo, de dicionrio fraseolgico e de dicionrio de colocao.




132


Por regra geral, o chamado dicionrio histrico um dicionrio semasiolgico
que descreve as fases anteriores de evoluo de sistemas lingsticos coletivos.
Tambm isto considerado no dicionrio etimolgico, em que se segue a evoluo
formal de um significante atravs dos sculos, assim como suas mudanas de
contedos, levando-se em conta unidades lxicas semanticamente relacionadas com as
codificadas.
Um outro tipo o dicionrio alfabtico. A ordem alfabtica a mais usual em
todos os tipos de dicionrios, com exceo dos tipos onomasiolgicos, j referidos.
Nestes, se d com freqncia o agrupamento por matrias e conceitos.
Como se pode observar por esta tipologia dicionarstica, difcil existir um
dicionrio em que no entram vrios aspectos. difcil, portanto, estabelecer uma
separao estrita entre os aspectos descritivos e normativos. Junto aos dicionrios
puramente descritivos (os de uso) existem dicionrios cuja finalidade claramente
normativa (prescritiva).


II.2.2. A macroestrutura, a microestrutura e o sistema de remissivas de um
dicionrio terminolgico
J foram aportadas algumas consideraes acerca da tipologia dicionarstica.
Trata-se, agora, de perseguir exaustivamente os aspectos integrantes do dicionrio
terminolgico; sua macroestrutura, sua microestrutura e seu sistema de remissivas.
No sero oferecidas, neste momento, as opes do trabalho em relao a essas
questes, mas to somente um apanhado terico que influenciou essas opes, que
sero conhecidas no Captulo subseqente.




133


Inicialmente, porm, sero dadas as definies dessas UCE's, de acordo com
Maria Tereza da F. Lino.

Dicionrio terminolgico: dicionrio que apresenta os dados
terminolgicos relativos a uma ou vrias reas.
Macroestrutura: organizao geral de um dicionrio.
Microestrutura: organizao dos dados lexicolgicos ou
terminolgicos contidos num artigo de um dicionrio.
80


O sistema de remissivas consiste em indicaes colocadas para que o usurio
final busque novas informaes, no prprio dicionrio, a fim de completar seu
entendimento sobre determinada unidade de conhecimento especializado (UCE).
Dentro de uma determinada rea ou subrea, o terminlogo ter que seguir
procedimentos tericos quando da realizao de sua obra terminogrfica. Nesse
sentido, a teoria mais aceita aquela que preconiza, para os mtodos de base do
trabalho terminolgico, os seguintes procedimentos: a recolha, a anlise, a criao
neonmica e a normalizao.
H dois tipos de trabalho terminogrfico: o descritivo (o que, na verdade, est
sendo apresentando) e o normativo. Para o trabalho normativo, no basta um indivduo
ou uma equipe: necessria uma instituio normalizadora (ABNT, Termicat, Office
de Langue Franaise, etc.)
Quando do trabalho de recolha das UCEs, o termingrafo deve saber identificar
aquelas que pertenam prpria rea estudada e no lngua geral. Essa operao faz

80
LINO, M. T. R. F. Op. Cit., 1990, p. 113.




134


supor que ele deva ter um conhecimento aprofundado da lngua comum e
conhecimento ao menos sumrio acerca da rea ou subrea objeto de sua anlise. Essas
UCEs que ele persegue situam-se ao menos em dois nveis: i. no nvel conceitual, onde
se tenta reunir a nomenclatura dos conceitos prprios da rea pesquisada; ii. no nvel
funcional, onde o objetivo identificar as expresses prprias que pertencem tcnica
ou cincia estudada e somente a ela.
No trabalho de anlise contextual, aquela recolha poder ser considerada intil
se limitada apenas a revelar as UCEs especficas da tcnica estudada; necessrio ir
alm, quer dizer, grifar sobre a UCE revelada um certo contedo nocional que
permitir responder adequadamente questo do usurio por uma confrontao de
conceitos distintos. Dessa forma, a identificao do conceito por meio da anlise
contextual aparece como um mtodo fundamental da pesquisa terminolgica. Essa
anlise consiste em circunscrever o contexto identificando os elementos significativos
que se encontrou. Segundo o valor informativo desses elementos, o contexto ser
definitrio, explicativo ou associativo. Em cada caso, no entanto, os ndices nocionais
so importantes, no importando quais sejam.
81

Quando se chega questo da criao neonmica, necessrio deixar bem claro
que essa no a tarefa bsica da terminologia. Sua funo consiste fundamentalmente
em encontrar a UCE existente para a denominao do conceito em vez de criar uma
outra a todo custo. A criao de uma unidade lxica especializada no se justifica


81
DUBUC, R. Manuel pratique de terminologie, 1978, p. 74.




135


seno quando h falta da nominao procurada na lngua de especialidade de
referncia. E quando o termingrafo vier a criar uma UCE, ele deve ter conhecimentos
profundos da histria da lngua, de morfologia e de semntica.
A questo da normalizao dificilmente dissociada da pesquisa terminolgica.
No h dvida de que, pela natureza mesma de seu trabalho, pela aplicao rigorosa de
seus mtodos, o terminlogo/termingrafo tem condies de trazer para a operao de
normalizao uma contribuio valiosa. Mas no depende apenas dele. A
normalizao, que consiste em impor um mesmo uso para uma determinada rea ou
subrea, no pode resultar seno de uma conveno entre os usurios ou, quando isto
no for possvel, da imposio de uma instituio criada para esse fim. Apesar de no
ser parte integrante da terminologia, toda normalizao deve vir acompanhada de uma
excelente documentao.
Dados esses primeiros passos, o terminlogo ter de refletir ento sobre a
macroestrutura, a microestrutura e o sistema de remissivas de sua obra terminogrfica.
Como j definido, a macroestrutura refere-se ao conjunto das entradas de um
dicionrio. Nesse sentido, pode-se optar, como ponto de partida, pelo conceito para a
ordenao alfabtica que se apresenta na grande maioria dos trabalhos terminogrficos.

A ordenao sistemtica , em si mesma, a apresentao ordenada do
sistema conceitual de uma matria especializada. Esta ordenao
permite ainda uma apresentao mais adequada dos dicionrios
multilnges, j que o conceito especializado uma teoria nica para
todas as lnguas e diferencia-se somente pela forma da denominao.
82


82
CABR, M. T. La terminologa: teora, metodologa, aplicaciones, 1993, p. 85.




136


A microestrutura de um dicionrio pode ser definida como

...o conjunto de informaes ordenadas de cada verbete, realizando um
programa de informao constante para todos os verbetes e que se
lem horizontalmente (na macroestrutura, a leitura vertical) em
seguida s entradas.
83


Existe uma microestrutura bsica que

...constituda pelo conjunto das informaes ordenadas que se seguem
entrada e que tem uma estrutura constante, correspondente a um
programa e a um cdigo de informao aplicveis a qualquer entrada.
A esse conjunto entrada + enunciado terminogrfico denominamos
artigo ou verbete. Desse modo, o artigo mnimo tem dois
constituintes: entrada e definio.
84


Conforme a natureza da obra dicionarstica, esta microestrutura bsica pode
variar enormemente. Cite-se ento, de acordo com M. A. Barbosa, uma microestrutura
possvel para um dicionrio terminolgico. Ela se constituiria de:




83
REY-DEBOVE, J. tude linguistique et smiotique des dictionnaires franais contemporains, 1971, p. 21.
84
BARBOSA, M. A. Contribuio ao estudo de aspectos da tipologia de obras lexicogrficas. In: REUNIO
DA COMISSO DE ESTUDO ESPECIAL TEMPORRIA DE TERMINOLOGIA, 1993, p. 12.




137


Artigo = [+ Entrada (vocbulo) + Enunciado terminogrfico (+
Paradigma Informacional 1 (pronncia, abreviatura, categoria, gnero,
nmero, etimologia, rea, subrea, etc.), + Paradigma definicional
(acepo especfica da rea cientfica/tecnolgica ou de um falar
especializado), +/- Paradigma Pragmtico (exemplo de emprego
especfico daquela rea), +/- Paradigma informacional (freqncia,
normalizao, banalizao/vulgarizao/popularizao, etc.), +/-
Paradigma informacional n), + Remissivas relativas ao universo do
discurso em questo)].
85


Quanto ao sistema de remissivas, ele diz respeito indicao que o terminlogo
coloca para o usurio final buscar novas informaes que completem seu entendimento
sobre determinada UCE. No caso dos dicionrios terminolgicos, o sistema de
remissivas relativo ao universo do discurso caracterizado e relaciona UCEs que
fazem parte do repertrio. Implica que as UCEs so antnimas ou complementares.
Indica, por vezes, que as UCEs mantm uma relao hiponmica ou hiperonmica entre
elas, ou, ainda, que esto includas na definio de outra UCE.


II.3. A estrutura conceitual da gesto pela qualidade total em servios
O objetivo deste item do Captulo reforar, por meio da apresentao terica e
construo da estrutura conceitual, a convico de que a GQT em servios existe
paralelamente como rea de especialidade em relao GQT em manufatura. Esta, enquanto

85
BARBOSA, M. A. Da microestrutura dos vocabulrios tcnico-cientficos. In: ENCONTRO NACIONAL DA
ANPOLL, 1989, p. 575.




138


iniciadora e implementadora dessa filosofia administrativa em indstrias de transformao, ou
seja, organizaes que industrializam produtos manufaturados. Aquela, como uma seqncia
natural que acompanhou o desenvolvimento cientfico e tecnolgico da rea de especialidade
em questo. Como j descrito no item 1.4. do Captulo I, a GQT em servios, tomando-se por
argumentao a teoria administrativa, distingue-se da GQT em manufatura pelos motivos l
expostos, mas que podem ser resumidos pelo fato de que nela o processo o produto e o
produto o processo, ou seja, a GQT em servios deve se dar na interface em oposio ao
suporte, presente este tambm na produo. O que se tentar, agora, intensificar esta
convico, apresentando um aparato terico em terminologia que dar sustentao a essa
idia. Isso poder, certamente, reforar a resposta j dada em relao hiptese inicial aqui
defendida, qual seja, a GQT em servios realmente configura-se como uma rea especializada
do conhecimento humano complementar GQT em manufatura.
Inicialmente, convm ressaltar que tudo o que se refere cincia da Terminologia
custoso e complexo. Essa cincia, ou sua prtica, muito antiga, e sua atuao est ligada
questo da utilizao de um vocabulrio especializado por parte do falante. Enquanto
disciplina, ela interessa a diferentes tipos de usurios, como os tradutores tcnicos, os
documentalistas, os terminlogos e os profissionais de todas as reas de especialidade,
relativas a uma cincia ou tcnica. Mas, em que esse falar especializado se distingue do falar
de lngua geral? Para responder a essa questo, necessrio desenvolver a delimitao do que
seja lngua de especialidade, como introdutrio a essa teoria, para se encaminhar a outra
questo que a da estrutura conceitual.
Em relao lngua geral, comum a sua caracterizao como aquela utilizada por
todos os falantes de uma dada comunidade lingstica. Sua sistematizao encontra-se na
gramtica e seu universo lexical encontra-se delimitado nos dicionrios de lngua geral, que




139


tm a pretenso, nem sempre satisfeita, de abarcar todo o lxico dessa lngua. Sua utilizao
individual conhecida por fala, ou parole na terminologia saussuriana. Alheio s questes
geogrficas e culturais, o mundo moderno, com o advento das inovaes tecnolgicas e
cientficas, e a globalizao, passa a conviver com um outro tipo de lngua, a chamada lngua
de especialidade. Traando um paralelo entre lngua geral e lngua de especialidade, v-se que
essa tratada de modo metafrico para fazer referncia ao conjunto de subcdigos (includos
na lngua geral), entendidos como selees do cdigo geral, levando-se em conta alguns
critrios.
Dentre esses critrios, pode-se mencionar o tema. Mas, o que seria um tema
especializado? No seriam temas especializados aqueles que so objetos de conversao e
intercmbio lingstico habitual em situaes gerais de comunicao porque se trata de um
tema que no necessitou de uma aprendizagem de uma terminologia especfica por parte dos
falantes e seus usurios no tomariam parte de grupos profissionais especficos. O oposto
disso seria um tema especializado, ou seja, a terminologia utilizada seria aprendida por
profissionais com o intuito de exercer uma comunicao pragmtica, visando a uma melhora
nesse relacionamento profissional.
Essa comunicao entre especialistas se d comumente a partir da modalidade escrita
de uso da lngua. Nesse sentido, um texto especializado deve ser de carter referencial e,
portanto, apresentar recursos sintticos e textuais que servem para dar uma informao o mais
objetivamente possvel e ser melhor quanto mais impessoalizado o for. Para tanto, esses
profissionais recorrem freqentemente a frmulas textuais como a descrio, a definio, a
classificao, a enumerao, o clculo, etc. Desaprovam, por outro lado, outras possibilidades
muito utilizadas em lngua geral, como a narrao, o dilogo explcito, a interrogao, etc.




140


Os textos especializados possuem ainda as seguintes caractersticas: i. carter
lingstico complexo porque so construdos a partir da gramtica de uma lngua geral; ii.
carter pragmtico complexo porque as utilizaes que se podem fazer deles variada e
multidimensional; iii. carter sociolingstico complexo porque uma lngua um sistema de
comunicao social que ocupa um lugar determinado na sociedade que a utiliza, seja por sua
relao com outras lnguas dentro da mesma sociedade, seja pela relao que mantm com
lnguas de outras sociedades. Estas utilizaes especializadas so as mais controvertidas em
relao sua eficcia.
Por outro lado, outros aspectos esto implcitos nos textos de lngua de especialidade.
Um deles o dilogo implcito que comumente se observa entre o emissor e o receptor.
Nesses dilogos, as posies pessoais no so implcitas, mas indiretas, o que auxilia no
convencimento indireto dos receptores, por meio da argumentao, citao, exemplificao,
etc. Tudo canalizado para tal convencimento, assim como a presena de elementos
metalingsticos, cuja quantidade vai depender do nvel de especializao da comunicao e
do conhecimento prvio desses receptores.
Mas, parte esse aspecto estrutural dos textos de lngua de especialidade, qual a
linguagem que predomina nessas composies? Seria uma linguagem natural especializada ou
uma linguagem artificial? Inicialmente, no se deve considerar uma linguagem como sendo
inventada, mesmo considerando que a lngua especializada se vale de diversos sistemas
semiticos que conjugam os recursos para estruturar e significar seus diferentes aspectos.
Apesar de encontrar-se signos no-lineares tridimensionais, como modelos e maquetes, e
bidimensionais, como esquemas, diagramas e grficos, alm de signos lineares, como os
elementos mesmos da lngua, signos icnicos e no-icnicos, que so reconhecidos e remetem
ao significado e signos diretos e substitutivos na lngua de especialidade, todos so




141


construdos tomando-se como referncia a prpria linguagem, uma vez que fazem parte dessa
e utilizam os recursos prprios da lngua geral.
Na lngua de especialidade, todos os signos e recursos podem contribuir para a
comunicao especializada. Sempre ao se deparar com um texto especializado, possvel
encontrar uma mistura, s vezes um amlgama de vrios sistemas semiticos e constata-se
que uma das caractersticas capitais da comunicao especializada o papel, de um lado, das
linguagens simblicas e, de outro, dos recursos semiticos no-lineares e icnicos, como as
figuras, as imagens, os esquemas, os grficos, os cdigos, as cores, etc.
A partir dessa perspectiva, sero trazidas aqui algumas definies lingsticas dessa
UCE que so representativas da lingstica entre 1975 e 1989. Os autores dessas definies
so Galisson & Coste, Sager, Hoffmann, Mller, Ihle-Schmidt, Mhn & Pelka e Figge, que
foram citados por Kocourek.

O artigo do dicionrio de Galisson e Coste (76:511) define as lnguas de
especialidade como: (1) des langues utilises dans les situations de
communication (orales et crites) qui impliquent la transmission dune
information relevant dun champ dexprience particulier. Lnguas
utilizadas em situaes de comunicao (orais ou escritas) que implicam a
transmisso de uma informao relevante em um campo de experincia
particular.
A segunda definio foi extrada da obra English Special Languages de Juan
C. Sager, David Dungworth e Peter F. McDonald, um dos primeiros estudos
completos do ingls de especialidade. As lnguas de especialidade so assim
definidas: (2) means of linguistic communication required for conveying
special subject information among specialists of the same subject (Sager et




142


al. 80:21, 182). Os meios de comunicao lingstica necessrios para
exprimir informao sobre um assunto especfico, entre especialistas do
mesmo assunto.
A definio inglesa de LSP (language for special purposes) que Lothar
Hoffmann formulou uma traduo-parfrase de duas definies de sua
anlise detalhada Kommunikationsmittel Fachsprache (Hoffmann 76:170,
194): (3) a complete set of linguistic phenomena occurring within a definite
sphere of communication and limited by specific subjects, intentions, and
conditions (Hoffmann 79:16). Um conjunto completo de fenmenos
lingsticos, que ocorrem dentro de uma esfera definida de comunicao,
limitado por assuntos, intenes e condies especficas.
Bodo Mller, em sua obra fundamental, traduzida para o francs, d a
seguinte definio (85:187): (3) On appelle langue de spcialit ou langue
technique un registre qui provient de lapprofondissement des connaissances
et des ralisations techniques dans un secteur donn de lactivit humaine et
qui est utilis, quand la communication a trait cette spcialisation, par des
locuteurs lesquels possdent ces connaissances et participent ces
ralisations, totalement ou partiellement. Une telle langue est donc dfinie
par le domaine o elle est employe. Denomina-se lngua de
especialidade ou lngua tcnica um registro que provm do aprofundamento
do conhecimento e das realizaes tcnicas em um setor dado da atividade
humana e que utilizado quando a comunicao se faz nessa especializao
pelos locutores que possuem esses conhecimentos e participam dessas
realizaes, total ou parcialmente. Uma tal lngua ento definida pelo
domnio em que ela empregada.




143


Lieselotte Ihle-Schmidt consagra, em sua Tese de Doutorado de 1978,
publicada em 1983, as pginas de 15 a 25 definio de lngua de
especialidade e resume suas concluses em uma definio de 31
linhas, onde ela cita de incio a definio dada acima de Bodo Mller,
e depois continua: (5) [Die Fachsprache] ist somit diejenige
Sprachform, die die Fachleute eines bestimmten Faches bei der
Kommunikation ber ihr spezifisches Fachgebiet verwenden [...]
(Ihle-Schmidt 83:24) A lngua de especialidade aquela forma de
linguagem que os especialistas de uma determinada especialidade
utilizam para se comunicarem com outros especialistas sobre sua rea
de especialidade.
O livro fundamental alemo sobre a lngua de especialidade de Dieter
Mhn e Roland Pelka define seu objeto da seguinte forma: (6) Wir
verstehen unter Fachsprache heute die Variante der Gesamtsprache,
die der Erkenntnis und begrifflichen Bestimmung fachspezifischer
Gegenstnde sowie der Verstndigung ber sie dient und damit den
spezifischen kommunikativen Bedrfnissen im Fach allgemein
Rechnung trgt. [...] Hoje, ns entendemos como lngua de
especialidade a variante da lngua geral que serve para conhecer e
determinar assunto especfico e que se presta explicao do mesmo,
preenchendo as necessidades de comunicao especfica.
Uma das mais recentes definies de lngua de especialidade esta de
Udo L. Figge, que toma como base para a sua formulao a definio
de Hoffmann, como tambm aquela dada por Mhn e Pelka, e
acrescenta algumas caractersticas especficas: (7) Sie [=die
Fachsprache] ist eine Variett einer Standardsprache, besteht aus




144


einer spezifischen Menge hufig normierter lexikalischer Elemente
und einer spezifischen Menge (morphologisch-)syntaktischer Regeln,
wird von Individuen gekonnt, die auf einem spezifischen Gebiet
Fachleute sind, und dient der Manifestation von Fachwissen ber
dieses Gebiet zum Zwecke der Kommunikation unter diesen
Fachleuten. (Figge 89:302) A lngua de especialidade uma
variante da lngua padro, e composta de uma grande quantidade
especfica de elementos lexicais normalizados, e de uma grande
quantidade especfica de regras morfossintticas. conhecida por
pessoas que so especialistas em uma determinada rea e serve como
manifestao do conhecimento especializado desta rea na
comunicao entre elas.
86


Ainda de acordo com o autor mencionado, h uma certa concordncia entre essas
definies, apesar de parecerem variadas. Ele a coloca da seguinte forma:

A. as definies retm de incio a noo de variedade de lngua, o carter
lingstico global (isto quer dizer que isso se aplica a todos os planos da
lngua), mas restringida pela especialidade (esta restrio toma a forma
relativa ou de um complemento de nome);
B. todos os autores concordam igualmente sobre a funo lingstica
da comunicao;
C. as definies so tambm parecidas em relao ao aspecto da
especialidade;

86
KOCOUREK, R. La langue franaise de la technique et de la science, 1991, p. 20-21.




145


D. h, ainda, uma preocupao sobre a informao e o conhecimento
(conceito ligado comunicao pelo contedo comunicado, e que relaciona
a funo cognitiva de Jakobson e a funo de conhecimento de Guiraud).
87


Pode-se constatar que a especialidade de uma lngua divide-se no somente em relao
ao tema segundo a rea de conhecimento a que ela pertena e segundo o grau de
intelectualizao, mas tambm em relao ao grau de particularizao, que marcado no
plano terminolgico. Pode-se constatar tambm que o plano semntico-lexical ocupa um lugar
privilegiado entre os recursos da lngua de especialidade. Semanticamente, a unidade lexical
nominal precisa que domina os textos especializados e a UCE nominal, unidade nominal
definida, que domina estes textos.
Em relao ao tema da especialidade, as UCEs nominais refletem-se de tal maneira
que seria, em princpio, possvel formular uma definio operatria dos textos de uma cincia
dada ou de uma parte dela, apresentando uma lista de palavras-chave onde a ocorrncia nos
textos tcnicos marcaria como os mesmos pertencem a essa especialidade ou parte dela.
Do ponto de vista da intelectualizao, ainda a UCE nominal que exerce um papel
essencial na generalizao, na sistematizao conceitual, na racionalizao e na argumentao
desses textos especializados. As UCEs nominais, unidades lingsticas paradigmticas,
estveis, so ao mesmo tempo flexveis em relao ao dinamismo da rea de conhecimento.
Um dinamismo, um processo talvez transposto em uma terminologia que o prende e que o
torna acessvel ao pensamento. Alm disso, o sistema terminolgico manipulvel.
A lngua de especialidade constitui, de um lado, um dos sistemas semiticos de
especialidade, distinto dos outros sistemas semiticos, tais como as lnguas simblicas

87
KOCOUREK, R. Op. Cit., p. 21.




146


j aludidas. De outro lado, a lngua de especialidade uma sublngua, uma variao,
um estilo da lngua geral. Ela possui os recursos em comum com a lngua usual, mas
ela possui tambm importantes recursos prprios. Ela mais do que um registro, mais
do que um discurso, mais do que um vocabulrio ou do que uma terminologia. um
sistema livre de recursos sobre todos os planos da lngua que possui vrios registros e
um pouco mais do que caractersticas lexicais. , no entanto, o bom uso escrito do
especialista que a explora o mais comumente.
A lngua de especialidade principalmente uma lngua dita natural, com os
elementos braquigrficos integrados e com uma preocupao maior com o escrito, que
ela tem em comum com a lngua potica. Ela constitui, no mais, uma parte do discurso
misto lngua-linguagem.
Ela se aproxima, sob certos pontos de vista, das lnguas simblicas, em que
certas caractersticas so seguidamente consideradas como propriedades ideais da
lngua especializada. Por analogia com as lnguas simblicas e, em parte, com a lngua
potica, e, contrariamente lngua geral, uma lngua de especialidade est circunscrita
a um reduzido grupo de especialistas que dela se utilizam com o objetivo de
desenvolverem suas atividades especiais. Ela tem em comum, com as diversas
especialidades, aquilo que se poderia denominar de diversificao cognitiva segundo a
rea, a intelectualizao, a particularizao e a escola de pensamento.
Ela visa ao ideal da intelectualizao, ou seja, preciso semntica,
sistematizao conceitual, neutralidade emotiva, economia formal e semntica; ela
tem ainda uma tendncia em definir suas unidades lexicais, em controlar a polissemia e
a homonmia, em suprimir os sinnimos, em simplificar e at mesmo em delimitar os
meios sintticos, em neutralizar ou conter a emotividade e a subjetividade. Seu ideal




147


esttico a intelectualizao, evitando as metforas e toda sorte de smbolos
implcitos. Ela tem facilidade em assimilar um nmero importante de elementos
braquigrficos, como as abreviaturas e os ideogramas, o que a distingue da lngua
potica.
Em contraste com a lngua geral e com a lngua simblica, a lngua de
especialidade possui um lxico bem conhecido de seus usurios, o que permite a ela
apreender o mundo cognitivo da especialidade em sua complexidade e integralizao
ou, ao menos, de forma mais integralizada do que os outros sistemas semiticos de
especialidade. O lxico o fato cognitivo e lingstico mais importante desse tipo de
lngua.
Em razo de sua capacidade metalingstica, a lngua de especialidade pode ser
o instrumento de sua prpria formao, de seu prprio funcionamento, de sua preciso,
de sua evoluo. Ela pode tambm servir para interpretar e mesmo construir outros
sistemas semiticos; essa funo metalingstica atribui-lhe um lugar privilegiado
entre os sistemas semiticos.
Do ponto de vista das funes primrias, a lngua de especialidade um
instrumento que serve principalmente para significar o contedo especializado e a sua
comunicabilidade (funo cognitiva e comunicativa). Ela serve igualmente para
conservar e se estender ao longo do tempo. A semntica da lngua de especialidade e
sua terminologia , portanto, um domnio essencial de seu estudo.
O contedo especializado o contedo dos textos especializados; ele reflete
todos os componentes essenciais da especialidade, como o mundo dela (os fatos
estudados), os conceitos correspondentes, os conhecimentos acumulados, os mtodos
empregados e seus especialistas.




148


O campo comum ao aspecto lingstico e no-lingstico da especialidade
justamente o contedo especializado contido nos textos; um estudo da lngua de
especialidade compreenderia no somente o estudo de seu agenciamento sobre todos os
planos lingsticos, como tambm o exame de certas correspondncias entre os
componentes da especialidade e a lngua utilizada.
Seria interessante, nesse momento, fazer uma sntese do que foi exposto. A
lngua de especialidade uma variedade de lngua com um domnio cognitivo. Os
textos, base de suas significaes e, portanto, componentes do corpus da pesquisa, no
podem, e no so, cumulativos, emotivos, subjetivos e metafricos, delimitados de
maneira externa. Devem ser carregados, e so, de significao com o intuito de
comunicar, em uma coletividade restrita, o contedo temtico, racional e
circunstancial. Os recursos utilizados, criados a partir desses textos no plano
lingstico, so, s vezes, marcados por caracteres grficos, da a sua quantidade
expressiva no corpus estudado, por tendncias sintticas e, sobretudo, por um conjunto
rapidamente renovvel de unidades lexicais que requerem, e recebem nos textos, uma
preciso semntica metalingstica.
A lngua de especialidade , portanto, em seus textos, o tesouro do saber
disponvel e lingisticamente analisvel, e seus recursos o instrumento do saber futuro.
Dessa forma, retomando a questo da lngua geral, preciso reafirmar que ela
se refere ao conjunto das unidades que formam parte do conhecimento da maioria dos
falantes de uma lngua, utilizadas em situaes no-marcadas de comunicao. Essa
lngua geral poderia ser considerada como um subconjunto da lngua entendida como
global, ou seja, uma linguagem especializada banalizada que ficaria na metade do
caminho entre a lngua geral e a especializada. Por outro lado, as lnguas de




149


especialidade circunscreveriam-se no conjunto de sublinguagens, especificadas a partir
de uma terminologia prpria que seria utilizada em situaes especficas de
comunicao profissional, com as seguintes caractersticas:
i. a especificidade do tema e de sua perspectiva cognitiva, ou seja, so
abordados assuntos que no so dominados no dia-a-dia e dependeria
ainda do enfoque que se der ao abord-los;
ii. os interlocutores, em que o emissor o especialista que transmite sua
especialidade a um outro especialista (utilizando um discurso altamente
especializado), a um estudante (por meio de um discurso didtico
especializado) e ao grande pblico (a partir de um discurso de
divulgao especializado que no envolve banalizao). H ainda a
figura dos mediadores que podem favorecer a banalizao da
especialidade com vistas a difundir aquele conhecimento, caso seja de
interesse do grande pblico;
iii. as situaes de utilizao dessa linguagem especializada ocorrem
sempre nos ambientes profissionais, o que traz uma especificidade
distante da linguagem de uso geral;
iv. a densidade terminolgica dos textos que varia em relao ao nvel do
discurso, j que entre os especialistas ele tende a ser mais denso, e entre
esses e o pblico, menos denso.
Por meio de comentrios a essas caractersticas, poder-se-ia resgatar se o objeto
desta pesquisa se enquadra em uma lngua de especialidade em relao teoria
lingstica, uma vez que j ficou provado que o mesmo se esquadra em relao teoria
administrativa:




150


i. quanto ao tema, possvel a comprovao, a partir da apresentao da
teoria administrativa j aludida, de que o mesmo no um assunto
corriqueiro e abordado a partir de uma perspectiva profissional;
ii. alm disso, a partir da pesquisa bibliogrfica realizada e que ser
apresentada no momento oportuno, os emissores que tratam do mesmo
so especialistas transmitindo seus conhecimentos por meio de um
discurso altamente especializado e, como esses conhecimentos
interessam ao grande pblico, h a presena de mediadores que utilizam
um discurso de divulgao que ainda no se encontra banalizado por ser
uma rea do conhecimento ainda recente, mas que, nesta pesquisa, ao ser
apresentado um dicionrio terminolgico sobre o tema, h o
comprometimento de divulgar essas UCEs da forma como so utilizadas
pelos especialistas, sem atentar para a banalizao, a no ser que ela
tenha se institucionalizado;
iii. quanto s situaes de utilizao dessa lngua de especialidade, pode-se
vislumbrar que a mesma colocada em ambientes profissionais, ou seja,
a GQT em servios tpica de empresas prestadoras de servios, o ramo
da economia que mais se desenvolve no mundo globalizado de hoje;
iv. por ltimo, a densidade terminolgica dos textos selecionados como
corpus alta, uma vez que a preocupao foi com a coleta, a
contextualizao e a definio dessas UCEs nessa rede nocional.
Pelo exposto, mais uma vez faz-se necessrio resgatar a primeira hiptese que
aqui, neste item do Captulo, encontrou acolhida. Tomando-se por base a teoria
terminolgica, pde-se comprovar que o objeto de pesquisa desta Tese constitui-se




151


efetivamente em uma lngua de especialidade dentro do conhecimento humano
acumulado.
Mas, em que ela se distinguiria da GQT em manufatura? Para se obter essa
resposta, necessria a construo da estrutura conceitual da GQT em servios para
que essa distino fique evidente, j que esta uma etapa imprescindvel para a
elaborao de uma obra terminogrfica.
A pesquisa terminolgica, desde a sua estruturao com Wster na dcada de 50
do sculo passado, sempre deu ateno especial aos conceitos e s suas relaes dentro
de uma rea nocional, uma vez que sua abordagem onomasiolgica, ou seja, parte do
conceito para encontrar a UCE que lhe corresponda. Dessa forma, o conceito no vem
isolado, mas faz parte de uma rea especializada e relaciona-se com outros conceitos,
constituindo uma estrutura conceitual, conjunto sistematizado de conceitos, que
descrever uma rea do conhecimento humano.
Para a elaborao da estrutura conceitual, h a necessidade de se conhecer a rea
especializada com a qual se esteja trabalhando, como tambm de se ter a assessoria dos
especialistas da rea, j que preciso reconhecer os conceitos em textos, agrup-los em
distintas reas nocionais e estabelecer relaes entre eles. Para que isso seja possvel,
necessrio adquirir uma competncia cognitiva, que se realiza por meio da leitura de textos
especializados e contatos com especialistas da rea em questo. Quando se domina o tema,
pode-se construir a estrutura conceitual.
A delimitao da rea necessria porque, medida que se classifica o conhecimento
especializado, vai-se explicitando uma determinada viso cultural e cientfica da realidade.
Isto se deve ao fato de que a delimitao realizada de acordo com os seguintes critrios: i. os
objetivos da obra terminogrfica; ii. os usurios finais que se quer atingir; iii. os critrios que




152


foram utilizados para efetuar o recorte do conhecimento de determinada maneira e no de
outra, o que influenciar em uma estrutura conceitual especfica.
88

A estrutura conceitual constitui, ento, uma representao da realidade no mbito da
rea que se toma como objeto de estudo. Esta representao procura recolher e organizar
todas as ramificaes que so prprias da referida rea, de modo a refletir, em forma de
esquema, a realidade da rea em questo.
Assim, o ideal que a classificao de todas as UCEs coletadas a partir do corpus da
pesquisa seja feita dentro de cada campo ou subcampo correspondente da estrutura conceitual.
Alm disso, uma estrutura conceitual permite, de acordo com Gladis M. B. Almeida:

1. estabelecer previamente os conceitos que sero denominados;
2. circunscrever a pesquisa, j que todas as ramificaes da rea-objeto,
com seus campos, foram previamente consideradas;
3. elaborar uma terminologia mais controlada e coerente, j que possibilita
uma abordagem mais sistemtica de uma rea de especialidade;
4. controlar a pertinncia dos termos, pois, separando cada grupo de termos
pertencentes a um determinado campo, poder-se- determinar quais so
relevantes para a obra e quais no so;
5. prever o grupo de termos pertencentes rea-objeto, como tambm os
que fazem parte de matrias conexas;
6. classificar e ordenar as fichas terminolgicas;
7. definir as unidades terminolgicas de maneira lgica e sistemtica.
89



88
Cf. TERMCAT. Metodologa del treball terminolgic, 1990, p. 17 e 70.
89
ALMEIDA, G. M. de B. Teoria comunicativa da terminologia (TCT): uma aplicao, 2000, p. 120.




153


A estrutura conceitual da GQT em servios comeou a configurar-se com a
delimitao da rea especializada. Ela surge da Administrao de Empresas, a partir de um
novo enfoque na produo de bens e servios, com vistas a aumentar o lucro, fazendo bem
feito na primeira vez. Nesta pesquisa, foi necessrio acompanhar as grandes mudanas que
ocorreram na rea e uma das principais foi a criao de uma nova abordagem conceitual da
administrao da qualidade, a saber, a trilogia de processos por meio da qual a qualidade
administrada: planejamento da gesto pela qualidade total, controle da gesto pela qualidade
total e melhoria da gesto pela qualidade total. Esta trilogia tornou-se, por si prpria, uma
estrutura testada, na qual se pode criar uma abordagem coesa e unificada da administrao da
qualidade.
Alm disso, houve um crescimento da competio pela qualidade, competio que se
tornou particularmente intensa no mbito internacional. A qualidade hoje um elemento
crucial para o comrcio internacional, para a capacidade de defesa, para a segurana e sade
humanas e para a proteo do meio ambiente. As indstrias e as prestadoras de servios vm
respondendo a essa importncia crescente da funo qualidade de vrias maneiras:
1. O objetivo da qualidade tem se ampliado para incluir atividades de apoio
produo e prestao de servios, processos comerciais e necessidades do cliente
interno;
2. O planejamento da qualidade vem evoluindo para uma abordagem estruturada e
formal, a qual implica a participao interna bem como o planejamento conjunto
entre clientes e fornecedores;
3. Os administradores de nveis hierrquicos mais elevados esto ocupando-se cada
vez mais da administrao da qualidade, cuja tendncia visvel na evoluo do
conceito de administrao da qualidade em mbito empresarial, na criao de




154


conselhos da qualidade em nveis mais elevados da hierarquia, na ampliao do
plano de negcios para incluir o plano de melhoria anual da qualidade e na
instituio de objetivos da qualidade em mbito corporativo, avaliaes de
desempenho e aes corretivas da alta administrao;
4. O treinamento em administrao da qualidade tem sido estendido, de maneira
crescente, a todas as funes, incluindo a administrao geral.
No bastassem todas essas questes, vrios segmentos da sociedade tm se envolvido
com a administrao da qualidade, seja por meio de patrocnio governamental em programas
nacionais de motivao qualidade, seja por instituio de prmios para a qualidade, seja pela
promulgao de leis que visem a proteger a segurana, a sade e o meio ambiente, seja pelo
aumento do nmero de cursos e servios de consultoria voltados para os vrios aspectos
ligados administrao da qualidade. Tudo colide no sentido de se aumentarem cada vez mais
as complexas relaes conceituais envolvidas.
Diante de to complexas relaes entre os conceitos envolvidos, optou-se pela trilogia
j mencionada da rea em questo para construir sua estrutura conceitual, porque s ela
capaz de possibilitar um olhar isento, a partir de trs dimenses que abrangem os
conhecimentos relativos gesto pela qualidade total em servios.
A primeira dimenso, o planejamento da GQT em servios, dedica-se obteno da
qualidade em qualquer indstria, produto/servios ou processo. Todas as UCEs coletadas
seguem o processo da administrao aplicado funo qualidade, como a formao de
polticas, o estabelecimento de objetivos, o planejamento, a organizao, o treinamento, etc.,
listadas no item IV.4. deste Tese, denominado Repertrio das unidades de conhecimento
especializado relacionadas ao planejamento da gesto pela qualidade total em servios.




155


A segunda dimenso, o controle da GQT em servios, dedica-se ao controle, desde que
a gesto j esteja implantada na organizao. Todas as UCEs coletadas seguem o processo de
obteno do produto/servios aplicado funo qualidade, como o deenvolvimento de novos
produtos, as compras, a manufatura, os testes, o marketing, os servios ao consumidor, etc.,
listadas no item IV.5. desta Tese, denominado Repertrio das unidades de conhecimento
especializado relacionadas ao controle da gesto pela qualidade total em servios.
A terceira e ltima dimenso, a melhoria da GQT em servios, dedica-se ao
aperfeioamento desde que a gesto j esteja implantada e controlada na organizao. Todas
as UCEs coletadas seguem o processo de obteno da melhoria da qualidade aplicado
funo qualidade, que trataro de problemas gerais de gerenciamento, listadas no item IV.6.
desta Tese, denominado Repertrio das unidades de conhecimento especializado relacionadas
melhoria da gesto pela qualidade total em servios.
Paralelamente s dimenses, h os mtodos estatsticos, que migraram de sua rea de
especialidade e aqui so considerados como subrea, compostos por UCEs que nomeiam a
maioria destes recursos disponveis ao administrador da qualidade, e cuja apresentao se d
na segunda dimenso em relao ao setor de servios da estrutura conceitual, mas que se
encontram nas trs dimenses do setor de manufatura da mesma estrutura, ou seja,
planejamento, controle e melhoria da qualidade. Ainda em paralelo s dimenses, h que se
mencionar as UCEs relacionadas rea de especialidade do marketing, que tambm migraram
e aqui so consideradas como subrea, cuja apresentao se d em todas as dimenses tanto
do setor de manufatura quanto do setor de servios, de acordo com sua configurao
semntica.
At aqui, a estrutura conceitual estabeleceu, em algumas situaes, uma interseco
entre os setores de manufatura e de servios. No entanto, o setor de servios representado de




156


uma forma particular, quando no h meno manufatura, ou seja, h UCEs que trafegam
entre a manufatura e os servios, mas no h UCEs que sejam especficas para manufatura
como as h para servios, permeando as trs dimenses da estrutura conceitual: o
planejamento, o controle e a melhoria da gesto pela qualidade total em servios. o caso
daquelas relacionadas aos bancos, um dos representantes dos servios que mais certificaes
possui no Brasil e aqui tambm considerado como uma subrea. As UCEs que contemplam os
dois setores so imprescindveis para a compreenso da GQT em servios, uma vez que elas
surgiram concomitantes e, apenas em um momento posterior, conseguiram estabelecer suas
especificidades, devido, sem dvida, ao desenvolvimento tecnolgico.
Resumidamente, a estrutura conceitual a seguinte: parte-se de uma rea especializada
que a gesto pela qualidade total em servios; as dimenses que relacionam os conceitos
so: i. planejamento da GQT em servios; ii. controle da GQT em servios; iii. melhoria da
GQT em servios; paralelamente a essas dimenses possveis, a rea especializada recebe
influncias da subrea dos mtodos estatsticos especficos para a dimenso do controle da
GQT em relao ao setor de servios e para todas as dimenses em relao ao setor de
manufatura; a rea especializada ainda recebe influncias da subrea do marketing em todas
as dimenses em relao ao setor de manufatura, como tambm em relao ao setor de
servios; por ltimo, em todas as trs dimenses, UCEs relacionadas manufatura e servios
com significados em interseco e UCEs especficas que perpassam as trs dimenses, mas
especficas ao setor de servios, que so aquelas relacionadas aos bancos.
Graficamente, a estrutura conceitual tem a seguinte configurao:
P. S.: O (P) entre parnteses identifica cada uma das dimenses, ou seja, (P I)
corresponde ao planejamento da GQT em servios, (P II) ao controle da GQT em servios e
(P III) melhoria da GQT em servios.




157


ESTRUTURA CONCEITUAL DA REA GQT EM SERVIOS

I. SETOR DE MANUFATURA
I.1. Planejamento da GQT em manufatura e servios (P I)
I.1.1. Mtodos estatsticos no planejamento da GQT em manufatura e servios (P I)
I.1.2. Tcnicas de marketing no planejamento da GQT em manufatura e servios (P I)
I.2. Controle da GQT em manufatura e servios (P II)
I.2.1. Mtodos estatsticos no controle da GQT em manufatura e servios (P II)
I.2.2. Tcnicas de marketing no controle da GQT em manufatura e servios (P II)
I.3. Melhoria da GQT em manufatura e servios (P III)
I.3.1. Mtodos estatsticos na melhoria da GQT em manufatura e servios (P III)
I.3.2. Tcnicas de marketing na melhoria da GQT em manufatura e servios (P III)

II. SETOR DE SERVIOS
II.1. Planejamento da GQT em servios (P I)
II.1.1. Especificidade dos bancos no planejamento da GQT em servios (P I)
II.1.2. Tcnicas de marketing no planejamento da GQT em servios (P I)
II.2. Controle da GQT em servios (P II)
II.2.1. Especificidade dos bancos no contole da GQT em servios (P II)
II.2.2. Tcnicas de marketing no controle da GQT em servios (P II)
II.2.3. Mtodos estatsticos no controle da GQT em servios (P II)
II.3. Melhoria da GQT em servios (P III)
II.3.1. Especificidade dos bancos na melhoria da GQT em servios (P III)
II.3.2. Tcnicas de marketing na melhoria da GQT em servios (P III)




158


Para que o leitor possa ter uma viso suficientemente clara da estrutura conceitual
identificada na rea de especialidade gesto pela qualidade total em servios, sero arroladas a
seguir todas as 783 (setecentas e oitenta e trs) UCEs coletadas nesta pesquisa em cada uma
das trs dimenses dadas. As siglas relacionadas s UCEs tambm sero arroladas entre
parnteses ao lado da UCE correspondente. Ser observado ainda que algumas UCEs
trafegam entre o item especificidade dos bancos e as tcnicas de marketing em algumas
dimenses no setor de servios.

ESTRUTURA CONCEITUAL DA REA GQT EM SERVIOS

I. SETOR DE MANUFATURA
I.1. Planejamento da GQT em manufatura e servios (P I)
- 14 princpios - adequao ao uso
- adotar a nova filosofia - ambiente da organizao
- Associao Brasileira de Normas Tcnicas (ABNT)
- cadeia cliente-fornecedor - cadeia de clientes
- canal de distribuio - caractersticas da qualidade
- caracterizao de processo - CB-25
- cessar a aprovao de oramentos com base no preo
- checklist - ciclo da qualidade
- cliente - cliente externo
- cliente final - cliente intermedirio
- cliente interno - colaborador
- comit da qualidade - companhia




159


- conferncia de desenvolvimento - conselho da qualidade
- constncia de propsito - consultor
- consumerismo - consumidor
- cooperao - criar constncia de propsito
- cultura - custo da baixa qualidade
- custo da m qualidade (CMQ) - custo da no-qualidade
- custo da qualidade (CDQ) - custo da qualidade ruim
- custo de avaliao - custo de avaliao da qualidade
- custo de falha externa - custo de falha interna
- custo de falha no verificvel - custo de falha verificvel
- custo de obteno da qualidade (COQ) - custo de preveno
- delegao - delegar competncia
- desenvolvimento de pessoal - desenvolvimento de recursos humanos
- dimenso da qualidade - disseminao de informaes
- efeito corrente - efeito paradigma
- efeito sinergia - eliminar a necessidade de inspeo em massa
- eliminar as barreiras entre os departamentos
- eliminar lemas, exortaes e metas - eliminar o medo
- eliminar padres de trabalho - empowerment
- empregado - empresa
- empresa de classe mundial - encantar o cliente
- enchanted customer - enfoque na organizao
- enfoque no cliente - enfoque no processo
enfoque no produto - engajar todos na realizao da transformao




160


- engenharia da qualidade - envolvimento dos empregados
- equipe de melhoria contnua - equipe de melhoria da qualidade
- especificao - espiral da qualidade
- estratgia empresarial - expectativa do cliente
- facilitador - filosofia Deming
- fornecedor - funo
- funo mercadolgica - funo qualidade
- funcionrio - funcionrio potencializado
- grupo de sntese - hardware
- humanware - incerteza
- input - instituir liderana
- instituir treinamento
- International Organization for Standardization (ISO)
- lder - liderana
- lista de conferncia - lista de controle
- lista de verificao - manual da qualidade (MQ)
- mapa de desenvolvimento do produto - memria social
- mercado de consumo - meta
- misso da empresa - motivao extrnseca
- motivao intrnseca - multiplicador
- necessidade do cliente - norma ISO 9000 (ISO 9000)
- norma ISO 9001 (ISO 9001) - norma ISO 9002 (ISO 9002)
- norma ISO 9003 (ISO 9003) - norma ISO 9004 (ISO 9004)
- nova filosofia - objetivo da qualidade




161


- organizao - organizao de classe universal
- organizao de qualidade total - organizao fornecedora
- output - paradigma
- paradigma da produo em massa - planejamento a longo prazo
- planejamento da qualidade - planejamento do processo
- planejamento estratgico (P. E.) - planejamento estratgico da qualidade
- planejamento ttico - plano
- plano da qualidade - poltica da qualidade
- processo
- programa brasileiro da qualidade e produtividade (PBQP)
- programa da qualidade - programa da qualidade do fornecedor
- programa da qualidade seis sigma - programa da qualidade total (PQT)
- programa de controle da qualidade (PCQ)
- projetar para a produtibilidade (DFM) - projetar para as operaes (DFO)
- projeto de qualidade - qualidade (Q)
- qualidade do fornecedor - qualidade naturalista
- qualidade percebida - quatorze pontos de Deming
- reao em cadeia - remover as barreiras ao orgulho da execuo
- requisitos da qualidade - retribuio indevida
- reviso do projeto - saber profundo
- sistema - sistema americano de produo
- sistema da qualidade (SQ) - sistema de garantia da qualidade (SGQ)
- sistema de informao da qualidade (SIQ)
- sistema de operaes - sistema de produo em massa




162


- sistema Ringi - software
- subotimizao - time da qualidade
- trilogia da qualidade - trilogia Juran
- triplo papel (TRIPOL) - unidade de negcio
- usurio - vantagem competitiva
- venda negativa

I.1.1. Mtodos estatsticos no planejamento da GQT em manufatura e servios
- brainstorming - brainwriting
- mtodo de teste - planilha de planejamento da qualidade
- sistema de medio - sistema estvel
- tempestade de idias - tempestade de idias escrita

I.1.2. Tcnicas de marketing no planejamento da GQT em manufatura e servios
- ambiente de marketing - antimarketing
- cadeia de valor - conceito de marketing
- funo de marketing - programa de marketing
- sistema de marketing - venda positiva

I.2. Controle da GQT em manufatura e servios (P II)
- abordagem por projetos - abordagem por sistemas
- administrao - administrao ambulante (MBWA)
- administrao da qualidade - administrao da qualidade total (TQM)
- administrao de operaes - administrao estratgica




163


- administrao multifuncional - administrao orientada para o processo
- administrao orientada para o resultado
- administrao participativa - administrao por objetivos (APO)
- administrao superior
- aferidor de maturidade da gerncia da qualidade
- alta administrao - alta-direo
- anlise de processo - anlise do valor (AV)
- atender s necessidades do cliente - atividades em pequenos grupos (APGs)
- auditoria - auditoria da qualidade
- auditoria da qualidade do processo - auditoria de certificao
- auditoria do fornecedor - auditoria do sistema da qualidade
- auditoria externa da qualidade - auditoria interna da qualidade
- autocontrole - clculo da qualidade
- clula - clula confusa
- clula focalizada - certificao de sistema da qualidade
- certificao ISO 9000
- conformidade com as normas ISO 9000
- certificado ISO 9000 - ciclo de controle
- ciclo de rotina - ciclo de vida do produto (CVP)
- ciclo PaFVA - crculos de controle da qualidade (CCQ)
- confiabilidade - conformao
- conformidade - controle da qualidade (CQ)
- controle da qualidade amplo empresarial (CQAE)
- controle da qualidade defensivo




164


- controle da qualidade na empresa inteira (CWQC)
- controle da qualidade ofensivo - controle da qualidade total (TQC)
- controle do processo - customizao macia
- diligenciamento da qualidade - dono do processo
- economia de escala - economia da qualidade
- economia de escopo - economia de integrao
- especializao flexvel - estao de trabalho
- estudo da potencialidade do processo (CpK)
- fool proof - funo de operaes
- gerncia da qualidade - gerncia de processos
- gerncia participativa - gerenciamento da qualidade
- gerenciamento da qualidade por toda a empresa (CWQI)
- gerenciamento da qualidade total (GQT)
- gerenciamento de produo just-in-time
- gerenciamento por objetivos (GPO)
- gesto - gesto da qualidade (GQ)
- gesto de operaes - gesto estratgica
- gesto estratgica da qualidade (GEQ) - gesto orientada para o processo
- gesto orientada para o resultado - gesto participativa
- gesto pela qualidade total (GQT) - gesto por objetivos
- implementao - indicador da qualidade (IQ)
- item de controle - item de verificao
- just-in-time (JIT) - linha de fluxo
- manutenibilidade - mtodo 5W 1H




165


- mtodo de anlise e soluo de problemas (MASP)
- no-conforme - no-conformidade
- nvel de qualidade aceitvel (NQA) - otimizao do sistema
- padro - padro de qualidade
- poka-yoke - problema de amanh
- problema de hoje - problema de qualidade
- procedimento operacional padro (POP) e (SOP)
- processador unitrio - produtividade
- proprietrio do processo - qualimetria
- quantidade de pedido econmico (EOQ)
- rastreabilidade - retrabalho
- rotina - sistema prova de falhas
- tarefa - taxa de resposta
- tecnologia flexvel - tempo de ciclo do sistema
- total quality control (TQC) - verificao

I.2.1. Mtodos estatsticos no controle da GQT em manufatura e servios
- amostragem aleatria - amplitude do processo
- anlise de Pareto - capacidade do processo
- carta de controle (C.C.) - carta de tendncias
- carta programada de processo de deciso (PDPC)
- causa acidental - causa aleatria
- causa atribuvel - causa comum
- causa especial - causa no-natural




166


- causa natural - coeficiente de capacidade do processo (CpK)
- coeficiente de potencial do processo (Cp)
- controle da qualidade de Shewhart - controle estatstico
- controle estatstico da qualidade (CEQ) - controle estatstico do processo (CEP)
- defeitos por milho (DPM)
- defeitos por milho de oportunidades (DPMO)
- defeitos por unidade (DPU) - definio operacional
- desvio padro - diagrama corrido
- diagrama de afinidade (D/Af) - diagrama de anlise de dados matriciais
- diagrama de rvore (D/Ar) - diagrama de atividades (D/At)
- diagrama de causa e efeito (DCE) - diagrama de disperso
- diagrama de flechas - diagrama de fluxo
- diagrama de Ishikawa - diagrama de matriz (D/Ma)
- diagrama de Pareto - diagrama de relaes (D/Re)
- diagrama espinha de peixe - diagrama PDPC
- disponibilidade - distribuio binomial
- distribuio de Poisson - distribuio normal
- estado de controle estatstico - estratificao
- fluxograma - folha de coleta de dados
- folha de verificao - funo de perda (FP)
- grfico corrido - grfico de controle (GC)
- grfico de controle de Shewhart - grfico de Gantt
- grfico de Pareto - gravidade, urgncia e tendncia (GUT)
- histograma - ndice CpK (CpK)




167


- inspeo - lei de Pareto
- limite inferior de controle (LIC) - limite inferior de especificao (LIE)
- limite superior de controle (LSC) - limite superior de especificao (LSE)
- limites de controle (LC) - limites de especificao (LE)
- matriz de priorizao (M/Pr) - matriz de relaes (M/Re)
- mtodo estatstico - mtodo estatstico de amostragem
- metodologia M/PCpS (M/PCpS) - nvel da qualidade (NQ)
- partes por milho (PPM) - princpio de Pareto
- princpio dos 80/20 - processo estvel
- processo sob controle estatstico - seis sigma
- sete ferramentas bsicas da qualidade (7FBQ)
- sete ferramentas estatsticas da qualidade total
- sigma - sob controle estatstico
- tcnica estatstica - tcnicas de amostragem
- variabilidade - variabilidade do processo
- variao aleatria

I.2.2. Tcnicas de marketing no controle da GQT em manufatura e servios
- administrao de marketing - gerncia de marketing

I.3. Melhoria da GQT em manufatura e servios (P III)
- ao corretiva - adaptabilidade
- alcanar o seis sigma - anlise competitiva
- aperfeioamento contnuo - aperfeioamento da qualidade




168


- aperfeioar o sistema - aprimoramento do processo
- benchmarking - certeza
- ciclo da garantia da qualidade - ciclo de Deming
- ciclo de melhorias - ciclo de realimentao
- ciclo de Shewhart - ciclo PDCA (PDCA)
- ciclo PFVL - competncia essencial
- competio seis sigma - concorrncia com base no tempo
- curva de fidelidade - deciso por consenso
- desafio do seis sigma - desdobramento da funo qualidade (DFQ)
- desempenho - desenvolvimento da qualidade
- despertar - dinmica da qualidade
- diretriz da qualidade - erradicao da causa de erros (ECE)
- esclarecimento - estabilidade dinmica
- feedback - garantia da qualidade (GQ)
- grupo de melhoria - inovao
- insatisfao do cliente
- instituir programa de educao e retreinamento
- kairyo - kaizen
- lies aprendidas - liderana da qualidade
- mapa da turbulncia do mercado - medida da qualidade
- melhoramento de servio - melhoria contnua
- melhorias
- mtodo para anlise e melhoria do processo (MAMP)
- objetivo dinmico - pagamento pela percia




169


- pdca amplo-empresarial - perfil de variedade e customizao
- prmio nacional da qualidade (PNQ) - processo de melhoria contnua
- processo de melhoria da qualidade - programa 5S
- programa de melhora da qualidade - prossumidor
- pudim instantneo - QFD real time
- qualidade assegurada (QA) - qualidade de vida (QV)
- qualidade de vida no trabalho (QVT) - qualidade total (QT)
- quality function deployment (QFD) - reengenharia
- reviso do sistema da qualidade - sabedoria
- shake dow - superar as expectativas do cliente
- total quality management (TQM) - treinamento
- treinamento de reciclagem - treinamento inicial
- treinamento integrado - voz do cliente
- warusa-kagen - zero defeito (ZD)

I.3.1. Mtodos estatsticos na melhoria da GQT em manufatura e servios
- sete ferramentas gerenciais da qualidade (7FGQ)
- sete novas ferramentas (7NF)

I.3.2. Tcnicas de marketing na melhoria da GQT em manufatura e servios
- composto de marketing - endomarketing
- marketing - marketing interno (MI)
- marketing mix





170


II. SETOR DE SERVIOS
II.1. Planejamento da GQT em servios (P I)
- alavancagem - auto-servio
- brief do servio - campo de servios
- canal de distribuio de servios - caracterstica intangvel dos servios
- caracterstica tangvel dos servios - caractersticas do servio
- classificao dos servios - cliente de servios
- cliente freqente - cliente misterioso
- cliente novo - cliente perdido
- cliente potencial - cliente recuperado
- cliente-fantasma - complexidade
- comprador de servios - comprador fantasma
- conceito de servio - conceito de servio self-service
- confiana do cliente - custo de recuperao
- custo de troca de fornecedor - custo do servio
- demanda de servio - dimenso da qualidade de servios
- divergncia
- elementos bsicos da viso estratgica de servios
- elementos integrativos da viso estratgica de servios
- empresa de servios - empresa prestadora de servios
- empresa-cliente - especificao do servio
- estratgia de acompanhamento da demanda
- estratgia de diferenciao - estratgia de distribuio para servios
- estratgia de nivelamento da capacidade




171


- estratgia de operaes - estratgia de operaes focalizada
- estratgia de servios - fbrica de servios
- foco - fornecedor de servio
- fornecimento de servio - franquia
- funo de linha de frente - indstria de servios
- integrao - interao
- interface - item de demanda dependente
- item de demanda independente - mapa perceptivo
- mass customized - mercado
- mercado de servios - mercado potencial
- misso do servio - modelo das cinco falhas
- norma ISO 9004-2 (ISO 9004-2) - organizao de servios
- organizao holding - organizao multidivisionria
- organizao por funes - organizao por mercado
- organizao por produto - organizao prestadora de servios
- organizao unificada - Ps do posicionamento do servio
- percepo - persistncia do servio
- planejamento da qualidade dos servios
- poltica de preos - portflio
- posicionamento - preo
- previso de demanda - previso de vendas
- princpio da continuidade - princpio da proximidade
- princpio da similaridade - programa da qualidade de servio
- projeto de servio - promessa de servio




172


- qualidade do servio - representante de servios
- segmento-alvo de mercado - servio
- servio ampliado - servio de massa
- servio essencial - servio individual
- servio interno - servio ncleo
- servio perceptvel - servio profissional
- servio revolucionrio - servio substituto
- servio tecnolgico - servio total
- servios - servios customizados
- servios de comparao - servios de convenincia
- servios especiais - servios facilitadores
- servios humanos - servios industriais
- servios personalizados - setor de servios
- sistema de distribuio de servios - sistema de prestao de servios
- sistema de prestao de servios opo fixa
- sistema de produo interface/suporte - sistema de servios
- sistema flexvel - sistema self-service
- suporte - utilidade
- valor agregado - valor fornecido
- valor percebido - viso estratgica de servios

II.1.1. Especificidade dos bancos no planejamento da GQT em servios
- agncia - agncia de corporate
- agncia private - banco virtual




173


- bancos - cliente institucional
- cliente particular - clientelizao
- empresa financeira - estudos de mercado bancrio
- floating - instituio financeira
- planejamento de marketing do banco
- planejamento e desenvolvimento do produto bancrio
- plano de marketing do banco - qualidade de projeto
- qualidade do servio bancrio - qualidade estratgica
- qualidade institucional da organizao - qualidade na gesto bancria
- segmentao de mercado - servio bancrio
- servio financeiro - setor bancrio
- terceiro sistema bancrio - zona de atrao da agncia

II.1.2. Tcnicas de marketing no planejamento da GQT em servios
- caractersticas do marketing de servios
- comunicao com o pblico - desenvolvimento do produto
- estudos de mercado bancrio - executivo de marketing
- heterogeneidade - homem de marketing
- instrumentos de marketing - macromarketing
- micromarketing - pacote de servios
- pesquisa de marketing - planejamento de marketing do banco
- plano de marketing do banco - pricing
- sistema de informaes de marketing (SIM)
- venda pessoal




174


II.2. Controle da GQT em servios (P II)
- administrao de servios - atendimento
- atendimento eletrnico - auditoria da qualidade do servio
- auditoria de conformidade - auditoria de eficcia
- auditoria do usurio - capacidade do servio
- ciclo de servio - ciclo de vida do servio
- ciclo do fracasso - ciclo do sucesso
- conformidade do servio - controle da qualidade do servio
- design do servio - durao do servio
- elementos do servio - fila de espera
- fluxo de processo do servio (FPS) - funo de payoff
- funo de retaguarda - funo de tolerncia
- gesto estratgica dos servios
- gesto pela qualidade total em servios (GQT em servios)
- informatizao - itens do servio
- nvel de capacidade do servio - nvel de demanda
- nvel de servio - nvel timo da qualidade (NOQ)
- operao de servio - padro de demanda
- padro de servio - ponto de equilbrio mvel
- pontualidade - prestao de servios
- prestador de servios - previsibilidade
- problema de servio - processo de prestao de servios
- processo de produo - processo de servio
- processo loja de servios - produo de servios




175


- produto do servio - produto intangvel
- quatro categorias da qualidade de servios
- quatro parmetros universais do desempenho do servio
- satisfao do cliente - tecnologia de informao
- tecnologia de materiais - tecnologia de mtodos
- tempo de ao - tempo de acesso
- tempo de espera - tempo do servio
- teoria das filas - transao de servio
- unidade de servio

II.2.1. Especificidade dos bancos no contole da GQT em servios
- atendimento face nica - atividades de marketing
- certificao de agncia bancria - ciclo de vida do cliente (CVC)
- farmcia financeira - qualidade de produo
- qualidade operacional

II.2.2. Tcnicas de marketing no controle da GQT em servios
- atividades de marketing - ciclo de vida do cliente (CVC)
- gerncia de campo - gerncia de produto

II.2.3. Mtodos estatsticos no controle da GQT em servios
- erros por milho (EPM) - erros por milho de oportunidades (EPMO)
- erros por unidade (EPU) - grfico PERT
- tcnica de anlise da avaliao do programa (PERT)




176


II.3. Melhoria da GQT em servios (P III)
- 4 Ps do servio - agir como pequeno porte
- alegria - controle do destino
- credenciamento - cultivo da marca
- dados demogrficos - dados psicogrficos
- dimenso determinante - dimenso importante
- embalagem de servios - empresa virtual
- esforo sobre-humano - estratgia de criar switching costs
- estratgia essencial - excelncia de execuo
- excelncia em servios - extremidades do servio
- fidelidade do cliente - garantia de servio
- generosidade - infopreneurs
- informao - informao experimental
- informao gerencial - informao operativa
- integridade - investimento no sucesso dos colaboradores
- liderana baseada em valores - lucro social
- modelo de sustentabilidade do sucesso - momentos da verdade
- momentos de contato - novos servios
- programa certifique-se - qualidade total em servios
- quarteirizao - rede de servios
- rede de servios de ncleo central nico
- regra FIFO - relacionamento baseado em confiana
- respeito - reverter a pirmide
- scorecard - sndrome da pizzaria




177


- terceirizao - trabalho em equipe
- treinamento em mltiplas funes

II.3.1. Especificidade dos bancos na melhoria da GQT em servios
- communication-mix do banco - marketing bancrio
- marketing extensivo - marketing intensivo
- mtodo PGP - metodologia de pesquisa TARP
- package - zero cliente perdido

II.3.2. Tcnicas de marketing na melhoria da GQT em servios
- communication-mix do banco - demarketing
- ferramentas do marketing de servios - inseparabilidade
- intangibilidade - marketing bancrio
- marketing de servios - marketing defensivo
- marketing extensivo - marketing intensivo
- marketing interativo - marketing ofensivo
- marketing share - simultaneidade

A busca por conceitos e princpios universais para a gesto pela qualidade total em
servios um fenmeno relativamente recente. Como conseqncia, a padronizao da
terminologia est em estgio de formao, embora sua existncia j seja considerada um fato.
Algumas UCEs so utilizadas com signficados especiais que diferem daqueles dados por
dicionaristas de lngua geral. Outras tm mltiplos significados. O leitor deve ter em mente




178


que ainda persiste muita confuso na linguagem da qualidade, embora, sem ser pretencioso,
este trabalho pretenda contribuir para elimin-la.
O que se buscou apresentar aqui foi uma espinha dorsal sobre a qual foi acomodada a
realidade da gesto pela qualidade total em servios, embora outras estruturas possam ser
propostas, dependendo da porta que seja aberta.
Seria interessante se todos os administradores e profissionais conseguissem padronizar
a terminologia utilizada para descrever conceitos, acordos e significados. Tal situao ainda
est distante, uma vez que existem alguns obstculos ativos padronizao nessa rea de
especialidade, como as diferenas entre a tecnologia, o dialeto e o histrico cultural das vrias
organizaes envolvidas na implantao dessa filosofia administrativa, a mutabilidade dos
ingredientes da adequao ao uso e os esforos deliberados dos seres humanos em criar e
utilizar uma terminologia que assegure benefcios para suas organizaes e para si mesmos.
A necessidade principal descobrir as realidades que se encontram por trs dos
rtulos, ou seja, os acordos, as atividades ou aquilo sobre o que as outras pessoas esto
falando. Uma vez atingida essa compreenso, a comunicao acurada pode acontecer, mesmo
que no haja unanimidade a respeito dos rtulos. Ao contrrio, se a comunicao acontece
apenas atravs dos rtulos, fcil se iludir e pensar que esteja havendo uma compreenso a
despeito do fato de que cada uma das partes no sabe, literalmente, sobre o que a outra est
falando.






179


II.4. Unidades de conhecimento especializado oriundas de traduo e suas adaptaes
lngua portuguesa
II.4.1. Modos de formao de unidades de conhecimento especializado
O objetivo deste subitem do item 4 do Captulo Fundamentos Tericos apresentar as
caractersticas principais que se observam quando da formao morfolgica das unidades de
conhecimento especializado (UCEs), por meio da anlise e da discusso das possibilidades
que a lngua portuguesa oferece aos especialistas no momento da criao dessas UCEs.
Sero abordadas apenas as possibilidades inerentes criao de UCEs, uma vez que
possvel inferir diferenciaes em relao formao de vocbulos pertencentes ao lxico
geral. Portanto, processos de derivao e composio lexical, muito comuns na lngua geral,
sero preteridos em razo de uma sistematizao mais aprofundada da criao de UCEs.
O presente subitem se justifica pelo fato de que uma das hipteses levantadas nesta
Tese diz respeito pesquisa quanto aos modos de formao utilizados pelos especialistas para
adaptarem lngua portuguesa UCEs que foram criadas em outras lnguas, uma vez que a
filosofia da GQT foi concebida nos EUA e implantada no Japo. Para se ter uma idia, do
corpus, composto por 29 (vinte e nove) obras, nada menos do que 14 (quatorze) foram
redigidas por americanos (em maior quantidade) e japoneses (em nmero menor). As outras
15 (quinze) so produes nacionais, mas no se olvida o fato de que as idias ali
desenvolvidas tm sua origem nesses autores estrangeiros. Portanto, a presena de tradues
de UCEs, em um primeiro momento, pode ser considerada significativa nessa rea de
especialidade. Posteriormente, na concluso, ser apresentado um levantamento estatstico
para se averiguar qual dos processos de formao apresentados foi o mais produtivo em
relao a essa adaptao das UCEs relacionadas GQT em servios.




180


A literatura j avanou bastante neste aspecto terico da Terminologia e alguns
estudiosos j realizaram pesquisas acerca dessa problemtica, dentre os quais vale lembrar
Alain Rey, Haensch, Danielle Corbin, Gouadec, Rondeau, Pierre Lerat, Cabr, Koucourek,
entre outros. Vale lembrar que as unidades lexicais, para todos esses autores, s se
transformam em UCEs quando definidas e empregadas em textos de especialidade. Pode-se
mencionar, inclusive, que as unidades lexicais so terminologizadas e que as palavras que
formam ou ajudam a formar as UCEs so terminognicas.
90

Seria interessante abrir um parnteses neste momento para justificar a escolha por
Unidade de Conhecimento Especializado (UCE), e no termo, na identificao das unidades
lexicais especializadas nos textos especializados que compem o corpus da pesquisa. Na
verdade, a denominao sempre gerou controvrsias e nunca foi aceita de forma padronizada
pelos diferentes segmentos que atuam na rea da Terminologia. Isto se deve, talvez, ao fato de
que se est diante do aspecto mais importante da cincia terminolgica e cada segmento
contribui de forma isolada para a denominao deste significante que a base de susteno da
cincia em foco.
No obstante a controvrsia criada, interessante observar como os estudiosos da
Terminologia concebem o seu prprio objeto de anlise. A definio de quem estabeleceu os
princpios da Teoria Geral da Terminologia, E. Wster, : "Uma unidade terminolgica
consiste em uma palavra qual se atribui um conceito com seu significado, ao passo que para
a maioria dos lingistas atuais, a palavra uma unidade inseparvel composta de forma e
contedo."
91


90
Cf. KOCOUREK, R. Op. Cit., 1991, p. 105.
91
Cf. KRIEGER, M. da G. O termo: questionamentos e configuraes. In: KRIEGER, M. da G.; MACIEL, A.
M. B. (Org.) Temas de terminologia, 2001, p. 67.




181


J para Alain Rey , "O nome o objeto mesmo da terminologia: com efeito, um nome
definvel no interior de um sistema coerente, enumerativo e/ou estruturado, um termo; o
contedo de sua definio correspondendo a uma noo (conceito), analisvel em
compreenso." Alm disso, acrescenta que "No plano nocional, para que um nome tenha
direito ao ttulo de termo, necessrio que ele possa, enquanto elemento de um conjunto (uma
terminologia) ser distinto de qualquer outro."
92

Por sua vez, Daniel Gouadec afirma que "Um termo uma unidade lingstica que
designa um conceito, um objeto ou um processo. O termo a unidade de designao de
elementos do universo percebido ou concebido. Ele raramente se confunde com a palavra
ortogrfica."
93

Seguindo nesta perspectiva, Rondeau traz a seguinte acepo que, alm do aspecto
sgnico, apregoa que "O termo caracteriza-se no sentido de que para uma noo dada h,
teoricamente, somente uma nica denominao. Esta caracterstica do termo se funda sobre
um outro postulado da Terminologia: o da relao de univocidade entre denominao
(significante) e noo (significado), relao do tipo reflexiva."
94

Em Pierre Lerat, l-se que "As denominaes tcnicas esto na lngua porque so
suscetveis de serem traduzidas em lngua estrangeira, mas so denominaes de
conhecimentos especializados, e isto que as torna pertinentes terminologicamente."
95





92
Cf. KRIEGER, M. da G. Op. Cit., p. 68.
93
Cf. KRIEGER, M. da G. Op. Cit., p. 68.
94
Cf. KRIEGER, M. da G. Op. Cit., p. 68.
95
Cf. KRIEGER, M. da G. Op. Cit., p. 69.




182


Esta pesquisa se identifica, entre todas as propostas tericas, com aquela de R.
Kocourek, em que esse autor menciona que "as unidades lexicais dos textos tcnico-
cientficos representam um subconjunto das unidades lexicais, ou de suas acepes, do
conjunto lexical de uma lngua, e que essas unidades lexicais tornam-se termos se so
definidas e empregadas em textos de especialidade."
96
Na verdade, este carter contextual do
termo reiterado em Cabr que diz:

El carcter de trmino se activa en funcin de su uso en um contexto y
situacin adecuados. Esta adecuacin consiste en uma seleccin de los
mdulos de rasgos apropriados, que incluyen los rasgos morfosintcticos
generales de la unidad u una serie de semnticos y pragmticos especficos
que describem su carcter de trmino de un determinado mbito. O
carter do termo ativa-se em funo do uso em um contexto e situao
adequados. Esta adequao consiste em uma seleo de contextos
apropriados, que incluem os contextos morfossintticos gerais da unidade e
uma srie de contextos semnticos e pragmticos especficos que descrevem
seu carter de termo em um determinado nvel.
97







96
Cf. ALVES. I. M. et. al. O lxico nas lnguas especializadas. In: SEMINRIO INTEGRADO DE PESQUISA
EM LNGUA PORTUGUESA, 2002, p. 1.
97
Cf. ALVES, I. M. et al., Op. Cit., p. 1.




183


De todas estas definies, possvel depreender um denominador comum: o estatuto
terminolgico de uma unidade de conhecimento especializado define-se por sua dimenso
conceitual, sendo, portanto, esta a sua qualificao primeira, ou seja, o que faz de um signo
lingstico uma UCE o seu contedo especfico, propriedade que o integra a uma
determinada rea de especialidade.
Dessa forma, entre as diversas possibilidades de nomeao dessa unidade lexical
terminolgica, a opo nome-la por UCE, j que concorre com a forma proposta pela
Teoria Comunicativa da Terminologia (TCT) que, por meio de Estop (1999), props a
denominao Unidade de Significao Especializada (USE) para o catalo. Em sua
argumentao, a autora afirma que estas unidades esto formadas por um ncleo (nominal) e
um complemento que so USEs, mas que a unidade em seu conjunto no forma um termo.
Em conjunto, elas podem ser definidas como unidades portadoras de conhecimento
especializado, lingsticas ou no-lingsticas (smbolos, frmulas), que se utilizam em
situaes de comunicao especializada. Entre as UCEs lingsticas, encontram-se as
unidades lxicas nominais prprias de uma rea especializada, unidades verbais, adjetivais e
adverbiais e unidades polilxicas, entre as quais se incluem as unidades fraseolgicas
especializadas e as combinaes especializadas recorrentes. Nesse sentido, um aspecto
importante que se observa a ampliao das unidades que podem ser consideradas como
objeto de estudo da terminologia, que incluem, alm das unidades nominais e verbais de
carter denominativo e referencial, outras unidades lingsticas que podem exercer esta
funo. Para a pesquisa, a mudana deveu-se ao fato de no se propor uma sigla que pudesse
gerar mais uma confuso na denominao da unidade, tendo-se por convico que ambas as
denominaes so sinonmicas.




184


A definio e redefinio de uma UCE constitui um fato terminolgico fundamental,
pois a natureza desse processo consiste na substituio de um novo significado ou um
significado precedente da mesma unidade lexical, ou seja, essa capacidade de as unidades
lexicais serem dotadas de significados superpostos ou justapostos acompanha todo ato de
formao terminolgica. Os tipos de formao terminolgica em lngua portuguesa so, em
efeito, numerosos e diversos.
O primeiro grande grupo a ser descrito refere-se formao de palavras
terminognicas complexas. Dentro desse grupo, merece ateno a derivao. Dentro dela,
sero mencionados os processos de denominao simples, derivao imprpria e regressiva, e
derivao prpria por prefixao, sufixao e parassntese. Aps a apresentao dessas
possibilidades de formao de UCE's terminognicas complexas, sero apresentados os
processos de confixao e de composio, alm de outros tipos de processos.
Quanto denominao simples, deve-se levar em conta que ela ocorre em
Terminologia como um caso de transio. Na verdade, esse caso de transio resulta
principalmente do fato universal de que os mesmos recursos formais intervm sob diferentes
nveis no plano da lngua, onde assumem funes diferentes.
98
H, na verdade, uma zona de
transio entre a derivao e a confixao, entre a derivao e a composio, entre a
composio e a confixao, entre a composio e a lexicalizao ou entre a lexicalizao e a
formao de sintagmas livres, ou ainda entre os recursos gramaticais e os lexicais. Todos
esses processos podem vir a configurar possibilidades de formao de UCEs, mas inegvel
que isso no ocorre com muita freqncia.

98
KOCOUREK, R. Op. Cit., p. 106.




185


No grupo da derivao, o tipo mais produtivo, segundo a literatura consultada,
99
o da
denominao simples. Consiste na denominao da UCE por meio de palavras simples ou
expresses braquigrficas simples, como o caso do vocbulo gua, que possui um
significado no dicionrio geral, mas que tambm tem sua especificidade terminolgica ao se
adentrar nos textos especializados da rea do meio-ambiente. Por outro lado, esse vocbulo
pode auxiliar na formao de sintagmas terminologizados, como o caso de gua
gaseificada, por exemplo.
Quanto derivao imprpria, ela ocorre quando duas palavras de forma parecida e
com a mesma origem surgem nos textos especializados como pertencentes a duas classes
gramaticais diferentes, ou seja, s vezes so empregadas como substantivos e outras como
adjetivos. Processo muito produtivo na lngua geral, tambm conhecido como hipotaxe ou
converso. o caso de falada que, na lngua geral, possui um significado de particpio
passado do verbo falar e que, na lngua de especialidade da rea de lingstica, auxilia na
formao do sintagma nominal lngua falada, com valor de adjetivo enquanto que acima
possui um valor de forma verbo-nominal, podendo, dependendo do contexto, ser adjetivo,
verbo ou hbrido. Um outro exemplo o vocbulo dirigvel. Empregado como substantivo ao
referir-se aeronave que mais leve do que o ar, passa a ser adjetivo quando empregado
em relao a um automvel que apresenta uma certa facilidade ao ser conduzido por um
motorista, no sintagma carro dirigvel.
Como a derivao imprpria, a derivao regressiva uma formao sem a presena
de sufixos. Conhecida tambm como reduo da raiz ou mesmo formao regressiva, ela
consiste em uma reduo do vocbulo. o caso de automvel formando auto e outras
possibilidades idnticas. No entanto, h uma certa confuso em relao formao dos verbos

99
Cf. KOCOUREK, R. Op. Cit., p. 106 et seq.




186


para substantivos, como em reclamar formando reclame, em que ocorre a perda da vogal
temtica (VT) e da desinncia modo-temporal (DMT) do infinitivo. Aqui, o correto seria falar
de derivao imprpria, pois o emprego dessa classificao formativa deve designar a relao
que existe entre um verbo e um nome que se relaciona com a base do verbo e que aparece sem
a sua DMT do infinitivo ou outra qualquer. O que importante, salvo essas preocupaes
formais, que existe um tipo de formao paralela sufixao, como em contribuir
contribuio, por exemplo, que cmoda para a conciso da lngua de especialidade.
Entrando na derivao prpria, conhecida tambm como afixao, v-se que ela se
efetiva por meio dos afixos, ou seja, prefixos e sufixos. Muito produtiva na lngua geral, nas
lnguas de especialidade tambm no diferente, mas h que se levar em conta algumas
especificidades. H derivao prpria se um ou mais morfemas se unirem a um morfema livre
(uma palavra, um radical) para criar um termo derivado como em chumbo chumbada. H,
por outro lado, confixao se dois ou mais morfemas livres greco-latinos se unirem e
formarem uma UCE confixada como em polmero, da rea de especialidade da qumica. H,
ainda, por sua vez, composio se dois ou mais vocbulos forem justapostos para criar uma
unidade gramaticalmente contnua, ou seja, uma palavra composta como em lava-vidros.
difcil distinguir entre derivao e confixao ou entre afixos e confixos. Se preciso, convm
utilizar, para esses dois tipos de morfemas, a UCE genrica formadores, anteriores e
posteriores base, segundo a posio em que eles se encontrem na UCE derivada ou
confixada. Dessa forma, possvel distinguir os formadores das palavras que constituem a
base do nome derivado ou os nomes constitutivos da UCE composta.
Colocando em evidncia apenas a derivao, chega-se concluso de que os prefixos
e os sufixos so morfemas. Os sufixos aparecem aps o radical e possuem a capacidade de
mudar a classe de palavras da UCE. Os prefixos surgem antes do radical e tambm podem




187


acarretar mudanas em relao classe de palavras da mesma. Como os afixos so
considerados formas presas, eles no possuem uma significao imutvel e, por isso mesmo,
esto sujeitos a um nmero infindvel de variao, que pode se dar por diversos fatores, entre
os quais os de ordem fontica, grfica, gramatical, etimolgica ou histrica. De qualquer
forma, os afixos so um meio importantssimo para a preciso e a sistematicidade inerentes a
uma terminologia. Ao encerrar a descrio desse primeiro tipo de formao, vale lembrar a
possibilidade de formao de derivao mltipla onde vrios afixos contribuem na formao
da UCE, e um caso especial de derivao mltipla, que a parassntese ou derivao por
afixos contnuos em que h a adio simultnea de um prefixo e de um sufixo base da UCE.
Se o objetivo fosse trazer todas as possibilidades de formao morfolgica por meio
dos afixos, seria possvel apresentar uma relao exaustiva com mais de cinco centenas de
prefixos e sufixos que auxiliam na formao de unidades de conhecimento especializado.
Como o objetivo apenas apresentar essas possibilidades, na concluso ser visto se esse
processo foi realmente produtivo na rea de especialidade eleita como objeto de pesquisa. No
entanto, possvel constatar a riqueza desses formadores como uma das caractersticas de
uma lngua de especialidade qualquer, que, s vezes, os busca na prpria lngua geral para
formar as suas UCEs.
O segundo tipo de formao de UCEs que ser apresentado a confixao, uma vez
que ela contribuir para completar o exame da formao de UCEs terminognicas complexas.
Aps essa apresentao, a composio ser examinada.
A base terica precedente acerca dos formantes conteve, entre outros, os radicais
gregos ou latinos ligados, que foram denominados de confixos ou radicais cientficos. Se dois
ou mais radicais se ligavam, com ou sem a adio de afixos, eles formavam uma UCE
confixada ou um confixo.




188


Conhecida tambm como interfixo e interfixao, nenhuma dessas denominaes
plenamente satisfatria, pois confixao e interfixao sugerem um parentesco muito estreito
com afixao e formao cientfica indica um sentido muito amplo para designar esse tipo de
formao. No entanto, a opo ser por confixao, como a maioria da literatura especializada
o prefere, com o significado de formao de palavras confixadas, que remetem a uma
caracterizao terminognica. o caso de UCEs como geometria, gemetro, barmetro,
audmetro, entre outras.
Os confixos aparecem limitados com origem morfemtica nas lnguas clssicas, ou
seja, o Grego e o Latim. A unio desses confixos se d normalmente por meio da submisso a
certas regras de formao. A ordem de apresentao dos mesmos particular: o confixo que
determina, que modifica, precede habitualmente o confixo que determinado, que rege. Na
UCE confixada pedologia, por exemplo, o confixo modificador pedo- precede o confixo
regente log + ia. Normalmente, possvel tambm identificar a ordem inversa, com o
regente precedendo o modificador, como em estudo do sol.
Na formao de confixos anteriores que terminam por vogal, efetua-se a ligao com a
consoante inicial do confixo posterior, mas pode haver uma eliso ou crase diante de uma
vogal. Seja anterior ou posterior, no raro que a mesma forma do radical constitua dois
confixos com variao, como em gramo- e grama, e fono- e fone, que formaram
gramofone e fonograma.
Por vezes, a confixao pode vir acompanhada de sufixao. Pode-se juntar um sufixo
a ela, como ia, em cirurgia, Geografia, Terminologia, Zootecnia, etc.
Um confixo como auto- no se associa somente a outros confixos, como em
autgrafo. Comportando-se como uma forma livre, pode formar falsos derivados, como




189


autista e autismo ou falsos compostos. Diversos casos de falsos derivados e compostos
representam uma certa transio entre a derivao, a confixao e a composio.
Sob o ponto de vista grfico, a aglutinao o processo mais produtivo, mas sem a
presena do hfen, que rara. Ele s empregado para evitar o contato entre duas vogais,
como em crio-anestsico, ou para tirar a ateno de um aspecto semntico, como em agro-
qumica, que evoca agronomia. Assim como os afixos, os confixos apresentam uma
enormidade de radicais que contribuem na formao de UCEs em todas as reas de
especialidade, mas que se destacam na formao de UCEs nas reas mdica e biolgica.
Os radicais das lnguas clssicas aparecem em grande quantidade nos dicionrios de
lngua geral, como tambm nas gramticas normativas por meio das listas dos radicais gregos
e latinos no captulo reservado formao das palavras. No entanto, so cada vez mais
utilizados em lnguas de especialidade que possuem uma terminologia moderna desenvolvida.
Estes radicais tm ainda contribudo na planificao e unificao internacional de sistemas
terminolgicos de diversas lnguas. Portanto, a confixao tem se transformado em um
processo muito produtivo na formao terminolgica, haja vista apenas aquelas iniciadas por
h, como homograma, hemisfrio, hexgono, hidrfobo, heterogeneidade, entre tantas
outras. Resta saber se essa produtividade tambm ser significativa em relao GQT em
servios.
Um outro tipo de formao que caracteriza a terminologia de uma rea de
especialidade a composio. Ela se d quando duas ou mais UCEs (palavras constitutivas)
se unem para dar uma unidade terminolgica graficamente contnua (uma UCE composta)
como em lava-vidros. Graficamente, h a presena da aglutinao, como tambm a utilizao
do hfen. H sempre uma oportunidade de confuso com os sintagmas nominais ou verbais




190


que, por sua vez, so separados por um espao em branco, como em gesto pela qualidade
total em servios.
A composio est muito prxima da confixao, mas nesta os componentes so os
morfemas ligados (hexa- + -grama, formando hexagrama) e naquela os componentes so
morfemas ou grupos de morfemas livres.
H um tipo de formao intermediria entre a derivao e a composio: trata-se da
formao que auxilia partculas anteriores, tais como meio, no, depois, onde a forma e a
funo se situam entre palavras e prefixos, como em meio-perodo. Eles so considerados, s
vezes, como prefixo e, s vezes, como componente de um composto.
H ainda um outro tipo de formao intermediria entre a confixao e a composio:
trata-se de reunir um confixo e uma palavra livre, como o confixo tele- e a palavra viso
para formar televiso. Essa possibilidade bastante produtiva em algumas reas de
especialidade.
O procedimento de formao da composio consiste sobretudo na justaposio
simples de palavras constitutivas. Certas reas de especialidade adotaram esse sistema de
composio como princpio internacional com vistas normalizao. A Associao Francesa
de Normalizao (Afnor) j normalizou alguns, como benzilcelulose. Um outro procedimento
o emprego da vogal de ligao entre os constitutivos. Ela aparece sobretudo no interior de
adjetivos compostos, ao final do morfema anterior. Assim como a vogal de ligao dos
confixos anteriores, ela possui a funo de unir os componentes do adjetivo composto, que se
apresentam, na maioria das vezes, coordenados. Esse tipo de procedimento muito produtivo
na linguagem jornalstica, como em euro-americano, belgo-luxemburguense, ou mesmo
franco-ingls-germano-americano. Tambm nas lnguas de especialidade, possvel essa
identificao, haja vista as UCEs lgico-matemtico ou fsico-qumico. Nesses compostos




191


apresentados, a vogal de ligao aparece ajustada ao sufixo adjetival de forma a se obter o
morfema ico.
Uma outra questo que poderia ser discutida relaciona-se ao estabelecimento da
identificao dos constitutivos como determinantes ou determinados. Isso poderia estabelecer
relaes de subordinao e/ou coordenao, mas o espao diminuto e o objetivo outro.
Posteriormente, se poder verificar tambm a produtividade desse tipo de formao em
relao rea de especialidade elevada a objeto de pesquisa.
Como contribuio terica identificao das formaes de UCEs terminognicas
complexas, foram realizadas distines entre a UCE-palavra, tal como perxido, e a UCE-
sintagma, como perxido de hidrognio, na rea de especialidade da qumica.
Foi possvel identificar ainda os modos fundamentais de formao de UCEs que foram
a derivao prpria (UCE + afixos), a confixao (confixo + confixo) e a composio (palavra
+ palavra), que auxiliam na formao de unidades de conhecimento especializado. Diferentes
combinaes desses trs modos possibilitam a criao de um grande nmero de tipos de
UCEs complexas. A ttulo de exemplo, vale citar alguns: barium (confixo + afixo = falso
derivado); lava-vidros (palavra simples + palavra simples = palavra composta elementar);
benzilcelulose (falso derivado + palavra derivada = composto de derivado); terminolgico-
lexicolgico (derivado de confixo + derivado de confixo = composto de derivado de confixo).
Todos esses exemplos so UCEs complexas com variados morfemas. Apesar de suas
complexidades, algumas dessas unidades no ultrapassam o nvel de palavra. As unidades que
ultrapassam esse nvel, e que se situam no mbito do sintagma, sero objetos do estudo
seguinte. Tudo isso com o intuito de se apresentar as possibilidades que a lngua portuguesa
oferece de criao de UCEs para, posteriormente, se averiguar quais processos foram mais
produtivos em relao terminologia da GQT em servios.




192


A formao de UCEs com vrios vocbulos denominada lexicalizao ou formao
sintagmtica, entre outras denominaes. Aquelas que interessam ao item apresentado
classificam-se como UCEs sintagmticas ou sintagmas terminolgicos. Como elas constituem
a terminologia de uma rea de especialidade dada, pelo critrio formal, constituiro o objetivo
deste estudo.
Na literatura existente sobre a questo,
100
pode-se encontrar uma variada lista de
denominaes das mais diferentes correntes de pesquisadores de lnguas francesa e inglesa.
No entanto, o que predomina que o sintagma lexical pode ser considerado como: i. uma
combinao de elementos em uma unidade mais elevada; ii. pertencente a um sistema
paradigmtico de unidades lexicais; iii. unificado pelo sentido, por suas propriedades
denominativas.
Antes da apresentao dos critrios de lexicalizao, sero apresentadas algumas
oposies fundamentais desse tipo de formao. Em primeiro lugar, h uma distino entre os
sintagmas lexicais e as palavras compostas, ou seja, estas so um tipo de unidade lexical com
uma s palavra que esto mais prximas do sintagma lexical. Em segundo lugar, pode-se
estabelecer uma diferena entre os sintagmas lexicais e outros tipos de grupos estveis, como
os grupos fraseolgicos. A terceira distino pode ser estabelecida entre o sintagma lexical e o
sintagma livre, como tambm entre aqueles e os sintagmas descritivos, definitrios ou mesmo
os sintagmas classificatrios ou catalogrficos que possuem uma estabilidade no sistema
lexical muito pequena ou quase nula. Entre os sintagmas lexicais, percebe-se ainda uma
diferena essencial entre eles e os sintagmas apelativos no-terminolgicos, os sintagmas
nomes prprios e os sintagmas terminolgicos (UCEs sintagmticas ou multiUCEs).

100
Cf. KOCOUREK, R. Op. Cit., p. 136 et seq.




193


Dentro desse iderio introdutrio, e tratando-se dessas distines, chega-se a se dar
conta de que se trata seguidamente de distines de grau sobre um continuum entre dois plos
opostos, com uma classe de casos equivocados entre as oposies nitidamente distintas. Todas
as decises relativas a esses casos de transio, se elas se impem, no sero seno uma
deciso operacional, j utilizada por pesquisadores renomados.
Entre os diversos tipos de sintagmas lexicais, a teoria apresentada se ocupar
basicamente com as UCEs sintagmticas nominais em lngua portuguesa, com suas
propriedades caractersticas e seus problemas de distino entre as UCEs sintagmticas e os
sintagmas livres em textos especializados. Essa preocupao pode ser justificada pelo fato de
que esse o tipo mais produtivo na grande maioria das UCEs sintagmticas utilizadas em
lngua de especialidade. No entanto, inegvel que outras pesquisas j se preocuparam com
as outras possibilidades, como os sintagmas verbais e a fraseologia.
Mesmo evocando, s vezes, exemplos da lngua geral, sero desenvolvidos apenas
aspectos suscetveis de interesse ao terminlogo, uma vez que a Terminologia constitui um
domnio por excelncia do sintagma lexical. A seguir, sero apresentados alguns critrios que
permitem vislumbrar esse processo de formao de UCEs.
O primeiro deles o sinttico. Posto isso, preciso formular a seguinte questo para se
adentrar nesta problemtica: o que distingue as UCEs sintagmticas nominais da lngua
portuguesa dos sintagmas nominais livres? Sob um ponto de vista fontico ou fonolgico,
pode-se mencionar o acento tnico, as pausas na fala ou at mesmo as ligaes sonoras nos
sintagmas livres em comparao com a ausncia total de tonicidade nos termos sintagmticos.
Sob o ponto de vista do significante, pode-se observar alguns ndices teis como as
maisculas, o hfen e at mesmo a utilizao do itlico para a distino entre um e outro. Mas,




194


sem dvida, no domnio da sintaxe, da semntica, das relaes sistmicas e de uso que os
sintagmas lexicais se manifestam em seus traos especficos.
Suas diversas configuraes implicam que os sintagmas lexicais comportam variados
vocbulos e que eles se situam entre as palavras compostas e os sintagmas livres. Sob a tica
gramatical, esses elementos constitutivos guardam as caractersticas das palavras, ou seja,
mantm sua individualidade morfolgica, sua forma lexical plena. No mais, este grupo de
palavras no se importa mais com a seqncia, pois esta pertence a uma estrutura sinttica
especfica, um sintagma nominal, por exemplo.
Os sintagmas que se poderiam considerar como potencialmente lexicalizados no
apresentam certas classes lexicais e certas formas gramaticais das palavras; contrariamente ao
que se poderia chamar de sintagma livre, os sintagmas lexicais tpicos possuem um repertrio
restrito de palavras fracas: encontram-se raramente artigos ou conjunes, como tambm no
h determinantes mediais outros que no os artigos definidos. No so encontrados pronomes,
verbos auxiliares ou mesmo preposies.
O determinante que inicia um sintagma nominal, apesar de fazer parte dos sintagmas
do texto, no pode ser considerado como um constitutivo dos sintagmas lexicais. O artigo
indefinido inicial pode apenas servir como um critrio de lexicalizao.
Do ponto de vista do significante, o sintagma lexical uma seqncia linear de
palavras. Ele pode tambm ser descrito por meio de uma frmula sinttica que compreende
uma seqncia de smbolos que representam, respectivamente, as categorias lexicais dos
constituintes. As frmulas produtivas de sintagmas lexicais so relativamente pouco
entendidas e descritas. No mais das vezes, pode-se encontrar substantivo + adjetivo,
substantivo + preposio + substantivo, substantivo + adjetivo + adjetivo, substantivo +
adjetivo + preposio + substantivo, entre outras.




195


O estudo dos sintagmas lexicais mais limitado do que o dos sintagmas livres. Ao se
observar alguns exemplos, chega-se concluso de que a quase totalidade de sintagmas
formada por at trs palavras. preciso, portanto, dar-se conta do fato essencial de que a
produtividade das frmulas mais estudadas restrita. Deve-se, ento, de modo sistemtico e
regular, estudar a possibilidade de decompor seqncias longas em sintagmas constitutivos
mais curtos, ou ser que existiria uma boa razo para no segment-los?
A limitao do nmero de palavras segue conjuntamente com a restrio aos tipos de
frmulas sintticas dos sintagmas lexicais. No entanto, patente que se ele se torna funcional
na comunicao entre os especialistas, essa restrio no se sustenta. Isso se d pela
introduo do critrio da maneabilidade sintagmtica ou maneabilidade pequena. A fim de se
verificar a maneabilidade de um sintagma criado, deve-se descobrir se um sintagma
entendido, que faz parte de uma lista, de um glossrio ou de uma norma, integra-se tambm
sem dificuldades aos textos de especialidade.
Esse critrio pode ajudar na segmentao dos sintagmas dbios que se encontram
seguidamente nas classificaes e nos catlogos de objetos materiais. Trata-se de sintagmas
perifrsticos. Josette Rey-Debove
101
cita o sintagma seguinte: maillot de bain fminin dune
seule pice dgageant les ctes, le bas du dos et les hanches. mai de banho feminino de
uma nica pea aberto de lado, abaixo das costas e dos quadris. Pode-se tambm mencionar
alguns compostos alemes como
Donaudampfschiffahrtsgesellschaftskapitnswitwenrentenauszahlungstag deus de muita
sorte ou a expresso normalizada pela DVI
Ultrakurzwellnberreichweitenfernfunkverbindung ultraconservador ou os

101
Cf. KOCOUREK, R. Op. Cit., p. 140.




196


criptocompostos ingleses como valve spool dirt excluding rubber washer steel spacer
vlvula espria excluda do espao.
Um outro caso extremamente interessante, e que ser desenvolvido no momento
apropriado, a utilizao das siglas e dos acrnimos que combinam, na comunicao
especializada, a maneabilidade sintagmtica de uma nica palavra com o carter semntico
descritivo do sintagma subjacente entendido: IPTU = Imposto sobre Propriedade
Territorial Urbana. Uma das funes concomitantes da sigla a de exprimir a inteno do
usurio, que pode considerar o sintagma subjacente como lexicalizado, apesar de sua
complexidade sinttica.
A especificidade, e a contradio inerente, dos sintagmas como Imposto sobre
Propriedade Territorial Urbana que eles deveriam ser de acordo com a inteno do
usurio apelao (palavras, UCEs), mas que no so, ao final, seno sintagmas descritivos
ou definitrios. Do ponto de vista da maneabilidade sintagmtica, esses sintagmas necessitam
ainda de um status lexical de apelao, no sentido de que sua significao s composta a
partir do entendimento da sigla como um todo sem recorrer possibilidade de repatriamento
das unidades lexicais quando encaradas individualmente.
A frmula sinttica linear no assinala a estrutura hierrquica das relaes internas das
UCEs. Nos sintagmas nominais subordinativos, o regente constitudo por um substantivo,
que modificado por diversos modificadores, tais como um adjetivo, um sintagma
preposicional (com um substantivo ou um infinitivo), um sintagma nominal ou uma
combinao desses elementos dados. O modificador pode ser por ele mesmo modificado, bem
entendido. Pode-se indicar a estrutura hierrquica por um diagrama de rvore ou por qualquer
tipo de parentetizao. Esse tipo de diagrama pode auxiliar o pesquisador a encontrar ainda




197


relaes semntico-sintticas entre os constituintes do sintagma, o que o auxiliar na redao
dos textos definitrios.
A especificidade semntica dos sintagmas lexicais foi estudada por
lexiclogos/terminlogos que propuseram vrios critrios sintticos que devero ajudar a
delimitar a lexicalizao ou, ao menos, a coeso sinttica interna dos sintagmas. Esses
critrios foram analisados exaustivamente por diversos autores e classificados por cada um
deles a partir de uma tica pessoal. Sero aqui apresentados em uma seqncia que tem por
base uma suposio que se pode reduzir s quatro operaes fundamentais: de deslocamento
(rearranjo, permutao); de expanso (aditamento, adio); de elipse (apagamento,
supresso); de comutao (substituio).
A primeira operao a do deslocamento do modificador ou, em outras palavras, o
critrio da mobilidade de posio ou de ordem invarivel das palavras constitutivas. Esse
critrio est limitado em sua aplicabilidade: para um significado dado ou para as palavras
constitutivas dadas, a ordem das mesmas nos sintagmas em lngua portuguesa, lexicalizados
ou no, ordinariamente estvel, determinada pela estrutura hierrquica e pelo tipo e
propriedades do modificador. Poder-se-ia no se vislumbrar diferena entre o gordo Carlos e
Carlos o gordo, mas seria difcil de o mesmo acontecer em relao a uma UCE.
Isso ocorre porque existem oposies potenciais com base na ordem das palavras.
Essas oposies so geralmente neutralizadas em favor de um outro membro, como em
mquina de escrever eltrica ou se poderia dizer mquina eltrica de escrever? O que se
observa que o sintagma preposicional de escrever est mais estreitamente ligado ao regente
mquina do que ao modificador adjetival eltrica.
Os testes de expanso comportam a expanso do regente ou a expanso do
modificador. A expanso do primeiro pode se efetuar em posio inicial, medial ou final, mas




198


sobretudo a expanso medial que merece ateno. Trata-se de um teste de inseparabilidade
das palavras do sintagma, quer dizer, a impossibilidade de interromper a seqncia pela
adio de modificadores.
A seqncia e o entendimento de um regente poderia ser interrompida ao se inserir um
novo modificador entre o regente e seu modificador? Em casos de sintagmas lexicais, isso
seria impossvel, mas ao tratar-se de sintagmas livres talvez isso seja possvel, como em
gesto pela qualidade total, para o primeiro caso, e poltrona de rodas/poltrona rosa de
rodas, para o segundo caso. Esses dois casos provam que existem graus de coeso interna dos
sintagmas e que a coeso interna de gesto pela qualidade total superior quela de
poltrona de rodas.
A expanso do regente por um outro modificador pode se dar em posio final? o
caso, por exemplo, de se retomar o sintagma mquina eltrica de escrever com o
modificador eltrica no meio e obter o sintagma mquina de escrever eltrica. Isso mostra
que a coeso interna de mquina de escrever mais comum.
Quanto expanso do modificador, possvel expandi-lo adicionando um novo
elemento no-lexicalizado um modificador do modificador sem esbarrar no significado
do sintagma original? O sentido do sintagma mudaria sem dvida se recebesse um advrbio
como muito ou um pronome como todo.
O terceiro grupo de critrios tem por base a elipse do modificador ou do regente do
sintagma. Pode-se suprimir, no contexto, o modificador e no retomar seno o determinante,
anaforicamente, como um substituto contextual do sintagma inteiro? Em um contexto como
Eu prefiro a estrada de ferro rodovia pedagiada, inaceitvel retomar estrada por
estrada de ferro, mas seria possvel retomar rodovia por rodovia pedagiada simplesmente,
como em Essa rodovia muito cara. H uma certa razo em afirmar-se que estrada de




199


ferro possui mais coeso do que rodovia pedagiada. A razo para isso que h uma
diferena semntica entre os dois regentes: estrada uma palavra mais geral e rodovia
mais especfica.
A comutao parecida com o critrio precedente da elipse. Graas sua natureza
semntica mais pronunciada, ela representa uma transio aos critrios semnticos que viro
na seqncia. Ela se d de duas formas diferentes: como substituio do modificador ou como
substituio do sintagma inteiro.
Sob a tica da primeira concepo, pode-se levantar a seguinte questo: possvel
substituir um modificador por outro? O sintagma sal da terra , em seu sentido especfico de
elite, um sintagma lexical porque da terra no pode ser substitudo por do mar sem causar
uma mudana semntica profunda. O sintagma cadeira de rodas, por outro lado, no seria
lexicalizado uma vez que de rodas pode ser substitudo por de doente sem mudana brusca
em seu sentido geral, cadeira de doente. Portanto, pode-se concluir que a palavra cadeira
reteve sua autonomia nos dois sintagmas analisados. J a palavra sal, no sintagma sal da
terra, est empregada em sentido figurado, o que dificulta a aplicao desse critrio.
Na segunda concepo da comutao, pode-se colocar a seguinte questo: possvel
substituir o sintagma inteiro por apenas uma palavra? Se isso for possvel, diz-se que o
sintagma estvel, como em batata da terra por batatinha, simplesmente. A comutabilidade
est baseada sobre a substituio entre os membros de um campo com a mesma base
semntica.
Um outro grupo de critrios j mencionado aqui tem por base a anlise da
compatibilidade sistmica (paradigmtica) do sintagma. Verifica-se a relao entre o sintagma
em questo e as outras unidades lexicais no-sinnimas, mas semanticamente parecidas, no




200


mago do sintagma lexical. A sistematicidade da UCE no mago da terminologia um dos
critrios importantes de apreciao de sries sinonmicas.
Ser abordado agora o critrio semntico: a imprevisibilidade semntica de um
sintagma cujo sentido no facilmente ou inteiramente dedutvel do sentido das palavras
constitutivas. Trata-se de encontrar o significado de um sintagma que no est sempre ligado
quele sugerido pelos elementos constitutivos do mesmo. Pode-se empregar questes simples
para estabelecer as distines de base e para julgar os sintagmas em relao
imprevisibilidade semntica. o caso de se perguntar se gua pesada realmente aquela
gua que pesada. Essa imprevisibilidade se aplica aos sintagmas especializados
considerados paradigmticos, fora do contexto, julgados por um destinatrio que conhece o
significado das palavras que constituem o sintagma, mas no conhece o significado especial
eventual do mesmo. Esse conceito mais psicolingstico em relao aos vrios fatores
lingsticos, que contribuem para a imprevisibilidade dos sintagmas: estrutura hierrquica do
sintagma, relaes semnticas subjacentes entre os constituintes, ambigidade das palavras
constitutivas, emprego figurado das palavras constitutivas, carter exocntrico do sintagma e
emprego verdadeiramente idiomtico (nico) de um constituinte.
Ainda se faz necessrio acrescentar que o critrio da imprevisibilidade vizinho do
conceito de transparncia (previsibilidade). Uma UCE no-transparente aquela que mostra
um desacordo entre o contedo sugerido pelos elementos constitutivos e o significado real,
convencional, ou seja, que demonstra um desacordo entre a formulao de sua motivao e
seu sintagma definicional.




201


H ainda um outro critrio de lexicalizao que, se no foi analisado pelos lingistas,
ao menos foi mencionado por eles: o critrio nico. Para mile Benveniste, um dos traos
que caracteriza o sintagma lexical (a sinapsia) o carter nico e constante do significado.
102

Ao lado desse trao est a exigncia de que o objeto nomeado seja designado completa e
unicamente pelo sintagma lexical que possui um significado nico e constante. Isso est de
acordo com o pensamento de outros lingistas, mormente os formuladores da TCT, que
insistem no fato de que as UCEs devem receber uma definio por parte dos especialistas da
rea dada. Essa questo uma propriedade essencial das UCEs, que deve ser caracterizada
no somente pelas UCEs-palavras como tambm pelas UCEs-sintagmas. Essa discusso leva
questo das definies em Terminologia, mas isso ser objeto de um outro subitem deste
Captulo Fundamentos Tericos.
O prximo critrio, e o ltimo critrio semntico que ser abordado, refere-se
natureza do sentido (do significado) e do referente (a coisa, o designado) que corresponda ao
sintagma dado. Existiria uma vivacidade onomasiolgica pertencente denotao,
denominao? Um ponto de vista adotado pela maioria dos especialistas indica que a
existncia mesma de um conceito especfico implica a criao, a existncia de uma apelao
para esse conceito. Essa vivacidade onomasiolgica denomina-se institucionalizao das
expresses que denotam classes de objetos que tm um papel mais ou menos marcado na vida
atual. Essa natureza do referente e do significado no o ltimo critrio de lexicalizao
simplesmente porque esse critrio no chega a fazer a distino entre uma apelao
lexicalizada de um conceito e o sintagma livre que descreve ou define esse mesmo conceito.
Aps essa tentativa de abrir os horizontes tericos acerca dos critrios sinttico e
semntico, agora a vez de se concentrar nos sintagmas lexicais por meio do critrio ligado

102
Cf. KOCOUREK, R. Op. Cit., p. 148.




202


ao uso, pois a integrao dos elementos constitutivos em uma unidade superior se faz com o
tempo e pela fora do uso pelos especialistas da rea dada.
sobretudo em relao freqncia que se pode examinar o problema do uso. A
lexicalizao dos sintagmas deve se dar a partir do estudo da freqncia da co-ocorrncia das
palavras constitutivas, que est estreitamente ligada estabilidade da forma sintagmtica e
estabilidade das relaes de significao. Como exemplo, pode-se citar o sintagma paralisia
infantil que pertence a um grupo binrio, o de maior ocorrncia nas formaes de sintagmas.
Neste estudo, foram apresentados os critrios de lexicalizao disponveis segundo a
literatura vigente. Para o encerramento dessa matria, ser apresentado um resumo que
converge para o fato de que o critrio essencial de lexicalizao em Terminologia a
existncia de uma definio especializada do sintagma analisado, mas antes de encontrar a
definio nos textos de especialidade, convm continuar a anlise da UCE-sintagma com o
intuito de se determinar o grau de lexicalizao desse sintagma. Para isso, necessrio
examinar as seis propriedades seguintes que so:
A. sua posio no mago da srie sinonmica e do sistema terminolgico dado;
B. sua estrutura sinttica linear e hierrquica;
C. sua maneabilidade sintagmtica;
D. sua imprevisibilidade semntica;
E. sua recorrncia atestada;
F. sua coeso sinttica.
Esses critrios precedentes so sobretudo sugestes que indicam as propriedades e os
procedimentos que se podem optar quando se leva em considerao o desejo de avaliar a
lexicalizao de um sintagma. Para se apreciar uma UCE sintagmtica, faz-se necessrio
conhecer a sua formao e previsibilidade. O entusiasmo pelas UCEs sintagmticas e sua




203


capacidade de nomear os conceitos no deve obscurecer o defeito fundamental desses
agrupamentos: um dos objetivos essenciais da denominao de um conceito a abreviao, a
criao de uma expresso breve que substitua uma longa descrio ou definio e que possa
funcionar melhor nos textos especializados. A partir desse ponto de vista, as UCEs
sintagmticas no so a soluo ideal do problema da denominao. A sua flexibilidade
formal e semntica, sua produtividade e sua quantidade, porm, so o procedimento
privilegiado da formao terminogrfica.
Retomando a proposio inicial do subitem do Captulo, vale lembrar que a derivao,
a confixao, a composio e a lexicalizao so os quatro tipos essenciais de formao
lexicogrfica e terminogrfica. No entanto, a lngua de especialidade pode recorrer a outros
procedimentos terminognicos, em que o emprstimo, a abreviao e o emprego figurado
fazem parte. Sobre esses procedimentos sero dados alguns esclarecimentos tericos.
O emprstimo um fenmeno universal no somente na evoluo de uma lngua, mas
igualmente no sistema lingstico observado sincronicamente em um momento dado. Ele
uma forma normal de enriquecimento lexical e, segundo Silva,

o problema do emprstimo lingstico no se resolve com atitudes
reacionrias, com o estabelecimento de barreiras ou cordes de isolamento
entrada de palavras e expresses de outros idiomas, como o fazem a
Alemanha e a Frana, por exemplo, que adaptam ortografia vigente de seus
respectivos idiomas tudo o que importado. Resolve-se com o dinamismo
cultural, com o gnio inventivo do povo e com as resolues para suprir as
necessidades dos especialistas das mais diferentes reas do conhecimento.
Povo que no forja cultura perde de criar unidades lexicais com energia




204


irradiadora e tem de se conformar, quer queiram seus gramticos, quer no,
condio de mero usurio de criaes alheias.
103


A teoria acerca dos emprstimos remonta ao sculo XIX com a Lingstica Histrica e
Comparativa, juntamente com os princpios dos neogramticos e sua crtica respectiva.
Posteriormente, h uma apreciao sistemtica desses dados at o estudo sobre os contatos
das lnguas, sobre o multilingismo e sobre as interferncias. Finalmente, dentro desse
apanhado histrico, dentro do domnio terminolgico, h a prtica e a teoria da evoluo das
UCEs oriundas de emprstimos, sua integrao ou substituio.
Afora essa preocupao histrica, o que interessa aqui definir essa UCE. Emprstimo
significa o ato (a ao, a procedncia) e o resultado do ato, ou seja, o elemento lingstico
emprestado (emprego metonmico). Ainda, tendo como base o critrio sincrnico, emprstimo
significa o fato de que as unidades lexicais existem no sistema lexical das lnguas.
Em relao ao elemento emprestado, pode-se falar de emprstimo fonolgico, grfico,
lexical, gramatical, textual, e pode-se distinguir tambm aquele de forma e de sentido. No
entanto, s ser emprstimo aquele elemento que apresente uma forma de unidade lexical,
pois enquanto uma forma de enriquecimento e de formao lexical, ele uma inovao do
prprio sistema que , em uma certa medida, sancionado para ele e que responde s suas
possibilidades e a seus desejos.




103
SILVA, Manoel M. A. da. Nenimos oriundos de traduo e suas formaes morfolgicas em lngua de
especialidade, Revista Acta Scientiarum, 2000, p. 33.




205


Apesar de pertencer ao lxico da lngua de chegada, o emprstimo contemporneo no
seno uma unidade lexical marginal, que se encontra no mais das vezes na periferia do
sistema lexical. Parece razovel delimitar o emprstimo como um elemento importante, mas
transitrio, do sistema lexical da lngua de chegada.
Na literatura terica sobre o objeto em questo,
104
tem-se at o emprstimo no interior
da mesma lngua, como os emprstimos de uma rea de conhecimento para outra. Isso no
condiz com os pensamentos arrolados aqui, uma vez que o mesmo tem de vir de uma lngua
de partida diferente da lngua de chegada. Nesse sentido, pelo critrio sincrnico, enquanto
componente marginal do sistema lexical, os emprstimos sero analisados enquanto
procedimento de integrao ou de substituio.
Vale a pena retomar neste momento aquilo que j foi descrito acerca de um caso
particular de emprstimo cientfico que emprega vrios morfemas na composio de unidades
lexicais: trata-se da confixao ou formao cientfica que faz uso dos morfemas gregos e
latinos. No entanto, deve-se acrescentar um nmero importante de outros internacionalismos
de origem variada, que atravessam as fronteiras e se tornam integrados em um nmero
elevado de lnguas ao redor do mundo. O mais importante deles, sem dvidas, o anglicismo,
ou seja, a influncia da lngua inglesa como lngua de partida. Esse fato se deve a que ela
mais apta para exprimir todas as noes cientficas ou tcnicas que proliferam no mundo
contemporneo, noes essas, na maioria das vezes, criadas nos Estados Unidos da Amrica,
pas cuja lngua oficial a lngua inglesa.



104
Cf. KOCOUREK, R. Op. Cit., p. 160 et seq.




206


Nos textos especializados, o emprego de UCEs inglesas motivado por diversos
fatores, alm desse aludido. Elas so empregadas, s vezes, porque na lngua portuguesa no
h a UCE correspondente ou ela no se traduz ao esprito do especialista. o que se
denomina de emprstimo de necessidade. Alm disso, as UCEs inglesas servem de suporte
para facilitar a compreenso de uma UCE portuguesa menos conhecida, ou ainda para
estabelecer a equivalncia entre a UCE portuguesa e a equivalente inglesa do qual se serve a
literatura especializada inglesa e que so vistas nos textos. Um outro tipo que no muito raro
o emprstimo alternado, nos textos, com o seu sinnimo autctone, ou seja, s vezes se
utiliza a forma inglesa ao lado da forma portuguesa. Pode ser uma questo de estilo de
variao para demonstrar que as duas formas esto estabelecidas na lngua em uso. Com o
intuito de serem admitidas no lxico portugus e utilizadas em seus textos, algumas UCEs
estrangeiras so mais ou menos adaptadas ao sistema da lngua portuguesa. o que se
denomina integrao (adaptao, assimilao, modificao) dessas UCEs estrangeiras.
sobretudo o grau dessa integrao que vale a pena ser mencionado aqui.
O primeiro deles a integrao fnica da UCE. Os fonemas ingleses so substitudos
por uma seqncia de fonemas portugueses que imitam a pronncia inglesa ou americana
como, por exemplo, spray, know-how, hardware. Um fonema de emprstimo pode ser
transportado para a pronncia portuguesa, como o /-ing/ de planning. Essa integrao fnica
no normalizada seno raramente, existindo, assim, muitas variantes.
Alm da integrao fnica, h a integrao grfica que se pode observar em alguns dos
dicionrios de lngua geral mais utilizados no Brasil, com alguns apresentando grafias
prximas transcrio fontica, como em choque, do ingls choke.




207


A integrao pode ser tambm lxico-morfolgica, sobretudo sufixal como em
continer (ingls container), em que o sufixo ingls foi substitudo pelo sufixo
correspondente em lngua portuguesa.
Do ponto de vista morfolgico, a vantagem do emprstimo , entre outras, que o
elemento algeno est desprovido dos efeitos da motivao e da conotao das unidades
lexicais autctones. Por vezes, a integrao de uma forma algena est acompanhada de um
deslize semntico que no repassado para o emprstimo na lngua de chegada, como em
parking, que significa to somente a ao de colocar o carro no parque de estacionamento,
mas em portugus utilizado sem o acrscimo existente no ingls: parking lot.
Uma vez lexicalizadas, as UCEs vo sofrendo uma evoluo semntica ou
morfolgica autnoma. Como exemplo, pode-se citar a UCE inglesa tennis player que veio do
francs tenez e que depois retornou Frana e utilizado tambm no Brasil sob a forma
inglesa tennis, aportuguesada para tnis. Trata-se, em relao utilizao francesa, de um
reemprstimo.
Se o emprstimo no encontra respaldo, o aportuguesamento toma uma forma mais
drstica e recorre-se ao decalque. Esse consiste na substituio do emprstimo por sua
traduo literria ou pela imitao autctone de seu tipo de formao ou de motivao. Esse
procedimento muito criticado, sobretudo por pessoas que prezam a pureza da lngua e do
importncia exagerada a um purismo que deve respeitar os processos de formao naturais de
sua lngua. No entanto, inegvel que o decalque constitui um dos procedimentos neonmicos
mais eficazes. Alm disso, o decalque pode ser considerado um dos meios mais importantes
de harmonizao internacional.
Deve-se considerar tambm que, ao substituir o emprstimo por um decalque, perde-se
certas propriedades do mesmo, tais como o efeito estilstico de uma expresso algena




208


(emprstimo de luxo), mas se ganha na obteno de uma forma que tem a vantagem de ser
portuguesa e possuir uma motivao internacional.
Se o decalque no resolve o problema da nominalizao, rejeita-se completamente a
influncia formal do emprstimo e o substitui por uma outra unidade lexical, ou seja, recorre-
se a numerosos tipos de formao lexical para criar uma nova unidade (um neologismo, um
nenimo). Dentro dessa concepo, o papel principal das comisses de terminologia da
ABNT deveria ser o de ajudar o usurio a resolver a oposio entre os sinnimos concorrentes
ou criar e normalizar as unidades lexicais novas que teriam a funo de facilitar a
comunicao especializada em lngua portuguesa.
O carter controverso do emprstimo terminolgico no seno um exemplo do
conflito constante entre a preocupao com a salvaguarda e defesa da homogeneidade das
lnguas, de um lado, e a tendncia internacionalizao, uniformizao e universalizao
das terminologias, de outro. So as reas de apreciao e de harmonizao terminolgicas nos
respectivos comits que devem fazer frente a este conflito. De qualquer forma, o emprstimo
lingstico segue sendo um importante modo de nominalizao a qualquer lngua de
especialidade e tem sua importncia comprovada pelo critrio da ocorrncia e do uso. Ser
que esse fato ser confirmado na pesquisa em curso?
A respeito das outras possibilidades de formao de UCEs que a lngua portuguesa
oferece, vale citar a questo da abreviao em Terminologia. A abreviao um fenmeno s
vezes corrente e s vezes perifrico nos textos especializados e no sistema das lnguas. , em
todo o caso, um fato especfico e eminentemente lingstico. Ela compreende a truncao e as
siglas, mas a braquigrafia (grafia breve, curta) tambm poderia fazer parte desse grupo. No
entanto, uma parte das unidades lexicais braquigrficas so unidades abreviadas ou suas
variantes, reunidas ou no com outros elementos, motivo pelo qual estaro fora dessa




209


descrio, pois no h interesse para essa pesquisa em descrever possibilidades como kw
(kilowatt), etc. Por outro lado, as siglas representam um tipo importante de unidades lexicais
braquigrficas abreviadas, pertencentes a um sintagma, e por isso sero descritas no decorrer
da apresentao.
Como o emprstimo, a palavra abreviao pode ter vrias acepes: i. o ato de
abreviar uma expresso lingstica; ii. a unidade lingstica que resulta desse ato; iii. a
existncia de unidades lingsticas agregadas no sistema lexical. Os quatro tipos de
abreviao lexical so a formao de smbolos alfabticos, a truncao (e sobretudo a
apcope), a elipse e a siglao.
A abreviao extrema de uma palavra a formao de formas reduzidas a uma letra ou
duas, que funcionam como se fossem uma palavra, ou seja, enquanto variantes grficas ou
sinnimas da UCE utilizada. Isso j foi mencionado quando se tocou na questo dos smbolos
alfabticos abreviados, como kw, etc., e a proposta seguir para a descrio da truncao.
A truncao a formao de uma UCE abreviada a partir de uma nica palavra-fonte,
cuja forma aparece reduzida a um pedao da slaba que, no entanto, possui duas letras (dois
fonemas). A literatura assim a definiu: contrao de um texto por meio da supresso de suas
partes. Ela entra no sistema lexical sobretudo por intermdio dos emprstimos e da lngua
falada, como em pneu (mtico). Alguns tipos de truncao so mais produtivos. Vale
mencionar, por exemplo, a afrese (supresso de uma parte inicial da palavra, como em bus
para nibus), a sncope (supresso de uma parte medial) e a haplologia (caso especial de
sncope em que se suprime um dos dois elementos mediais sucessivos identificados, como em
alcmetro para alcometro). O tipo de truncao mais freqente a apcope, ou seja, a
supresso da parte final da UCE, como em quilo (grama), moto (cicleta), e abreviaes
apocpicas monossilbicas, como pneu, etc. Ela tambm pode se dar em uma das palavras




210


constitutivas de um sintagma e o resultado uma UCE composta, como em eurafricano para
euro-africano. Ela ainda pode ser mltipla e se configurar sobre variadas palavras de um
grupo de palavras com o resultado sendo uma UCE composta especial, como em infoterm
para informao + terminologia. Com o advento dessas possibilidades, crvel afirmar-se
que a apcope mltipla conduz siglao. Um outro tipo particular de truncao a
acronmia (UCE composta contaminada, forjada pela apcope do primeiro elemento e pela
afrese do segundo), como em transistor para transferncia + resistncia. No entanto, a
abreviatura de sintagmas pode tomar outras formas alm dessas descritas, como se ver a
seguir.
A elipse lexical cria novas unidades lexicais, suprimindo uma ou vrias palavras
constitutivas do sintagma ao se obter nova unidade lexical abreviada com um nmero
reduzido de palavras, como em um (carro) oito-cilindros ou em plula (anticoncepcional).
J a siglao emprega um procedimento diferente. Ao invs de suprimir os
determinantes do sintagma, como o faz a elipse, o processo guarda a letra inicial (ou um
grupo de letras inicial) dos mesmos, como em Associao Brasileira de Normas Tcnicas
(ABNT), constituindo um caso extremo de apcope mltipla. necessrio insistir, neste
momento, que a sigla uma unidade lexical, pois sempre os especialistas fazem uma
descrio lingstica ao utiliz-la, normalmente logo aps o seu uso. Ela braquigrfica, s
vezes possui morfema de plural, consegue criar derivados e tambm conhece formas de
expanso, o que denota a sua especificidade, que se integra morfologia inerente ao sistema
lexical. Um tipo de sigla muito empregado a chamada sigla soletrada, que formada pelas
iniciais pronunciadas letra a letra, de maneira a no formar palavra, como em Comunidade
Econmica Europia (CEE), com at quatro letras. Ela interessante sobretudo sob dois
pontos de vista: primeiramente, os signos so silbicos, o que constitui uma importncia nos




211


dias de hoje; segundo, o sistema de fonemas coloca sua importncia nessas siglas soletradas e
reduzidas. Um outro tipo refere-se sigla integrada, que pronunciada como uma palavra,
como em objetos voadores no identificados (Ovni). Esse tipo de sigla representa uma etapa
mais avanada de adaptao da sigla ao sistema lxico plenamente articulado, pois a nova
UCE est constituda de fonemas indicados pela unio das letras da sigla. inegvel o
entusiasmo que essa possibilidade de formao oferece aos especialistas, uma vez que ela
possui uma preciso descritiva condensada, possibilidades internacionais de normalizao e
flexibilidade em sua formao.
Alm desses aspectos descritivos de formao terminogrfica abreviativa, vale
mencionar, para encerrar esta descrio, os aspectos semnticos que auxiliam na formao de
UCEs. Nessa descrio, o emprego da metfora e da metonmia faz-se necessrio.
Diferentemente dos modos de formao j descritos, o emprego figurado no cria novas
formas de unidades lexicais, mas ele pode acompanhar a formao por derivao, por
confixao, por lexicalizao e por emprstimo.
A oposio e a complementaridade entre o emprego figurado e o emprego prprio
uma das distines essenciais nos textos e no sistema da lngua. Essa dicotomia irredutvel.
O emprego figurado j foi estudado sob diversos aspectos, como a mudana semntica, a
motivao e a transferncia de significado terminolgico ou nocional. medida que h uma
mudana de significado da UCE j disponvel, o emprego figurado possibilitaria uma certa
confuso e um perigo de impreciso? Ele no seria incompatvel com a preciso inerente a
uma cincia? A resposta no, pois nenhuma lngua de especialidade nem tampouco outros
sistemas semiticos utilizados pelas cincias esto desprovidos de elementos figurados. A
questo, portanto, no excluir a linguagem figurada, mas sim descrever a sua utilizao em
lngua de especialidade.




212


A proposta distinguir trs tipos de emprego figurado. O primeiro deles refere-se
comparao e analogia universais que acompanham o pensamento humano. Trata-se de um
recurso do pensamento que veicula o saber em uma medida que no se comea seno em um
sentido de entrev-lo. Essa concepo de metfora ser aqui denominada de analogia
cognitiva. Nas ltimas dcadas, esse tipo de metfora tem sido muito freqente na literatura
filosfica, semitica, psicolgica e lingstica. Essa exploso do estudo da analogia cognitiva
ser um aporte epistemologia e compreenso do conceito de analogia, de comparao e de
metfora que sero aqui desenvolvidos.
O segundo so os tropos livres (nicos, no lexicalizados), ou seja, as metforas vivas.
Elas so um princpio universal da lngua medida que modifica virtualmente todos os
determinantes. A metaforizao vive nas frases e nos textos, sendo ento analisvel no plano
lexical, frsico e textual. Ela pode estar ligada comparao figurada, diferente da
comparao cognitiva nos textos tcnicos. Ela est fundida sobre um contato, real ou
subjacente, entre dois lexemas semanticamente parecidos, mas funcionalmente dspares. A
colocao desses lexemas inslita e a relao essencialmente diferente daquela entre
hiponmia e hiperonmia, ou entre dois co-hipnimos ou entre dois co-hipernimos. Essa
questo que distingue, normalmente, a comparao e a analogia cientfica da analogia
figurada. As metforas esto baseadas nos semas no-definitrios, s vezes contextuais,
etimolgicos, opacos, que so, no entanto, reveladores. A metfora viva potencialmente
polivalente e implica um elemento de subjetividade, de cumplicidade, de segredo.
O terceiro tipo de metaforizao a metfora lexical, que pertence aos tropos lexicais
(repetidos), em que o sentido figurado se torna sistmico, ou seja, trata-se de uma nova
acepo que faz parte do sistema lexical. Esse ltimo tipo um aspecto familiar de formao
terminolgica, como em estrutura profunda.




213


Ao se comentar sobre metfora e metonmia em Terminologia, h uma limitao
relacionada aos casos de metfora e metonmia lexicais em que a linguagem figurada foi
admitida ao sistema lexical da lngua de especialidade. Em outras palavras, o mais importante
o tropos necessrio que intervm para cobrir uma lacuna no lxico, que consiste no fato de
que um signo j afetado por uma idia inicial seja tambm influenciado por uma idia nova
que ela mesma no tinha fundamento na lngua em questo. Se as novas acepes figuradas
forem definidas e empregadas nos textos de especialidade, os tropos lexicais ajudam a formar
as UCEs novas. O significado dessas UCEs pode ser esclarecido, mas no definido pela
motivao figurada. A definio ser decisiva nesse caso.
Em resumo, entende-se por emprego figurado, em Terminologia, o fato de que o
significado de uma UCE est em desacordo com o sentido ordinrio de um vocbulo que
constitui a UCE, em que o desacordo tem por base uma relao especial de parentesco. Nesse
caso de metfora, essa relao de parentesco aquela de similitude, de semas comuns, de base
semntica comum. Nos casos de metonmia, a relao de contigidade.
A complexidade morfolgica e sinttica das unidades lexicais metafricas (e das
UCEs metafricas) e seu entendimento foram menos estudados do que seu aspecto semntico.
Faz-se necessrio retomar que as metforas lexicais so por vezes paralelas em vrias lnguas,
sem necessariamente possuir o significado idntico. O acordo metafrico entre duas lnguas
pode ser dado pelo fato de que a UCE metafrica na lngua no seno um decalque de uma
UCE metafrica de uma outra lngua. Ele tem um atrativo internacional incontestvel.
As UCEs-palavras metafricas so geralmente mais raras do que as UCEs compostas e
as UCEs-sintagmas, cujo constituinte aparece empregado em um sentido metafrico. J foi
mencionado que um mesmo sintagma pode ser livre e lexical e isso ocorre tambm em relao
metfora, ou seja, o sintagma pode ser metafrico ou no, dependendo do contexto em que




214


se inserir. Em relao a isso, interessante notar que a UCE metaforizao de uma UCE
designa no somente a motivao metafrica de uma UCE, como tambm o emprego
metafrico, em lngua geral, de uma palavra especializada. As partes do corpo humano
prestam-se em maior nmero para a efetivao dessa tendncia, como em olho mgico, que
seria considerada uma metfora antropomrfica. H tambm a metfora zoomrfica que
caracteriza a composio popular metafrica do tipo parte do corpo + de + animal, como em
olho de boi.
Esse caso mostra a fora e a fraqueza da motivao metafrica: de um lado, h o valor
pictural, o poder de evocao, o carter concreto e vivo e, de outro, constata-se a falta de
sistematicidade, a falta de indicaes objetivas e, em particular, a ambigidade, ou seja, a
aplicabilidade de a mesma metfora possuir uma quantidade mais elevada de casos diferentes,
como no caso de olho de boi, que pode designar uma planta, um animal, uma janela redonda.
Em comparao com a metfora, a metonmia um pouco menos freqente, mas ela
intervm nos textos mais seguidamente do que a metfora. Fala-se em metonmia se a relao
entre o significado da UCE e o significado comum da palavra que constitui a UCE aquele de
contigidade. Esse conceito de contigidade foi definido sobretudo pela tradio retrica, e
ele ser delimitado aqui pela enumerao dos tipos principais de metonmia.
Um deles, a sindoque, representa a relao entre a parte e o todo, entre o mais e o
menos e a relao de incluso. Alguns estimam que a sindoque um caso particular de
metonmia e outros a classificam parte.
Um outro tipo de motivao metonmica que est bem representado em Terminologia
a relao entre atividade e resultado. Um outro encontra-se em inventor e inveno,
descobridor e descoberta, produtor e produto, como em diesel (de Rudolf Diesel). Um outro




215


ainda encontra-se entre lugar e produto, como entre beaujolais e a costa do mesmo nome na
Frana.
Conclui-se, portanto, que a metfora e a metonmia lexicais so dois aspectos
semnticos de criao que permitem o enriquecimento da Terminologia sem recorrer a
significantes novos.
Aps toda essa descrio das possibilidades que a lngua portuguesa oferece para a
criao de UCEs, ser apresentado um quadro que resuma a problemtica dos tipos de
formao terminolgica. Essas possibilidades sero, posteriormente, retomadas sob forma de
quadro sintico e acrossmico, para a apresentao estatstica dos tipos de formao que se
mostraram mais produtivos em relao CGT em servios.

QUADRO-RESUMO DAS POSSIBILIDADES DE FORMAO DE UCEs
ORIUNDAS DE TRADUO COM SUAS PROVVEIS ADAPTAES LNGUA
PORTUGUESA
I. FORMAO ESSENCIAL DE UCEs TERMINOGNICAS COMPLEXAS
I.1. Derivao
I.1.1. Denominao simples
I.1.2. Derivao imprpria (hipotaxe ou converso)
I.1.3. Derivao regressiva (reduo da raiz ou formao regressiva)
I.1.4. Derivao prpria (afixao)
I.1.4.1. Derivao prpria por prefixao
I.1.4.2. Derivao prpria por sufixao
I.1.4.3. Derivao mltipla (parassntese)





216


I.2. Confixao (radicais cientficos greco-latinos)

I.3. Composio
I.3.1. Composio por aglutinao
I.3.1.1. Composio por aglutinao que auxilia partculas anteriores
I.3.1.2. Composio por aglutinao de confixo com palavra livre
I.3.2. Composio por justaposio (com ou sem hfen)
I.3.2.1. Composio por justaposio simples
I.3.2.2. Composio por justaposio com emprego de vogal de ligao

I.4. Lexicalizao ou formao sintagmtica
I.4.1. Critrios de formao
I.4.1.1. Formao pelo critrio sinttico
I.4.1.1.1. Deslocamento
I.4.1.1.2. Expanso
I.4.1.1.3. Elipse
I.4.1.1.4. Comutao
I.4.1.2. Formao pelo critrio semntico
I.4.1.2.1. Estrutura hierrquica
I.4.1.2.2. Relaes semnticas subjacentes
I.4.1.2.3. Ambigidade
I.4.1.2.4. Emprego figurado
I.4.1.2.5. Carter exocntrico
I.4.1.2.6. Emprego idiomtico




217


I.4.1.2.7. Emprego nico de Benveniste
I.4.1.2.8. Natureza do sentido e do referente
I.4.1.3. Formao pelo critrio do uso
I.4.1.3.1. Freqncia

I.4.2. Tipos de formao sintagmtica
I.4.2.1. Sintagma lexical nominal
I.4.2.2. Sintagma lexical verbal
I.4.2.3. Sintagma lexical fraseolgico

II. OUTROS TIPOS DE FORMAO DE UCEs TERMINOGNICAS COMPLEXAS
II.1. Emprstimo
II.1.1. Em relao ao elemento emprestado
II.1.1.1. Emprstimo fonolgico
II.1.1.2. Emprstimo grfico
II.1.1.3. Emprstimo lexical
II.1.1.4. Emprstimo gramatical
II.1.1.5. Emprstimo textual
II.1.1.6. Emprstimo de forma
II.1.1.7. Emprstimo de sentido

II.1.2. Em relao ao interior da mesma lngua
Emprstimo de uma rea de conhecimento para outra





218


II.1.3. Em relao a outros fatores
II.1.3.1. Emprstimo de necessidade
II.1.3.2. Emprstimo alternado com seu sinnimo autctone
II.1.3.3. Emprstimo de integrao
II.1.3.3.1. Emprstimo de integrao fnica
II.1.3.3.2. Emprstimo de integrao grfica
II.1.3.3.3. Emprstimo de integrao lxico-morfolgica
II.1.3.4. Emprstimo lexicalizado (aportuguesado)
II.1.3.4.1. Emprstimo lexicalizado com evoluo semntica autnoma
II.1.3.4.2. Emprstimo lexicalizado com evoluo morfolgica autnoma
II.1.3.4.3. Decalque

II.2. Abreviao (aspectos descritivos)
II.2.1. Formao de smbolos alfabticos (abreviao extrema uma letra ou duas)
II.2.2. Truncao
II.2.2.1. Afrese (perda inicial)
II.2.2.2. Sncope (perda medial)
II.2.2.2.1. Haplologia (perda medial de elemento idntico)
II.2.2.3. Apcope (perda final)
II.2.2.3.1. Em uma das palavras constitutivas do sintagma
II.2.2.3.2. Mltipla
II.2.2.4. Acronmia (UCE composta contaminada)
II.2.3. Elipse lexical
II.2.4. Siglao




219


II.2.4.1. Soletrada (at quatro letras)
II.2.4.2. Integrada (a partir da pronncia como palavra)

II.3. Abreviao (aspectos semnticos)
II.3.1. Emprego figurado
II.3.1.1. Metfora lexical
II.3.1.1.1. Analogia cognitiva
II.3.1.1.2. Tropos livres
II.3.1.1.3. Tropos lexicais
II.3.1.2. Metonmia lexical
II.3.1.2. Sindoque
II.3.1.2.1. Parte/todo
II.3.1.2.2. Atividade/trabalho
II.3.1.2.3. Inventor/inveno
II.3.1.2.4. Descobridor/descoberta
II.3.1.2.5. Produtor/produto
II.3.1.2.6. Lugar/produto
Dessa forma, a partir da apresentao de todas estas possibilidades, crvel afirmar
que a lngua portuguesa oferece inmeras oportunidades de formao de UCEs sejam elas
forjadas no lxico materno ou oriundas de traduo. Assim, a segunda hiptese defendida
nesta Tese tambm encontrou respaldo, ou seja, o idioma consegue acompanhar o
desenvolvimento tecnolgico de qualquer rea de especialidade porque o mesmo possui
mecanismos de adaptao de estrangeirismos e de criao de UCEs como qualquer outro.
Aps a apresentao do Dicionrio terminolgico da gesto pela qualidade total em servios,




220


sero apresentados os resultados das ocorrncias das formaes de UCEs e ser verificado
qual dos diversos tipos de formao apresentados mostrou-se o mais produtivo na rea de
especialidade estudada. Isto possibilitar uma resposta terceira hiptese aqui colocada.
Como teriam ocorrido essas adaptaes ou quais processos formadores foram utilizados para
que a terminologia da gesto pela qualidade total em servios pudesse ser considerada de
lngua materna?
Na seqncia do desenvolvimento deste Captulo, ser apresentado um subitem que
contempla o estudo do texto definicional, uma vez que esse assunto importante dentro dos
estudos terminolgicos e, quando da feitura de obras terminogrficas, quase todos os
especialistas se abstm dessa prerrogativa que a de compor uma definio que seja
compreensiva e utilizvel por qualquer tipo de usurio, seja ele um grande conhecedor da
especialidade em questo, um divulgador ou um simples usurio das UCEs da especialidade.


II.5. A problemtica da definio terminogrfica
Embora a questo tratada neste subitem no esteja relacionada s hipteses
colocadas por este trabalho, sua presena importante, pois a definio a razo de
ser de um dicionrio. Qualquer que seja o objetivo da obra terminogrfica e qualquer
que tenha sido a microestrutura eleita, ela deve, preferencialmente, contar com a
definio. preciso esclarecer tambm que a definio vai organizar-se em funo da
natureza da obra em que comparece. H, pois, uma correlao entre tipologia de
dicionrios e tipologia de definies, ou seja, no se pode optar sempre por um mesmo
tipo definicional.




221


Dessa forma, cabe esclarecer algumas contribuies de modelos definicionais.
Inicialmente, h um nmero reduzido de publicaes dedicadas ao tema. A grosso
modo, apenas franceses e canadenses vinham demonstrado preocupao com a
normalizao de conceitos relativos ao tema. Modernamente, porm, alguns estudiosos
brasileiros debruaram-se sobre o tema e produziram estudos consistentes sobre a
problemtica.
De modo geral, a finalidade da definio, nos dicionrios de lngua de
especialidade, distinguir um termo do outro. Para que se possa dar uma viso um
tanto quanto abrangente sobre a definio, autores diversos que se preocuparam com a
mesma sero apresentados.
A primeira questo que se coloca : o que a definio? Para Pierre Lerat,
atividade semntico-lgica por excelncia, a definio, e mesmo o enunciado
definitrio sobre suas mltiplas formas, condensa os conhecimentos em uma frase.
105

J para Boutin-Quesnel et al., a definio um enunciado que descreve um
conceito e que permite diferenci-lo de outros conceitos no interior de um sistema
conceitual.
106

Na Norma ISO 1087, a definio um






105
LERAT, P. Terminologie et smantique descriptive, 1988, p. 17.
106
BOUTIN-QUESNEL, R. (et al.) Vocabulaire systmatique de la terminologie, 1985, p. 27.




222


...enunciado que descreve um conceito (enunciado de pensamento
constitudo por abstrao a partir de propriedades comuns a um
conjunto de objetos. Elas no so ligadas s lnguas individualmente.
So, entretanto, influenciadas pelo contexto sociocultural) e que
permite diferenci-lo de outros conceitos no interior de um sistema de
conceitos (conjunto estruturado de conceitos construdos base de
relaes estabelecidas entre estes conceitos e onde cada conceito
determinado por sua posio no conjunto). A definio classifica-se
em:
1. Definio por compreenso: aquela baseada sobre a compreenso
de um conceito. Esse tipo de definio compreende a meno do
conceito genrico mais prximo (j definido ou supostamente
conhecido) e dos caracteres distintivos delimitando o conceito a ser
definido.
2. Definio por extenso: aquela baseada sobre a enumerao
exaustiva de objetos s quais um conceito faz referncia ou aos
conceitos especficos que lhe so imediatamente subordinados.
107


Uma outra publicao relevante acerca dos conceitos relativos definio a
do Centre International d' Information pour la Terminologie (Infoterm). Nela, so
encontradas as seguintes informaes:




107
ABNT. Terminologia - Glossrio - Parte 1. Princpios e mtodos: (ISO 1087), 1996, p. 4.




223


A definio a chave de todo trabalho cientfico. Ela uma descrio
de um conceito feito no meio de outros conceitos conhecidos,
sobretudo sob a forma de palavras ou termos. Ela determina o lugar
desse conceito em um sistema de outros conceitos aparentes. Uma
explicao uma descrio de um conceito, que feita independente
de seu lugar no sistema de conceitos. Podem estar ligadas definio
os conceitos de:
A. Determinao: um segundo conceito est to integrado que
caracteriza a compreenso do primeiro; a compreenso do primeiro
conceito dilata-se assim ao menos em uma caracterstica suplementar.
O conceito que resulta uma espcie de primeiro conceito.
B. Conjuno: as compreenses de dois conceitos esto reunidas,
resultando em um conceito que uma espcie comum aos dois
primeiros conceitos.
C. Disjuno: as extenses de dois conceitos esto reunidas.
D. Integrao: quando se religa dois objetos individuais ou mais e se
cria uma nova identidade. A ligao ontolgica combina no mais dois
conceitos conjuntos ou mais, mas dois objetos individuais ou mais que
pertencem a estes conceitos.
Segundo as ligaes entre os conceitos, h definies por
compreenso (determinao) ou definies por extenso (conjuno,
disjuno, integrao). A grosso modo, existe um grande nmero de
tipos de definio. Para o trabalho terminogrfico, faz-se necessrio
dar preferncia aos dois grandes tipos de definies mencionados
acima.
A classificao das definies :




224


1. Definio especfica (por compreenso)
Consiste em especificar as caractersticas do conceito a ser definido,
quer dizer, determinar a compreenso do conceito. Faz-se necessrio
encontrar o gnero j definido ou considerado o mais prximo.
Limita-se, em seguida, extenso do gnero relevando as
caractersticas que diferenciam o conceito a ser definido de outros
conceitos que esto no mesmo nvel de abstrao. Essas caractersticas
so ditas restritivas e pertencem a um s tipo de caracterstica. Uma
definio especfica , ento, a expresso lingstica extensiva de um
elo de conceitos por determinao.
2. Definio genrica (por extenso)
Consiste em enumerar todas as espcies que esto no mesmo nvel de
abstrao ou todos os objetos individuais que pertencem ao conceito
definido. a expresso lingstica extensiva de um elo entre conceitos
que resulta de uma conjuno, disjuno ou de uma integrao. Ela
no pode ser jamais exaustiva. Uma definio genrica mais
facilmente observvel do que uma definio especfica. Por
conseguinte, pode ser til completar uma definio especfica com
uma definio genrica.
As definies podem igualmente ser, segundo o fim ao qual
estejam destinadas, repartidas em definies descritivas (que
enunciam a significao de um termo) e definies normativas
(que enunciam a significao que um termo deveria ter). Podem
relacionar-se tambm a tipos de descries e ilustraes. No caso
da descrio, mais especificamente denominada descrio da




225


colocao de objetos individuais, a mesma revela suas relaes
partitivas correspondentes s das definies de conceitos. Essa
descrio pode ser aquela do todo. Nesse caso, as partes do todo
so enumeradas. Mas ela pode igualmente ser aquela de uma
parte. Se assim o for, indica-se a relao entre um objeto
individual e o todo, e as partes adjacentes.
No caso das ilustraes, pode-se mencionar que elas so bastante
teis quando se quer demonstrar a preciso ou mesmo dar uma
grande clarividncia a uma definio. O tipo de ilustrao
depender da inteno, mas fica esclarecido que poder tratar-se
de imagens ou diagramas. As imagens, que esto prximas da
realidade, como a fotografia, complementam a definio geral,
demonstrando os objetos definidos.
108


guisa de concluso dessas consideraes sobre a definio e sua tipologia,
ser acrescentado que a definio terminogrfica deve permitir aos usurios uma
imagem mental exata dos conceitos definidos. Para este fim, podem-se combinar
vrios tipos de definio de modo a se conseguir efetivar essa imagem mental. Os
mtodos de procedimento para a elaborao das definies so vrios, mas convm
eleger um percurso metodolgico que se encerra em bom termo: em uma primeira



108
INFOTERM. Manuel de terminologie, 1987, p. 135-139.




226


etapa, faz-se o levantamento da mesma UCE em vrias publicaes ou nmero de
informantes; em seguida, compatibilizam-se os conceitos encontrados e chega-se ao
conceito-parmetro que ser depois submetido aos chamados juizes, especialistas da
rea em questo; finalmente, chega-se ao conceito final que, submetido s teorias e
procedimentos terminogrficos, constituir a definio.
A definio em terminografia serve para delimitar com preciso um conceito de
uma rea ou subrea de especialidade e fundamental para a determinao dos traos
semnticos pertinentes.
considerada pertinente aquela informao que serve para diferenciar
conceitualmente as UCEs de uma mesma rea ou subrea de especialidade. No
considerada pertinente aquela informao meramente explicativa ou descritiva da
realidade designada pela UCE em um trabalho terminogrfico. Caso essa informao
tenha que constar, ela dever ser escrita em uma nota e no na definio do verbete.
Ainda necessrio diferenciar claramente as relaes de sinonmia entre UCEs,
que so informaes importantes em uma definio terminogrfica. Em uma obra
terminogrfica, a remissiva no deve constar do texto definitrio; ao contrrio, deve
ser indicada parte porque se refere a denominaes diferentes de um mesmo
conceito.
A prtica terminolgica rejeita definies que aportem informaes
metalingsticas e, portanto, no se deve utilizar definies introduzidas por: Termo
que designa ..., o ..., Qualificativo aplicado a ..., etc.
A definio terminogrfica deve sempre trazer uma UCE que seja
conceitualmente mais genrica do que a UCE definida. Essa UCE conhecida como




227


descritor. O descritor deve possuir sempre a mesma classe gramatical da UCE que
esteja sendo definida.
Essas observaes aplicam-se mais comumente a UCEs que no sejam
sintagmas. Quando as UCEs forem sintagmas, suas definies tero como descritores a
base do sintagma. Essa formao sintagmtica ocorre com muita freqncia nos
vocabulrios tcnicos. De acordo com Ieda M. Alves,

...os termos sintagmticos resultam, nesses casos, em uma indeciso
em relao designao de um novo conceito. A designao em forma
de sintagma pode vir a ser substituda por um nica base ou o
sintagma pode chegar a cristalizar-se e inserir-se no lxico da
lngua.
109


Como se pode perceber, a definio terminogrfica desempenha papis
fundamentais no interior da comunicao especializada. Tal importncia, entretanto,
diretamente proporcional ao nmero de dificuldades envolvidas em seu estudo, pois
diferentes fatores e condies perpassam sua formulao, constituindo um tema de
elevada complexidade. Desse modo, ainda que se discuta sobre sua natureza, funes e
especificidades, no h clareza suficiente, entre os pesquisadores, sobre muitos de seus
aspectos.
De acordo com Maria J. B. Finatto:


109
ALVES, I. M. A definio terminolgica. In: ENCONTRO NACIONAL DE
PROFESSORES/PESQUISADORES DE LEXICOLOGIA, LEXICOGRAFIA E TERMINOLOGIA, 1989, p.
24.




228


Definir, dito de modo muito simples, no mbito das terminologias,
estabelecer um vnculo entre um termo, um conceito e um significado.
E, toda vez que isso ocorre, verificamos a ativao do conjunto das
propriedades inerentes linguagem humana. Com a formulao de
uma definio, so mobilizados, constitudos e atualizados, em
distintos nveis, diferentes valores e potencialidades de conhecimento
e significao, descritos com relativa dificuldade por aqueles aparatos
analticos que a tradio dos estudos lingsticos qualifica como
estritamente lingsticos.
110


Foi mencionado que definir estabelecer um vnculo entre um termo (aqui
tratado por UCE), um conceito e um significado. Como caracterizar essas UCEs?
Inicialmente, preciso esclarecer que as definies que sero apresentadas
nesta pesquisa foram validadas por um especialista da rea em questo. Quando da
discuso com o mesmo sobre a formulao e os padres de qualidade dos textos
definitrios, tornaram-se necessrios alguns instrumentos para a sistematizao das
definies, o que, via de regra, conferiria maior rapidez ao trabalho, e que sero
trazidos ao trmino deste subitem. Naturalmente, levou-se em conta que o objeto sob
considerao seria, em primeira instncia, um produto dialgico, dirigido a usurios
determinados e, justamente por isso, marcado pelas peculiaridades de interlocuo
instauradas por sua prpria natureza e pela rea repertoriada.
Em relao s UCEs (termos), este trabalho j pode contribuir e sua
caracterizao encontra-se no subitem II.4.1. J para a caracterizao da UCE

110
FINATTO, M. J. B. Elementos lexicogrficos e enciclopdicos na definio terminolgica: questes de
partida. Organon, 1998, p. 134.




229


conceitos, preciso afirmar que, em Terminologia, eles so tidos como unidades pr-
lingsticas de conhecimento, isto , conceitos podem existir sem smbolos ou signos
lingsticos que lhe correspondam previamente. Segundo Sager, "os termos so
percebidos como smbolos ou rtulos que representam conceitos."
111
A necessidade de
uma denominao, neste sentido, considerada como o primeiro passo na consolidao
de um conceito como um instrumento socialmente til.
Na teoria terminolgica, em qualquer de suas vertentes, amplamente
reconhecido que conceitos, como unidades cognitivas, devem ser diferenciados de
significados de palavras enquanto unidades semnticas. Por outro lado, na teoria
lingstica, observa-se que forma e significado so elementos inseparveis, ou pelo
menos interdependentes.
Em Terminologia, porm, a esfera dos conceitos tida como independente das
UCEs, e preciso considerar que determinados conceitos no so restritos a uma dada
lngua e que podem existir mesmo sem uma expresso lingstica correspondente.
Para Wster, um conceito, distanciado de conceitos individuais, a "unidade
que as pessoas identificam com um grupo de caractersticas por meio de sua
organizao mental e que so utilizados para sua compreenso."
112

Em publicaes de normas da ISO, que se preocupa com a fixao de
metodologias e padres para a atividade normalizadora e terminolgica/terminogrfica,
encontra-se, em sntese, o seguinte: "conceito uma unidade de pensamento que
contm uma ou um conjunto de propriedades comuns a um conjunto de objetos. A

111
Cf. FINATTO, M. J. B. A definio terminolgica do dicionrio Termisul: expresso lingstica de relaes
conceituais complexas. In: KRIGER, M. da G.; MACIEL, A. M B. (Org.) Temas de terminologia, 2001, p. 307.
112
Cf. FINATTO, M. J. B. Op. Cit., p. 308.




230


seleo dessas propriedades socialmente determinada."
113
V-se, portanto, que
conceitos podem representar no s seres ou coisas na mente, mas, em um sentido mais
amplo, qualidades, aes, situaes, relaes, funes, etc. e nunca ocorrem isolados,
mas mantm relaes diretas ou indiretas com outros conceitos que compartilham um
certo nmero das mesmas caractersticas que os estabelecem.
Em Terminologia, contudo, os conceitos podem ser definidos como

...unidade de pensamento servindo representao mental da
realidade, ou como unidades de conhecimento, servindo a uma
representao da estrutura de conhecimento, ou, finalmente, como
unidades de comunicao que servem para comunicar conhecimento.
114


Um outro tradicional ponto de diferenciao entre os pares Lingstica/lngua
comum e Terminologia/lngua de especialidade a considerao de que, enquanto o
terminlogo usualmente parte de conceitos e tentam encontrar UCEs que possam lhes
ser correspondidas, a abordagem onomasiolgica, j aqui apresentada, o lingista parte
de palavras e tenta definir seus conceitos, a abordagem semasiolgica, tambm j
mencionada.
interesssante retomar a idia de que conceitos no so significados. Esta
proposio parte do princpio que "o contedo semntico de uma palavra polissmico
e inclui as suas propriedades do significado, ou denotao, seu significado adicional
ou conotao, e sua capacidade de combinao com outras palavras da lngua.
115
Em

113
Cf. FINATTO, M. J. B. Op. Cit., p. 308.
114
Cf. FINATTO, M. J. B. Op. Cit., p. 308.
115
Cf. FINATTO, M. J. B. Op. Cit., p. 309.




231


Terminologia, por outro lado, conceitos so identificados como unidades de
conhecimento e contm, via de regra, apenas conhecimento factual ou tcnico e no
devem abrigar elementos emotivos ou conotados.
Assim, pode-se considerar que a definio terminogrfica um lugar de
encontro entre o aspecto conceitual e o lingstico, uma vez que o texto da definio
tem a funo de descrever as caractersticas que delimitam um conceito e a funo de
particulariz-lo em um determinado sistema conceitual.
Alain Rey, por outro lado, aponta uma caracterstica da definio que integra
terminologias tcnico-cientficas: "a propriedade de estabelecer em si mesma um
entrelaamento ou compromisso entre a definio lexicogrfica e a descrio
enciclopdica."
116
Conforme sua explicao, a descrio enciclopdica aquela
definio que, via de regra, sendo ampla e diversificada no teor de informaes,
carrega traos relevantes e irrelevantes na caracterizao da coisa nomeada.
Como j explicitado, os diferentes dicionrios podem ser caracterizados como
dicionrios comuns de lngua, dicionrios enciclopdicos e dicionrios especializados,
entre outros. Esta classificao, levando-se em conta seus limites, possibilita uma
conseqente categorizao de suas definies em lexicogrficas, enciclopdicas e
terminogrficas. Tal tipologia pode ser assim definida: a lexicogrfica caracteriza-se
pela predominncia de informaes lingsticas, tratando mais de palavras; as
enciclopdicas ocupam-se mais de referentes e de descrio de coisas; as
terminogrficas, por sua vez, trazem predominantemente conhecimentos formais sobre
fenmenos.

116
Cf. FINATTO, M. J. B. Op. Cit., p. 134.




232


Assim, a definio terminogrfica, para alm dos limites da indicao de um
gnero prximo e de uma diferena especfica, no mero cenrio de partilha entre
duas tradies dicionarsticas conjugadas. Isto porque ela e seu entorno so modelados
por exigncias do acesso informao e condicionados por circunstncias
comunicativas e socioculturais particulares das diferentes reas de especialidade.
Ela , enfim, a voz de algum e a voz de uma rea de especialidade, e este um
dos rumos mais importantes que seu estudo pode tomar. Nesta direo, importante
no perder de vista a situao e o papel da definio, visto que o dicionrio , antes de
tudo, a interface discursiva de autor e usurio a partir da proposio de um texto
definitrio.
117

Pelo exposto at aqui, a definio terminogrfica pode ser enriquecida e ter seu
escopo ampliado pelo acrscimo de elementos enciclopdicos. No entanto, esta
contribuio no pode vir no prprio texto definitrio e sim vir acompanhada pelo
ttulo de Notas. Em relao contribuio lexicogrfica, importante lembrar que a
presena de informaes e comentrios de cunho lingstico pode significar a
diferena entre uma compreenso eficiente ou defeituosa de conhecimento e
terminologias, mas, como j dito, dever vir mencionada no item Notas e no mesclada
no texto definitrio.
Esta novidade apontada nos estudos da definio terminogrfica no anula nem
tampouco desconsidera a questo das categorias aristotlicas de gnero prximo e da



117
Cf. FINATTO, M. J. B. Op. Cit., p. 143.




233


diferena especfica que, tradicionalmente, desde os estudos clssicos de Filosofia,
Retrica e Lgica, so apontadas na constituio e estrutura das definies. O que se
procura evidenciar que estas categorias passaram a ser tomadas no mais como
referenciais, mas, como assevera Maria J. B. Finato, "acabaram se transformando nos
principais parmetros analticos da definio, chegando a ser compreendidas como
seus valores lgicos mais essenciais."
118
A prpria Teoria Geral da Terminologia
(TGT) de Wster j lidava com esse tipo de categorizao quando enfocava a definio
nas terminologias tcnicas e as apresentava como um recurso importante para a
obteno de definies melhores e mais objetivas.
De outro lado, na perspectiva lingstica mais formalizante da definio, que a
compreende como um conjunto proposicional-predicativo, essas categorias, que no
so mais o gnero e a diferena tal como originalmente pensados por Aristteles,
passaram a ser compreendidas quase que existindo por si prprias, visto que no se
considera quem as tenha enunciado ou afirmado, ou seja, a definio de uma UCE
passou a ser tomada como um conjunto de valores lgicos sem autoria ao longo do
desenvolvimento dos estudos lingsticos, destacando que esse tipo de enfoque passou
naturalmente s teorias terminolgicas e suas consideraes sobre a definio de
UCEs.
119

Ao trmino deste subitem do Captulo Fundamentos Tericos, faz-se necessrio
acrescentar que, independentemente de a UCE ser sintagmtica ou no, as seguintes
recomendaes sero seguidas quando da redao das definies terminogrficas:

118
Cf. FINATTO, M. J. B. Op. Cit., p. 435.
119
Cf. FINATTO, M. J. B. Op. Cit., p. 435.




234


A. o grau de complexidade e tecnicismo se adaptar ao vocabulrio e aos
usurios finais. Assim, como se pesquisa uma terminologia, ser mantido um
tom impessoal;

B. a UCE definida no far parte da definio;

C. a ordem sinttica lgica ser mantida;

D. sempre que for possvel, a definio ser elaborada em uma s frase;

E. qualquer referncia ao campo objeto do trabalho ser evitada com o intuito
de indicar uma acepo diferente da lngua geral ou de outra rea temtica
porque o trabalho terminogrfico se enquadra em um mbito de especialidade
concreto;

F. as definies circulares sero evitadas, isto , aquelas que se remetem
reciprocamente.











235


III. ESTABELECIMENTO DO CORPUS E METODOLOGIA
III.1. Etapas da pesquisa
A pesquisa terminogrfica divide-se em duas classes: quanto ao modo de tratamento e
quanto s lnguas utilizadas. Quanto ao tratamento, ela pode ser temtica ou pontual. Em
relao s lnguas envolvidas, ela pode ser interna, se monolnge, ou comparada, quando
bilnge ou plurilnge.
A pesquisa terminogrfica em pauta classifica-se, quanto ao modo de tratamento, em
temtica, ou seja, tem por finalidade estabelecer, de modo o mais exaustivamente possvel, o
conjunto de UCEs ligadas a uma rea especfica no interior da lngua portuguesa. Dessa
forma, um dicionrio monolnge quanto s lnguas utilizadas.
No mbito dessa pesquisa temtica, foi abordado o enfoque onomasiolgico, que
consiste em realizar uma recolha de UCEs em uma rea dada a fim de explor-las e defini-las
a partir dos conceitos identificados.
Assim, como em toda pesquisa temtica monolnge, foram percorridas as seguintes
etapas:
1. escolha da rea e da lngua de trabalho;
2. coleta da documentao;
3. estabelecimento dos limites da pesquisa;
4. recolha das UCEs em obras significativas da rea estudada, aps consulta com
especialistas;
5. apresentao dos dados terminogrficos.
A rea escolhida foi a gesto pela qualidade total em servios e a lngua de trabalho foi
a lngua portuguesa. Dessa forma, s foram eleitas, como fontes obras editadas em lngua
portuguesa e no Brasil. Em relao s obras dos especialistas americanos, franceses e




236


japoneses, foi dada preferncia queles que foram traduzidos e publicados por editores
brasileiros. Estas obras so as mais representativas dos especialistas mais reconhecidos da
rea pesquisada, o que favoreceu sobremaneira a coleta das UCEs. Foram recolhidas, nestas
obras especializadas, UCEs relacionadas ao planejamento, ao controle e melhoria da gesto
pela qualidade total em servios.
Como desde o incio da pesquisa o especialista que assessorou a mesma alertou para o
fato de haver uma interseco com o setor de manufatura, foi dada tambm preferncia
leitura de obras dessas idias em indstrias de transformao, o que se configurou bastante
produtivo, como foi comprovado no item relacionado apresentao da estrutura conceitual
da rea pesquisada.
A coleta dos dados foi realizada por meio da leitura das referidas obras especializadas
que forneceu as condies necessrias ao preenchimento das fichas terminolgicas e
elaborao posterior dos verbetes.
A pesquisa apresenta-se, portanto, delimitada quando lngua utilizada, rea
especializada e ao tipo de obras que compuseram o corpus e que foram utilizadas como fontes
para a recolha e a sistematizao das UCEs na estrutura conceitual.
A relao das obras utilizadas ser dada posteriormente, mas a apresentao dos dados
terminogrficos, antes de submetidos a esta Banca, foram devidamente validados pelo
especialista da rea pesquisada.


III.1.1. Pesquisa bibliogrfica
A pesquisa bibliogrfica necessria fundamentao terica da presente pesquisa
consistiu da leitura e anlise de textos e obras em lingstica geral, lexicologia, lexicografia,




237


terminologia geral e terminografia especializada que forneceram dados metodolgicos e, entre
outros itens, descrio sistemtica das possibilidades de formao de UCEs oriundas de
traduo para que se pudesse situar o objeto de pesquisa dentro da problemtica a que
pertence.
Essa questo de UCEs oriundas de traduo constitui uma das trs hipteses
levantadas nesta pesquisa, ou seja: i. a GQT em servios constitui efetivamente uma rea de
especialidade em relao GQT em manufatura ou apenas uma subrea dessa? ii. uma vez
que essa Filosofia Administrativa surge em lngua estrangeira, se surgiu, como as UCEs se
adaptaram lngua portuguesa? iii. quais teriam sido os modos de formao utilizados nesta
adaptao?
Tambm foram necessrias e importantes as leituras de obras relacionadas
Administrao de Empresas, normalizao terminolgica, marketing, estatstica e servios
bancrios para que, de um lado, fosse possvel situar as utilizaes das UCEs que
contriburam para o desenvolvimento das pesquisas na rea de servios e que, por outro,
pudessem levar compreenso dos diversos conceitos e representaes utilizados pelos
especialistas.
Procurou-se, ento, efetuar uma seleo dessas obras e eleger aquelas que
serviriam como corpus da pesquisa. Depois de efetuada a escolha das obras, que teve
por base o critrio da importncia, foi agendada uma entrevista com o especialista para
a certificao de que as opes haviam sido corretas. Aps alguns esclarecimentos de
ordem tcnica, ficou definido que a pesquisa das UCEs seria efetuada em trs grupos
de obras significativas que compreendessem o trip de Deming, qual seja, o
planejamento, o controle e a melhoria da gesto pela qualidade total em servios.





238


III.1.2. Estabelecimento do corpus
Ao realizar a delimitao do corpus de uma pesquisa terminogrfica, o pesquisador
deve contar com a ajuda de especialistas da rea que elegeu como objeto de pesquisa para que
o trabalho tenha um cunho cientfico e possa, posteriormente, ser utilizado por esses mesmos
especialistas. Nesta pesquisa no foi diferente. Foi estabelecido um contato com o Servio
Nacional de Auxlio s Micro e Pequenas Empresas do Estado de So Paulo (Sebrae-SP) e
esta organizao forneceu uma lista com 170 (cento e setenta) obras relacionadas gesto
pela qualidade total, embora tenha criado dificuldades para disponibilizar o especialista.
Dessas, foram selecionadas com a pessoa responsvel pelo atendimento externo da
organizao um total de 50 (cinqenta) que foram submetidas ao especialista Paulo Garcia,
consultor de Qualidade do Sebrae-SP e RJ que implantou e gerenciou o Departamento de
Qualidade Total da Empresa Gradiente Eletrnica S. A. por mais de 20 (vinte) anos. Ele
recomendou as 29 (vinte e nove) obras seguintes, que constituem o corpus da pesquisa e de
onde foram coletadas as UCEs e contextos relacionados gesto pela qualidade total em
servios.
Faz-se necessrio frisar que estas obras so todas especializadas, ou seja, apresentam
um discurso produzido por especialistas que tm como pretensos usurios principais outros
especialistas da rea. No houve, por parte da pesquisa, e como ser demonstrado pelos
contextos, nenhuma preocupao em eleger fontes que trouxessem o discurso de divulgao
porque a inteno do trabalho sempre foi a de buscar as contribuies mais eminentes que
contriburam para a sistematizao dessa rea em constituio, ao menos na poca em que ele
foi iniciado.
Dessa forma, em relao tentativa de se coletar UCEs relacionadas ao planejamento
da GQT em servios, foram selecionadas 12 (doze) obras que constituram a primeira parte do




239


corpus.
Obras recomendadas pelo especialista:
1. ALMEIDA, Ricardo Cintra de. Bancos, sistemas da qualidade e resultados: um
estudo do Brasil. So Paulo: Ed. Atlas, 1998.
2. CERQUEIRA NETO, Edgard Pedreira de. Gesto da qualidade: princpios e
mtodos. 3. ed. So Paulo: Pioneira (Biblioteca Pioneira de Administrao e
Negcios), 1993.
3. DEMING, William Edwards. Qualidade: a revoluo da administrao. Trad. de
Clave Comunicaes e Recursos Humanos. Rio de Janeiro: Ed. Marques-Saraiva,
1990.
4. FISCHMANN, Adalberto Amrico & ALMEIDA, Martinho Isnard Ribeiro de.
Planejamento estratgico na prtica. 2. ed. So Paulo: Ed. Atlas, 1991.
5. HESKETT, James L.; SASSER JR., W. Earl; HART, Christopher W. L. Servios
revolucionrios: mudando as regras do jogo competitivo na prestao de servios.
Trad. de Carmem Dolores Straube e Irineu Gustavo Gianesi. So Paulo: Pioneira
(Biblioteca Pioneira de Administrao e Negcios), 1994.
6. JURAN, J. M.; GRYNA, Frank M. Controle da qualidade: conceitos, polticas e
Filosofia da qualidade. v. I. Coord. da trad. por Maria Cludia de Oliveira Santos.
So Paulo: Makron Books: McGraw-Hill, 1991.
7. LAS CASAS, Alexandre Luzzi. Qualidade total em servios: conceitos, exerccios,
casos prticos. 3. ed. So Paulo: Ed. Atlas, 1999.
8. PASCALE, Richard Tanner; ATHOS, Anthony G. As artes gerenciais japonesas:
mtodos e sistemas dos executivos japoneses adaptados realidade ocidental. 10.
ed. Trad. de Ruy Jungmann. Rio de Janeiro: Editora Record, 1982.




240


9. PEREZ-WILSON, Mrio. Seis sigma: compreendendo o conceito, as implicaes e
os desafios. Trad. de Bazn Tecnologia e Lingstica. Rio de Janeiro: Qualitymark
Ed., 1999.
10. SCHERKENBACH, William W. O caminho de Deming para a qualidade e
produtividade: rotas e mapas. Trad. de Maria Clara Forbes Kneese. Rio de janeiro:
Qualitymark Ed., 1990.
11. WALTON, Mary. O mtodo Deming de administrao. Trad. de Jos Ricardo
Brando Azevedo. Rio de Janeiro: Ed. Marques-Saraiva, 1989.
12. ZIMMERMAN, Charles D. III; ENELL, John W. Indstrias de servios. In
JURAN, J. M.; GRYNA, Frank M. Controle da qualidade: qualidade em diferentes
sistemas de produo. v. VIII. Coord. da trad. por Maria Cludia de Oliveira
Santos. So Paulo: Makron Books: McGraw-Hill, 1991. p. 302-425.
Alm dessas doze obras que serviram de corpus para a recolha, definio e
contextualizao das UCEs relacionadas ao planejamento da GQT em servios, foram
selecionadas ainda outras 10 (dez) obras, agora relacionadas tentativa de se obter
UCEs inerentes ao controle da GQT em servios.
Obras recomendadas pelo especialista:
1. CAMPOS, Vicente Falconi. Gerncia da qualidade total: estratgia para aumentar
a competitividade da empresa brasileira. Belo Horizonte: Fundao Christiano
Ottoni: Escola de Engenharia da UFMG, 1990.
2. CROSBY, Philip B. Qualidade investimento. Trad. de urea Weissenberg. 7. ed.
Rio de Janeiro: Jos Olympio Editora, 1999.




241


3. GIANESI, Irineu G. Nogueira; CORRA, Henrique Luiz. Administrao
estratgica de servios: operaes para a satisfao do cliente. So Paulo: Ed.
Atlas, 1996.
4. IMAI, Masaaki. Kaizen: a estratgia para o sucesso competitivo. 4. ed. So Paulo:
Instituto de Movimentao e Armazenagem de Materiais (Imam), 1992.
5. LAS CASAS, Alexandre Luzzi. Marketing de servios. 2. ed. So Paulo: Ed. Atlas,
2000.
6. PINE II, B. Joseph. Personalizando produtos e servios - customizao macia.
Trad. de Edna Emi Onoe Veiga com reviso tcnica de Heitor M. Quintella. So
Paulo: Makron Books, 1994.
7. REIS, Lus Felipe Sousa Dias. Gesto da excelncia na atividade bancria. Rio de
Janeiro: Qualitymark Ed., 1998.
8. TEBOUL, James. Gerenciando a dinmica da qualidade. Trad. de Helosa Martins.
Rio de Janeiro: Qualitymark Ed., 1991.
9. TOLEDO, Geraldo Luciano. Marketing bancrio: anlise, planejamento, processo
decisrio. So Paulo: Ed. Atlas,1978.
10. YOSHINAGA, Ciro. Qualidade total: a forma mais prtica e econmica de
implementao e conduo. So Paulo: Ciro Yoshinaga, 1988.
Por ltimo, para completar o pensamento de identificao de UCEs de acordo
com a trilogia de Deming, foram selecionadas, com assessoria do Sebrae-SP e do
especialista citado, outras 7 (sete) obras, desta vez relacionadas tentativa de
identificao de UCEs vinculadas melhoria da GQT em servios.




242


Obras recomendadas pelo especialista:
1. ALMEIDA, Lo G. de. Qualidade: introduo a um processo de melhoria contnua.
Rio de Janeiro: Qualitymark Ed., 1995.
2. BARROS, Claudius D'Artagnan C. de. Excelncia em servios: uma questo de
sobrevivncia no mercado. 2 ed. Rio de Janeiro: Qualitymark Ed., 1999.
3. BERRY, Leonard L. Descobrindo a essncia do servio: os novos geradores de
sucesso sustentvel nos negcios. Trad.de Bazn Tecnologia e Lingstica. Rio de
Janeiro: Qualitymark Ed., 2001.
4. CASSARO, Antonio Carlos. Sistemas de informaes para tomadas de decises. 3.
ed. rev. e ampl. So Paulo: Pioneira (Biblioteca Pioneira de Administrao e
Negcios), 1999.
5. MOURA, Eduardo C. As sete ferramentas gerenciais da qualidade: implementando
a melhoria contnua com maior eficcia. So Paulo: Makron Books, 1994.
6. OUCHI, William G. Sociedade M: a fora de trabalho em equipe. Trad. de
Auriphebo Berrance Simes. So Paulo: Ed. Nobel, 1985.
7. SCHONBERGER, Richard J. Construindo uma corrente de clientes: unindo as
funes organizacionais para criar a empresa de classe universal. Trad. de Antnio
Cesar Amaru Maximiano e Cesar Campiani Maximiano. So Paulo: Pioneira
(Biblioteca Pioneira de Administrao e Negcios), 1992.

Apenas aps a leitura dessas fontes foi possvel configurar a estrutura conceitual da
rea gesto pela qualidade total em servios. Como a estrutura j demonstrou, as
dimenses propagadas pela trilogia de Deming no foram suficientes para abarcar
todas as complexas relaes que a mesma fornecia. Dessa forma, chegou-se




243


concluso de que a ordem da leitura selecionada, de acordo com as dimenses
aludidas, no estava correta. Foi necessrio, ento, repensar a ordem em que as obras
poderiam ser apresentadas e optou-se por um reagrupamento. Esta nova ordem
preconizava no apenas trs grupos de obras, mas sim cinco grupos que pudessem
corresponder estrutura conceitual da rea pesquisada. Assim, as obras foram
reagrupadas em relao estatstica, ao marketing, ao setor bancrio, especficas para
servios e relacionadas ao servio e manufatura, de acordo com o que foi estabelecido
na apresentao da estrutura conceitual, ou seja, s vezes dentro das trs dimenses da
GQT em servios, outras em apenas uma das dimenses, etc. Portanto, foram
reconstitudos os seguintes grupos de obras com o intuito de se identificar UCEs a
cada um dos subgrupos que constariam da estrutura conceitual:
GRUPO 1. Obras que poderiam trazer UCEs que demonstrassem a interseco entre
servios e manufatura sem especificar a dimenso.
1. ALMEIDA, Lo G. de. Qualidade: introduo a um processo de melhoria contnua.
Rio de Janeiro: Qualitymark Ed., 1995.
2. CAMPOS, Vicente Falconi. Gerncia da qualidade total: estratgia para aumentar
a competitividade da empresa brasileira. Belo Horizonte: Fundao Christiano
Ottoni: Escola de Engenharia da UFMG, 1990.
3. CASSARO, Antonio Carlos. Sistemas de informaes para tomadas de decises. 3.
ed. rev. e ampl. So Paulo: Pioneira (Biblioteca Pioneira de Administrao e
Negcios), 1999.
4. CERQUEIRA NETO, Edgard Pedreira de. Gesto da qualidade: princpios e
mtodos. 3. ed. So Paulo: Pioneira (Biblioteca Pioneira de Administrao e
Negcios), 1993.




244


5. CROSBY, Philip B. Qualidade investimento. Trad. de urea Weissenberg. 7. ed.
Rio de Janeiro: Jos Olympio Editora, 1999.
6. DEMING, William Edwards. Qualidade: a revoluo da administrao. Trad. de
Clave Comunicaes e Recursos Humanos. Rio de Janeiro: Ed. Marques-Saraiva,
1990.
7. FISCHMANN, Adalberto Amrico & ALMEIDA, Martinho Isnard Ribeiro de.
Planejamento estratgico na prtica. 2. ed. So Paulo: Ed. Atlas, 1991.
8. IMAI, Masaaki. Kaizen: a estratgia para o sucesso competitivo. 4. ed. So Paulo:
Instituto de Movimentao e Armazenagem de Materiais (Imam), 1992.
9. JURAN, J. M.; GRYNA, Frank M. Controle da qualidade: conceitos, polticas e
Filosofia da qualidade. v. I. Coord. da trad. por Maria Cludia de Oliveira Santos.
So Paulo: Makron Books: McGraw-Hill, 1991.
10. OUCHI, William G. Sociedade M: a fora do trabalho em equipe. Trad. de
Auriphebo Berrance Simes. So Paulo: Ed. Nobel, 1985.
11. PASCALE, Richard Tanner; ATHOS, Anthony G. As artes gerenciais japonesas:
mtodos e sistemas dos executivos japoneses adaptados realidade ocidental. 10.
ed. Trad. de Ruy Jungmann. Rio de Janeiro: Editora Record, 1982.
12. SCHERKENBACH, William W. O caminho de Deming para a qualidade e
produtividade: rotas e mapas. Trad. de Maria Clara Forbes Kneese. Rio de janeiro:
Qualitymark Ed., 1990.
13. SCHONBERGER, Richard J. Construindo uma corrente de clientes: unindo as
funes organizacionais para criar a empresa de classe universal. Trad. de Antnio
Cesar Amaru Maximiano e Cesar Campiani Maximiano. So Paulo: Pioneira
(Biblioteca Pioneira de Administrao e Negcios), 1992.




245


14. TEBOUL, James. Gerenciando a dinmica da qualidade. Trad. de Helosa Martins.
Rio de Janeiro: Qualitymark Ed., 1991.
15. WALTON, Mary. O mtodo Deming de administrao. Trad. de Jos Ricardo
Brando Azevedo. Rio de Janeiro: Ed. Marques-Saraiva, 1989.
16. YOSHINAGA, Ciro. Qualidade total: a forma mais prtica e econmica de
implementao e conduo. So Paulo: Ciro Yoshinaga, 1988.

GRUPO II. Obras que poderiam trazer UCEs especficas relacionadas aos servios.
1. BARROS, Claudius D'Artagnan C. de. Excelncia em servios: uma questo de
sobrevivncia no mercado. 2 ed. Rio de Janeiro: Qualitymark Ed., 1999.
2. BERRY, Leonard L. Descobrindo a essncia do servio: os novos geradores de
sucesso sustentvel nos negcios. Trad.de Bazn Tecnologia e Lingstica. Rio de
Janeiro: Qualitymark Ed., 2001.
3. GIANESI, Irineu G. Nogueira; CORRA, Henrique Luiz. Administrao
estratgica de servios: operaes para a satisfao do cliente. So Paulo: Ed.
Atlas, 1996.
4. HESKETT, James L.; SASSER JR., W. Earl; HART, Christopher W. L. Servios
revolucionrios: mudando as regras do jogo competitivo na prestao de servios.
Trad. de Carmem Dolores Straube e Irineu Gustavo Gianesi. So Paulo: Pioneira
(Biblioteca Pioneira de Administrao e Negcios), 1994.
5. LAS CASAS, Alexandre Luzzi. Marketing de servios. 2. ed. So Paulo: Ed. Atlas,
2000.
6. LAS CASAS, Alexandre Luzzi. Qualidade total em servios: conceitos, exerccios,
casos prticos. 3. ed. So Paulo: Ed. Atlas, 1999.




246


7. PINE II, B. Joseph. Personalizando produtos e servios - customizao macia.
Trad. de Edna Emi Onoe Veiga com revisao tcnica de Heitor M. Quintella. So
Paulo: Makron Books, 1994.
8. ZIMMERMAN, Charles D. III; ENELL, John W. Indstrias de servios. In
JURAN, J. M.; GRYNA, Frank M. Controle da qualidade: qualidade em diferentes
sistemas de produo. v. VIII. Coord. da trad. por Maria Cludia de Oliveira
Santos. So Paulo: Makron Books: McGraw-Hill, 1991. p. 302-425.

GRUPO III. Obras que poderiam trazer UCEs especficas relacionadas aos bancos.
1. ALMEIDA, Ricardo Cintra de. Bancos, sistemas da qualidade e resultados: um
estudo do Brasil. So Paulo: Ed. Atlas, 1998.
2. REIS, Lus Felipe Sousa Dias. Gesto da excelncia na atividade bancria. Rio de
Janeiro: Qualitymark Ed., 1998.
3. TOLEDO, Geraldo Luciano. Marketing bancrio: anlise, planejamento, processo
decisrio. So Paulo: Ed. Atlas,1978.

GRUPO IV. Obras que poderiam trazer UCEs especficas relacionadas ao marketing.
1. LAS CASAS, Alexandre Luzzi. Marketing de servios. 2. ed. So Paulo: Ed. Atlas,
2000.
2. TOLEDO, Geraldo Luciano. Marketing bancrio: anlise, planejamento, processo
decisrio. So Paulo: Ed. Atlas,1978.

GRUPO V. Obras que poderiam trazer UCEs especficas relacionadas estatstica.




247


1. MOURA, Eduardo C. As sete ferramentas gerenciais da qualidade: implementando
a melhoria contnua com maior eficcia. So Paulo: Makron Books, 1994.
2. PEREZ-WILSON, Mrio. Seis sigma: compreendendo o conceito, as implicaes e
os desafios. Trad. de Bazn Tecnologia e Lingstica. Rio de Janeiro: Qualitymark
Ed., 1999.
Pelo acima exposto, o corpus constituiu-se, ento, de 29 (vinte e nove) obras
assim subdivididas de acordo com a tentativa de estabelecer-se UCEs relacionadas
trilogia de Deming: para o planejamento da GQT em servios, 12 (doze) obras; para o
controle da GQT em servios, 10 (dez) obras; para a melhoria da GQT em servios, um
total de 7 (sete) obras.
Quanto segunda diviso, proposta aps a concepo da estrutura conceitual da
rea, a reorganizao das obras deu-se da seguinte maneira: 16 (dezeseis) obras
compuseram o grupo daquelas que teriam condies de apresentar UCEs que fossem
classificveis no setor de manufatura e no setor de servios, perpassando as dimenses
do planejamento, controle e melhoria da GQT em servios e manufatura; 8 (oito) delas
estariam predispostas a apenas fornecer UCEs relacionadas ao setor de servios nas
trs dimenses j citadas; 2 (duas) obras seriam especficas para a identificao de
UCEs relacionadas subrea da estatstica que poderiam trafegar entre os dois setores
citados; por ltimo, apenas 3 (trs) obras trariam UCEs especficas dos bancos que se
enquadrariam no setor de servios no item especfico contribuio dos bancos como
prestadores de servios que possuem um nmero maior de certificaes da srie ISO
9000 e outras 2 (duas) obras no item relacionado s atividades de marketing nos
bancos e no setor de servios.




248


Esse nmero de obras e as mesmas tiveram a aprovao da Assessoria do
Programa Sebrae de Qualidade Total em Empresas e do especialista consultado. As
idias preconcebidas para a recolha das UCEs foi do pesquisador que estabeleceu um
critrio para a realizao das leituras das mesmas com o intuito de ir constituindo a
estrutura conceitual da rea. Ao final, percebeu-se que o critrio adotado mostrou-se
til, apesar de imperfeito. O importante que ele foi vlido e pode ser utilizado em
qualquer trabalho terminogrfico em que o pesquisador no conhea a rea
suficientemente bem e possa contar com a colaborao do especiaista da mesma.
Apesar de haver um nmero bem maior de obras dedicadas ao tema, as
escolhidas para configurarem o corpus dessa pesquisa so representativas dessa rea
de especialidade. Muitas so tradues de obras dos precursores da GQT em servios e
manufatura no mundo e outras foram escritas por especialistas brasileiros reconhecidos
internacionalmente por sua dedicao propagao e implementao dessas idias.


III.1.3. Busca e organizao dos dados
A recolha das UCEs foi realizada, em um primeiro momento, por meio da
informatizao das obras acima que serviram como corpus da pesquisa, tendo como
aparato terico a delimitao da unidade de conhecimento especializado a partir dos
critrios sinttico e semntico. Esse ltimo critrio pressupe que a UCE seja uma
unidade constituda de duas ou mais palavras, mas o seu significado individual e as
palavras, individualmente, perdem os seus significados e adquirem um outro que s
compreendido dentro do contexto da lngua de especialidade.
O critrio sinttico/semntico foi utilizado a partir dos subcritrios da




249


inseparabilidade, da comutao e do significado nico como forma de possibilitar a
delimitao das UCEs nas obras que serviram como corpus. Mais especificamente, foi
adotada a teoria de mile Benveniste para a delimitao e recolha das UCEs
sintagmticas. Por meio da sinapsia, da natureza sinttica da ligao entre os
elementos em que no h composio por aglutinao, e da percepo da presena de
elementos de ligao (preposio) ou no (eventualmente), pode-se concluir que a
ocorrncia maior foi de UCEs sintagmticas.
A fim de certificar-se de que as UCEs recolhidas eram ou no terminolgicas,
fez-se uso de dois dicionrios que se encontram no mercado editorial e que trazem as
UCEs relacionadas GQT. Depois de recolhidas as UCEs nas obras que compuseram o
corpus da pesquisa, buscava-se nesses dicionrios a ocorrncia ou no da UCE em
questo. Algumas foram encontradas e outras no.
No entanto, a pesquisa aqui apresentada seguiu um caminho diverso daquele trilhado
pelos autores dos dicionrios mencionados. Foi utilizado um rigor cientfico e uma aplicao
das teorias preconizadas pela Terminologia a fim de se produzir um dicionrio que
pudesse ser til aos usurios/especialistas que militam na rea. Para tanto, o trabalho
contm apenas UCEs ligadas GQT em servios, de acordo com a trilogia propagada
por Deming e Juran, ou seja, planejamento, controle e melhoria da GQTem servios.
No haver, portanto, UCEs de outras reas/subreas, como na obra de Paulo M.
Prazeres. Isto s ocorrer se houver uma necessidade de esclarecimento, como no caso
das UCEs relacionadas estatstica, ao marketing e aos bancos. No sero
mencionadas, tampouco, UCEs relacionadas biografia de precursores da GQT no
mundo, como ocorreu na obra publicada pela Fundao Christiano Ottoni.
Em relao questo da informatizao do banco de dados, a inteno era utilizar o




250


software Folio Builder 4.1 que auxilia na delimitao dessas unidades de conhecimento
especializado, alm das leituras propriamente ditas das obras em questo. Por meio de um
scanner, seria possvel copiar textos para o computador e, por meio desse software aludido,
verificar a ocorrncia das UCEs em seus contextos significativos.
No entanto, no decorrer da pesquisa, chegou-se concluso de que a utilizao do
software talvez se tornasse problemtica devido ao fato de que a rea objeto da pesquisa estar
ainda em formao. Optou-se, ento, apenas pela leitura das obras que serviram como corpus
e esta foi uma deciso acertada, uma vez que ficou evidenciado, na estrutura conceitual, as
complexas relaes que envolvem a gesto pela qualidade total em servios e no era possvel
classificar as UCEs nos campos correspondentes, j que a literatura vigente e o prprio
especialista s reconheciam as dimenses do planejamento, do controle e da melhoria, fato
que foi revertido aps o conhecimento da estrutura conceitual.


III.2. Estrutura da ficha terminolgica
Antes que a UCE se transformasse em verbete do dicionrio, porm, o procedimento
metodolgico adotado foi o preenchimento das fichas terminolgicas, que servem como
dossis da mesma. A ficha terminolgica pde conter a UCE em sua lngua original, pois a
primeira pesquisa realizada, da GQT em manufatutra, demonstrou que nem todas as UCEs
relacionadas possuam um equivalente em lngua portuguesa. Nesses casos, apenas o
especialista foi capaz de esclarecer se a UCE deveria entrar como verbete ou remissiva.







251


H vrios modelos de ficha terminolgica, mas, segundo M. T. Cabr,
120
pode-se
distinguir trs tipos: as fichas terminolgicas monolnges, as fichas terminolgicas
monolnges com equivalncias e as fichas terminolgicas bilnges ou multilnges. A que
se mostrou pertinente para a pesquisa foi a do primeiro tipo, ou seja, ficha terminolgica
monolnge.
Mesmo em se tratando de tipologia monolnge, h muitas variaes, dependendo do
tipo de trabalho a ser empreendido. No caso desta pesquisa, o modelo de ficha/pesquisa
terminolgica mais adequado ao trabalho baseou-se na sugesto da Prof. Dr. Ieda Maria
Alves que preconiza sua apresentao em 18 (dezoito) campos e foi tambm
informatizada por meio do gerenciador de banco de dados MS-Access, de ampla
difuso, que se mostrou muito apropriado para esse tipo de tarefa, pois, alm dos
recursos habituais de um gerenciador de banco de dados, permitiu a converso dos
arquivos para o processador de textos MS-Word. conveniente expor aqui, portanto, o
protocolo de utilizao
121
para a explicao e o detalhamento dos contedos constantes
de cada campo previsto na ficha terminolgica:

Campo 1. CDIGO: a ficha apresenta um nmero de identificao automtico
da UCE fornecido pelo gerenciador de banco de dados MS-Access;


Campo 2. UCE: a UCE est apresentada sob forma lematizada (forma nominal
no masculino singular e verbo no infinitivo). As excees implicam

120
Cf. CABR, M. T. La terminologa: teora, metodologa, aplicaciones, 1993, p. 282.
121
Cf. CABR, M. T. Op Cit., p. 283.




252


que a mesma sempre utilizada no plural ou que seu conceito
comporta vrios elementos constituintes;
Campo 2.1. SIGLA: forma abreviada como a UCE tambm conhecida;
Campo 2.2. VARIANTE: outra forma utilizada sem critrios, ou seja,
discrepncias ortogrficas e/ou morfossintticas. Priorizou-se a
abertura de uma ficha para a UCE mais utilizada e foi includo um
contexto, na mesma ficha, com a outra menos conhecida;

Campo 3. REFERNCIAS GRAMATICAIS: indicaes morfolgicas mnimas
necessrias para a adequada utilizao da UCE em um contexto;

Campo 4. CONTEXTO: transcrio do contexto, de carter definitrio,
preferencialmente, em que a UCE ocorreu na fonte, que visa a
apresent-la, colocada entre < >, no mbito de seu funcionamento
conceitual e morfossinttico. apresentado mais de um contexto
apenas nos casos em que h variante, como explicitado acima, ou
quando houve deciso deliberada do pesquisador;

Campo 5. REFERNCIAS DO CONTEXTO: indicaes do autor (nome) e da
fonte (do ano de publicao e da pgina), que remetem ao corpus da
pesquisa, item VI.3 do Captulo Referncias Bibliogrficas;

Campo 6. OBSERVAES LINGSTICAS: indicaes de particularidades
gramaticais e lingsticas da UCE, com a utilizao da seguinte




253


acrossemia: s (substantivo), adj (adjetivo), ar (artigo), v (verbo), p
(preposio), cp (contrao prepositiva), c (conjuno), n (numeral),
pref (prefixo), suf (sufixo), pr (pronome) e adv (advrbio) e de um
cdigo dado para efeito de referncia em relao sua formao,
alm de outras informaes pertinentes exata compreenso da UCE
em questo;

Campo 7. OBSERVAES ENCICLOPDICAS: indicaes de um nmero
dado para efeito de referncia relacionado parte que constar como
verbete no Dicionrio, ou seja, se planejamento (PI), controle (PII)
ou melhoria (PIII) e de indicaes de particularidades da UCE, no
includas na definio, do ponto de vista histrico, funcional, etc;

Campo 8. DEFINIO: indicaes dos traos necessrios identificao do
conceito, ou seja, um elemento genrico e suas caractersticas
especficas que individualizam a UCE definida. redigida de forma
intencionalmente curta e com o objetivo de ser compreendida por
leitores no-especializados, observando-se a mesma estrutura
sinttica na redao das UCEs relacionadas;

Campo 9. REA: refere-se gesto pela qualidade total em servios e,
eventualmente, quando da interseco com o setor de manufaturados,
utilizada a gesto pela qualidade total em manufatura;





254


Campo 10. SUBREA: refere-se quela que caracteriza os bancos e, s vezes,
ao marketing e as relacionadas estatstica, que so utilizadas por
esses especialistas;

Campo 11. DADOS FRASEOLGICOS: eventuais UCEs que se juntam a uma
outra no-sintagmtica;

Campo 12. UCEs RELACIONADAS: denominadas de unitermos, so aquelas
que estejam citadas na ficha terminolgica da UCE, at um nmero
mximo de trs, tanto na definio quanto nas observaes
enciclopdicas, assim como aquelas que pertenam a uma
classificao, sempre em ordem alfabtica, e que faam parte do
repertrio;

Campo 13. SINNIMOS: indicaes dos diferentes significantes da UCE, que
possuem o mesmo significado, utilizados em contextos e fichas
terminolgicas prprios, com a mesma definio;

Campo 14. AUTOR DA FICHA: nome do pesquisador que preencheu a ficha;

Campo 15. REVISOR: nome do pesquisador que revisou a ficha aps a
colaborao do especialista da rea;





255


Campo 16. DATA DO REGISTRO: data em que a ficha foi preenchida pela
primeira vez, sem mencionar as revises e reelaboraes.

Para a concretizao desse Dicionrio Terminolgico, foram elaboradas 783
(setecentas e oitenta e trs) fichas terminolgicas, que foram remetidas ao especialista
da rea para reviso e adequao em relao aos conhecimentos ali auferidos. Desse
total, percebeu-se que 305 (trezentas e cinco) delas relacionavam-se especificamente
ao setor de servios, enquanto outras 478 (quatrocentas e setenta e oito) mesclavam-se
com o setor de manufatura, expondo, assim, a interseco entre as reas j aludidas.
Alm disso, foi possvel identificar 40 (quarenta) UCEs especficas para a subrea dos
bancos e outras 100 (cem) relacionadas subrea da estatstica, como outras 50
(cinqenta) para marketing. Foram ainda identificados 118 (cento e dezoito)
sinnimos, o que diminuiu para 665 (seiscentos e sessenta e cinco) o nmero de UCEs
da rea pesquisada e identificadas 65 (sessenta e cinco) UCESs em sua forma original,
ou seja, caracterizadas como emprstimos da lngua inglesa ou japonesa e que
continuam sendo utilizadas em sua forma original. No captulo dedicado concluso,
esses nmeros voltaro a ser apresentados. A seguir, trs exemplos de fichas
terminolgicas preenchidas:










256


Cdigo 93121692
uce gesto pela qualidade total em servios
sigla GQT em servios
variante gesto da qualidade em servios
referncias sf
contexto Confirmada essa tendncia, o mercado voltar suas atenes para a
empresa de Qualidade, no mais para a empresa com Sistemas de Garantia da Qualidade. O
diferencial passar a ser ento a <gesto pela qualidade total em servios>. Considerando que
o prazo de maturao dos programas de qualidade longo, julga-se prudente que os bancos
em operao no Brasil, o quanto antes, elaborem e avaliem seus projetos de qualidade. O
tempo perdido hoje poder ensejar o cliente perdido amanh. // Depois de uma base comum
englobando essencialmente os conceitos (de meio-dia a um dia inteiro), importante abordar
rapidamente a prtica e adaptar o modelo ao ambiente da empresa. A <gesto da qualidade em
servios>, em contato com seus clientes, diferente do controle da qualidade em um setor de
produo muito industrial, ou do planejamento da qualidade dentro do departamento de
projetos.
referncias do ALMEIDA, R. C. de, 1998, p. 89. // TEBOUL, J., 1991, p. 231.
observaes s+cp+s+adj+p+s (I.4.1.1.2., I.4.1.2.7. e I.4.2.3.)
observaes (P II) Filosofia administrativa que deve envolver todas as gerncias da
organizao de servios e eliminar a viso de que apenas a gerncia da qualidade a
responsvel pela mesma.




257


definio Parte da gerncia global que determina e implementa a poltica da
qualidade a partir de um conjunto de procedimentos que incluem planejamento estratgico,
alocao de recursos e outras atividades sistemticas como o planejamento, o controle e a
melhoria da qualidade em servios.
rea servios
subrea
dados
uce's relacionadas gerncia da qualidade; planejamento estratgico; poltica da qualidade
sinnimos
autor da ficha Manoel
revisor Manoel
data do registro 16/10/01
Quarta-feira, 4 de Dezembro de 2002. Pgina 391 de 801












258


Cdigo 2038810159
uce ndice Cpk
sigla Cpk
variante
referncias sm
contexto Os engenheiros da fabricao precisavam, primeiramente, compreender
bem o processo e o seu funcionamento, antes que pudessem ser teis para sua correo. Mas,
de forma igualmente importante, precisavam determinar o quo capaz era o processo em sua
capacidade de produzir produtos dentro dos limites das especificaes do cliente. E para isso
era necessrio que quantificassem seu <ndice Cpk>. (...) A equipe progrediu rapidamente e,
enquanto quantificavam a caracterstica, descobriram que ela era extremamente capaz para
suas exigncias. O valor de seu <Cpk> era 2, 83, e os dados provavam que estava muito bem
controlada estatisticamente.
referncias do PEREZ-WILSON, M., 1999, p. 43 e 46.
observaes s+sigla (I.4.1.2.7. E I.4.2.1.) A sigla corresponde ao original ingls see-
pee-kay, cuja traduo coeficiente de capacidade do processo.
observaes (P II) Quanto maior o valor de Cpk, melhor o processo, ou seja, mais
uniforme e mais repetitivo o processo e quanto menor o valor de Cpk, pior o processo e
maior a variabilidade que ele apresentar na produo/prestao de servios dentro dos limites
da especificao.
definio ndice da capacidade do processo, que quantifica a capacidade de o




259


processo produzir produtos/prestar servios dentro dos limites da especificao.
rea servios; manufatura
subrea estatstica
dados
uce's relacionadas capacidade do processo; coeficiente de capacidade do processo (CpK);
limites de especificao
sinnimos
autor da ficha Manoel
revisor Manoel
data do registro 1/11/02
Quarta-feira, 18 de Dezembro de 2002. Pgina 410 de 801













260


Cdigo 836862380
uce poka-yoke
sigla
variante pokayoke
referncias sm
contexto A soluo do Grupo de Melhoria desta fbrica foi a introduo do
<"poka-yoke"> (P) no bloco; assim o operador "no precisa estimar a posio correta do
tubo" e basta pr gravidade que a extremidade do tubo encoste no <"poka-yoke">. E assim
s soldar! fcil, no ? // O sistema prova de falhas foi guindado categoria de uma fina
arte em algumas das melhores companhias manufatureiras do Japo. A palavra japonesa para
ele <pokayoke>, que algumas companhias ocidentais usam alternadamente com seu
equivalente no respectivo idioma.
referncias do YOSHINAGA, C., 1988, p. 134. // SCHONBERGER, R. J., 1992, p. 78.
observaes s+s (II.1.3.1.) Emprstimo do japons cuja traduo sistema prova de
falhas.
observaes (P II) O conceito traduzido refere-se a uma falha de interpretao do
mecanismo em utilizao do que propriamente a uma depreciao em relao mo-de-obra.
definio Incorporao de mecanismos de defesa tecnologia de um processo que
reduzem as probabilidades de erros da mo-de-obra por inadvertncia.
rea servios; manufatura




261


subrea
dados mecanismos de poka-yoke; poka-yoke em servios; sistemas poka-yoke
uce's relacionadas processo
sinnimos fool proof; sistema prova de falhas
autor da ficha Manoel
revisor Manoel
data do registro 9/12/01
Sexta-feira, 3 de Janeiro de 2003 Pgina 580 de 801
















262


III.3. Estrutura do verbete
Com base nessa ficha de pesquisa terminolgica, foi elaborado o Dicionrio
terminolgico da gesto pela qualidade total em servios que apresenta 783
(setecentas e oitenta e trs) entradas e 665 (seiscentos e sessenta e cinco) verbetes.
Cada verbete contm informaes sistemticas (obrigatrias em todos) e no-
sistemticas (informaes no-recorrentes). As informaes sistemticas compem a
seguinte microestrutura: UCE, referncias gramaticais, definio, contexto, referncias
do contexto e remissiva. As no-sistemticas compem a seguinte microestrutura:
sigla, variante, observaes enciclopdicas, que viro sob forma de nota, e sinnimos.
As UCEs recolhidas esto classificadas em ordem alfabtica, respeitando uma ordem
seqencial. Essa ordem permite um acesso rpido e fcil s informaes. Para facilitar ainda
mais o acesso aos dados, o Dicionrio est subdividido em trs partes: a primeira traz UCEs
relacionadas ao planejamento da GQT em servios (P I); a segunda relaciona UCEs ligadas ao
controle da GQT em servios (P II); a terceira e ltima parte abriga uma relao de UCEs
inerentes melhoria da GQT em servios (P III), segundo a trilogia de Deming. Com o intuito
de agilizar a consulta, o Dicionrio traz ainda um ndice remissivo no incio onde consta a
UCE, a parte e a pgina em que ela se encontra.
Ao consultar o verbete, o usurio ter acesso aos seguintes dados sistemticos:
A. A UCE na seqncia alfabtica: como unidade bsica da terminologia, a UCE
constituda por uma denominao e um conceito determinado dentro da rea
pesquisada e esto apresentadas sob forma lematizada: substantivos e adjetivos no
masculino singular e verbos no infinitivo. As excees a esta sistematizao
implicam que a UCE sempre utilizada no plural ou seu conceito comporta vrios
elementos constituintes. Quando houver sigla ou acrnimo correspondente, os




263


mesmos sero dados como informao no-sistemtica pois, s vezes, eles podem
ser at mais conhecidos do que a prpria UCE;

B. A referncia gramatical: a referncia morfolgica e visa a indicar a classe
gramatical da UCE e a sua provvel posio sinttica dentro de uma frase. H
indicao de gnero para os substantivos e adjetivos e apenas a indicao de verbo
para o mesmo sem a sua transitividade. Os emprstimos tm o gnero registrado
apenas nos casos em que o determinante est explcito no contexto;

C. A definio: ela segue os preceitos preconizados pela teoria terminolgica e traz
uma UCE conceitualmente mais genrica que a UCE definida e as caractersticas
que individualizam a mesma. Conhecida como descritor, essa UCE possui a
mesma classe gramatical da UCE que est sendo definida, mas, se ela for um
sintagma, sua definio ter como descritor a base do mesmo. Redigida de forma
intencionalmente curta e com o objetivo de ser compreendida por usurios no
especializados, foi baseada nos contextos encontrados e, muitas vezes,
complementada pelo especialista consultado que a validou do ponto de vista
conceitual;

D. O contexto: ele a ocorrncia lingstica de uma UCE em um enunciado, ou seja,
uma frase ou segmento de frase onde aparece a UCE no-lematizada, no mbito de
seu funcionamento conceitual e morfossinttico. Ele foi extrado, com carter
definitrio, preferentemente, das 29 (vinte e nove) obras que serviram como fontes
e colocado entre sinais (< >) para melhor visualizao por parte do usurio final.




264


Os verbetes apresentam mais de um contexto nos casos em que um complementa o
outro, e juntos contribuem para a elucidao da UCE analisada, ou, quando for o
caso, a UCE apresentou uma variante. Nestes casos, sero divididos por duas
barras (//) que se repetiro nas referncias do contexto, evitando ambiguidades.

E. As referncias do contexto: aps a cpia do contexto, h uma indicao da
referncia da fonte de onde foi extrada a UCE, que remete o leitor ao item VI.3,
Referncias Bibliogrficas;

F. As remissivas, simbolizadas por Cf.: elas so a indicao de uma relao que se
estabelece entre duas entradas conceitualmente relacionadas e que faam parte do
repertrio. Implicam, por conseguinte, que so UCEs complementares, foram
citadas tanto na definio quanto nas observaes enciclopdicas ou lingsticas ou
mesmo que pertenam a uma classificao da UCE analisada;

Ainda ao consultar o verbete, o usurio poder ter acesso s seguintes informaes
no-sistemticas:
A. A sigla: forma concorrencial das UCEs sintagmticas, subdividida em acrnimo
(reduo do sintagma sob forma de slabas, geralmente as iniciais, pronunciadas
como uma palavra autnoma) e sigla (reduo do sintagma sob forma de suas
letras iniciais);

B. A variante: outra forma em que elementos de UCEs sintagmticas apresentam
alternncia de carter ortogrfico e/ou morfossinttico, embora amplamente




265


divulgados na rea pesquisada;

C. A observao lingstica: vir sob a forma de nota e refere-se, principalmente,
traduo da UCE;

D. A observao enciclopdica: vir tambm sob a forma de nota e indicar
particularidades da UCE, no-includas na definio, que dizem respeito ao
histrico ou ao emprego da UCE sob anlise;

E. O sinnimo: a citao de um sinnimo ser considerada como uma remisso, com
indicao dos diferentes significantes da UCE, em que todas tero entrada prpria
no dicionrio, mas apresentaro a mesma definio.

A seguir, as mesmas UCEs apresentadas na estrutura da ficha terminolgica sero
apresentadas sob forma de verbetes:











266


gesto pela qualidade total em servios sf
GQT em servios
gesto da qualidade em servios
Parte da gerncia global que determina e implementa a poltica da qualidade a partir de
um conjunto de procedimentos que incluem planejamento estratgico, alocao de
recursos e outras atividades sistemticas como o planejamento, o controle e a melhoria
da qualidade em servios.
Confirmada essa tendncia, o mercado voltar suas atenes para a empresa de
Qualidade, no mais para a empresa com Sistemas de Garantia da Qualidade. O
diferencial passar a ser ento a <gesto pela qualidade total em servios>.
Considerando que o prazo de maturao dos programas de qualidade longo, julga-
se prudente que os bancos em operao no Brasil, o quanto antes, elaborem e avaliem
seus projetos de qualidade. O tempo perdido hoje poder ensejar o cliente perdido
amanh. // Depois de uma base comum englobando essencialmente os conceitos (de
meio-dia a um dia inteiro), importante abordar rapidamente a prtica e adaptar o
modelo ao ambiente da empresa. A <gesto da qualidade em servios>, em contato
com seus clientes, diferente do controle da qualidade em um setor de produo
muito industrial, ou do planejamento da qualidade dentro do departamento de
projetos. (ALMEIDA, R. C. de, 1998, p. 89. // TEBOUL, J., 1991, p. 231)
Nota Filosofia administrativa que deve envolver todas as gerncias da organizao de
servios e eliminar a viso de que apenas a gerncia da qualidade a responsvel pela
mesma.
Cf. gerncia da qualidade; planejamento estratgico; poltica da qualidade








267


ndice Cpk sm
Cpk
ndice da capacidade do processo, que quantifica a capacidade de o processo produzir
produtos/prestar servios dentro dos limites da especificao.
Os engenheiros da fabricao precisavam, primeiramente, compreender bem o
processo e o seu funcionamento, antes que pudessem ser teis para sua correo.
Mas, de forma igualmente importante, precisavam determinar o quo capaz era o
processo em sua capacidade de produzir produtos dentro dos limites das
especificaes do cliente. E para isso era necessrio que quantificassem seu <ndice
Cpk>. (...) A equipe progrediu rapidamente e, enquanto quantificavam a
caracterstica, descobriram que ela era extremamente capaz para suas exigncias. O
valor de seu <Cpk> era 2, 83, e os dados provavam que estava muito bem controlada
estatisticamente. (PEREZ-WILSON, M., 1999, p. 43 e 46)
Nota A sigla corresponde ao original ingls see-pee-kay, cuja traduo coeficiente de
capacidade do processo.
Quanto maior o valor de Cpk, melhor o processo, ou seja, mais uniforme e mais
repetitivo o processo e quanto menor o valor de Cpk, pior o processo e maior a
variabilidade que ele apresentar na produo/prestao de servios dentro dos limites
da especificao.
Cf. capacidade do processo; coeficiente de capacidade do processo (CpK); limites de
especificao










268


poka-yoke sm
pokayoke
mecanismos de poka-yoke; poka-yoke em servios; sistemas poka-yoke
Incorporao de mecanismos de defesa tecnologia de um processo que reduzem as
probabilidades de erros da mo-de-obra por inadvertncia.
A soluo do Grupo de Melhoria desta fbrica foi a introduo do <"poka-yoke"> (P)
no bloco; assim o operador "no precisa estimar a posio correta do tubo" e basta
pr gravidade que a extremidade do tubo encoste no <"poka-yoke">. E assim s
soldar! fcil, no ? // O sistema prova de falhas foi guindado categoria de uma
fina arte em algumas das melhores companhias manufatureiras do Japo. A palavra
japonesa para ele <pokayoke>, que algumas companhias ocidentais usam
alternadamente com seu equivalente no respectivo idioma. (YOSHINAGA, C., 1988,
p. 134. // SCHONBERGER, R. J., 1992, p. 78.)
Nota Emprstimo do japons cuja traduo sistema prova de falhas.
O conceito traduzido refere-se a uma falha de interpretao do mecanismo em
utilizao do que propriamente uma depreciao em relao mo-de-obra.
Sin. fool proof; sistema prova de falhas













269


UNIVERSIDADE DE SO PAULO
FACULDADE DE FILOSOFIA, LETRAS E CINCIAS HUMANAS











DICIONRIO TERMINOLGICO DA GESTO
PELA QUALIDADE TOTAL EM SERVIOS






MANOEL MESSIAS ALVES DA SILVA



VOLUME II






SO PAULO
2003





270


IV. DICIONRIO TERMINOLGICO DA GESTO PELA QUALIDADE TOTAL
EM SERVIOS
IV.1. Introduo
Este dicionrio terminolgico a parte prtica da Tese de Doutoramento intitulada
Dicionrio terminlgico da gesto pela qualidade total em servios. Ele insere-se tambm no
mbito do Projeto "Observatrio de neologismos cientficos e tcnicos do Portugus
contemporneo do Brasil", criado em 1988 e de repercuo nacional, cuja coordenao
exercida pela Profa. Dra. Ieda Maria Alves, tambm orientadora desta pesquisa. O objetivo do
Projeto, que conta com o apoio do Conselho Nacional de Desenvolvimento Cientfico e
Tecnolgico (CNPQ), Fundao de Amparo Pesquisa do Estado de So Paulo (Fapesp) e
Pr-Reitoria de Pesquisa da Universidade de So Paulo, coletar, analisar e difundir aspectos
da neologia tcnico-cientfica e, ainda, como no caso especfico deste trabalho que, alm dos
apoios mencionados, contou tambm com recursos financeiros da Coordenao de
Aperfeioamento de Pessoal de Nvel Superior (Capes) e Universidade Estadual de Maring
(UEM), elaborar glossrios e dicionrios terminolgicos em algumas das reas analisadas.
A terminologia da gesto pela qualidade total tem sido estudada por este pesquisador
que apresenta a Tese desde o ano de 1993, quando ingressou no Curso de Ps-Graduao em
Letras Clssicas e Vernculas, rea de Concentrao em Filologia e Lngua Portuguesa, do
Departamento de Letras Clssicas e Vernculas, da Faculdade de Filosofia, Letras e Cincias
Humanas, da Universidade de So Paulo, nvel Mestrado, e ao qual esta Tese est sendo
submetida, agora em nvel de Doutorado.
O aumento da competitividade das organizaes nacionais e transnacionais, o
fenmeno da globalizao econmica e a tentativa muitas vezes bem-sucedida de transformar
o Brasil em um pas exportador so responsveis, dentre outros fatores, pela criao e




271


emprego dessa terminologia bastante variada, que reflete as mudanas econmicas pelas quais
a sociedade brasieleira vem passando e que desaguou na questo dos servios.


IV.1.1. Constituio da nomenclatura
Nesta pesquisa, so registradas UCEs da gesto pela qualidade total em servios que
foram coletadas sistematicamente em 29 (vinte e nove) obras especializadas relacionadas
rea analisada. Por terem sido coletadas em corpus especializado, dirigido a leitores
especialistas, esta pesquisa destina-se a este pblico, mas, com a aplicao da teoria
terminolgica relacionada s definies, tem tambm a pretenso de atingir leitores no-
especialistas, que estejam inseridos no mercado de trabalho e tenham necessidade de
compreender os conceitos aqui apresentados.
Este trabalho pretende, assim, elucidar as UCEs da gesto pela qualidade total em
servios que so mais freqentemente utilizadas pelos especialistas da rea analisada no que
concerne s trs dimenses propagadas por Deming e Juran, ou seja, o planejamento, o
controle e a melhoria da GQT em servios, como tambm apresentar aquelas que estejam
relacionadas estatstica, ao marketing e aos bancos, em particular, com o intuito de
apresentar um dicionrio que seja o mais abrangente possvel da rea especializada.
Nas obras analisadas, foram detectadas 783 (setecentas e oitenta e trs) UCEs,
das quais 305 (trezentas e cinco) delas relacionam-se especificamente ao setor de
servios, enquanto outras 478 (quatrocentas e setenta e oito) mesclam-se com o setor
de manufatura, expondo, assim, a interseco entre as reas. Alm disso, foi possvel
identificar 40 (quarenta) UCEs especficas dos bancos e outras 100 (cem) relacionadas
estatstica, alm de outras 50 (cinqenta) relacionadas ao marketing. Foram ainda




272


identificados 118 (cento e dezoito) sinnimos, o que diminuiu para 665 (seiscentos e
sessenta e cinco) o nmero de UCEs da rea pesquisada e identificadas 65 (sessenta e
cinco) UCEs em sua forma original, ou seja, caracterizadas como emprstimos da
lngua inglesa ou japonesa e que continuam sendo utilizadas pelos especialistas em sua
forma original.
No houve preocupao com o carter neolgico das UCEs em relao aos seus
significantes e, portanto, no foi estabelecido nenhum corpus de excluso, ou seja, o
conjunto de dicionrios que servem de referncia para o estabelecimento do carter
neolgico de uma UCE.


IV.1.2. Apresentao dos verbetes
Os verbetes esto apresentados em ordem alfabtica, em trs partes distintas que
seguem a trilogia Deming/Juran, e obedecem seguinte estrutura: UCE; Referncias
Gramaticais; Sigla ou Acrnimo, Variante e Dados Fraseolgicos, em alguns casos;
Definio; Contexto (s); Notas, que se referem a Observaes Lingsticas e/ou
Enciclopdicas, s vezes; Sinnimo (s) e Remissiva (s), em alguns casos. Antes de ter acesso
aos dados, o usurio tem sua disposio um ndice remissivo das UCEs, que trar a parte e a
pgina em que a UCE procurada se encontra.

1. UCE
As UCEs esto apresentadas sob forma lematizada: substantivos e adjetivos no
masculino singular e verbos no infinitivo. As excees a esta sistematizao implicam que a




273


UCE sempre utilizada no plural (atividades em pequenos grupos - APGs) ou seu conceito
comporta vrios elementos constituintes, como 14 princpios ou 4 Ps do servio.
Algumas UCEs constituem unidades lexicais j pertencentes terminologia da gesto
pela qualidade total em servios (atendimento face nica, caracterstica intangvel dos
servios). Outras referem-se estatstica, marketing e bancos, como j explicitado. Outras
ainda, com sndrome da pizzaria, parecem revelar um certo aspecto ldico da linguagem da
GQT em servios.
Foi considerada tambm oportuna a incluso, em um trabalho que visa explicao e
divulgao de uma terminologia, de UCEs referentes a denominaes de ndices estatsticos
(ndice CpK - CpK, limites de especificao) e de algumas instituies (Associao
Brasileira de Normas Tcnicas - ABNT, International Organization for Standardization
- ISO). Nesses casos, as UCEs esto apresentadas com as letras iniciais em maiscula. Com
estas incluses, e com base em Ieda M. Alves,
122
o trabalho talvez possa extrapolar o carter
estritamente lingstico e incorporar elementos enciclopdicos. No entanto, o fato constitui
uma das caractersticas da rea pesquisada e essas incluses so necessrias para a
compreenso da mesma.
Os emprstimos em lngua inglesa e japonesa so apresentados em sua forma original
e comentados lingisticamente no item Nota.

2. Referncias Gramaticais
As referncias gramaticais referem-se, na maioria dos casos, a substantivos masculinos


122
Cf. ALVES, I. M. Glossrio dos termos neolgicos da economia, 1998, p. 11.




274


e femininos. Dentre esses, grande parte constituda por sintagmas nominais, como processo
de melhoria contnua, valor agregado. registrado ainda o emprego de verbo em sintagmas
verbais (instituir liderana) e de adjetivo (no-conforme). Curiosamente, no foi registrado
nem identificado nenhum advrbio.
Os emprstimos do ingls e do japons tm o gnero registrado apenas nos casos em
que o determinante est explcito no contexto (do benchmarking, o brainstorm, um
brainwriting).

3. Sigla e Acrnimo
As siglas e os acrnimos, relativamente numerosos na terminologia pesquisada, esto
aqui representados, em que vrias UCEs sintagmticas sofrem a concorrncia de seus
respectivos acrnimos (reduo do sintagma sob forma de slabas, geralmente as iniciais,
pronunciadas como uma palavra autnoma: just-in-time/JIT, procedimento operacional
padro/POP, tcnica de anlise da avaliao do programa/PERT) ou siglas (reduo do
sintagma sob forma de suas letras iniciais: total quality control/TQC, zero defeito/ZD)

4. Variante
Nesse campo, so registradas variaes em que elementos de UCEs sintagmticas
apresentam alternncia de carter morfossinttico e/ou ortogrfico. Em alguns casos, a
alternncia reflete-se na escolha do sufixo (auditoria da qualidade/auditagem da
qualidade). Em outros, h o apagamento de elementos do sintagma: ciclo PDCA/PDCA. Em
outros ainda, h casos em que o adjetivo alterna com o emprego do sintagma preposicionado:
marketing bancrio/marketing dos bancos. Em relao ortografia, h casos de ser apenas
a presena ou a ausncia de um hfen (controle da qualidade amplo empresarial/controle




275


da qualidade amplo-empresarial, diagrama espinha de peixe/diagrama espinha-de-
peixe) e outros em que h a presena ou a ausncia de determinante, como em momentos da
verdade/momentos de verdade e nvel da qualidade/nvel de qualidade.

5. Dados Fraseolgicos
A expanso de um sintagma nominal mencionada antes da definio da UCE e
sempre que a UCE expandida for empregada com baixa freqncia, como ocorre em nvel da
qualidade desejado, expanso de nvel da qualidade e manual da qualidade do
fabricante/manual da qualidade do fornecedor, UCEs expandidas de manual da
qualidade (MQ).

6. Definio
As definies apresentam uma UCE genrica e as caractersticas que individualizam a
UCE definida. Conhecida como descritor, essa UCE possui a mesma classe gramatical da
UCE que est sendo definida, mas, se ela for um sintagma, sua definio ter como descritor a
base do mesmo. Redigida de forma intencionalmente curta e com o objetivo de ser
compreendida por usurios no-especialistas, foi baseada nos contextos encontrados e, muitas
vezes, complementada pelo especialista consultado que a validou do ponto de vista
conceitual.
Sempre que possvel, observada a mesma estrutura sinttica na redao das UCEs
relacionadas. Na ordenao das caractersticas das UCEs, procura-se apresentar, quando
pertinentes, sua constituio e em seguida seu objetivo. As UCEs includas nas definies
integram o repertrio do dicionrio.





276


7. Contexto (s)
Nesse campo, registrado um contexto, de carter definitrio, preferentemente,
extrado de uma das 29 (vinte e nove obras) que serviram como fonte da pesquisa, que visa a
apresentar a UCE, colocada entre < >, no mbito de seu funcionamento conceitual e
morfossinttico. Os verbetes apresentam mais de um contexto nos casos em que um
complementa o outro, e juntos contribuem para a elucidao da UCE analisada, ou, quando
for o caso, a UCE apresenta uma variante. Nesses casos, so divididos por duas barras (//),
que se repetiro nas referncias do contexto, evitando, assim, ambiguidades.

8. Referncia (s) do Contexto (s)
Aps a cpia do (s) contexto (s), h uma indicao da referncia da fonte de onde foi
extrada a UCE, que remete o usurio ao Captulo VI. Referncias Bibliogrficas, item VI.3.
Obras especializadas.

9. Nota
So includas, nesse campo, observaes de carter lingstico e/ou enciclopdico
sobre a UCE analisada e sempre nesta ordem.
As observaes de carter lingstico referem-se a informaes sobre a traduo da
UCE analisada. As observaes de carter enciclopdico visam a apresentar informaes, no
includas na definio, que dizem respeito ao histrico ou ao emprego da UCE sob anlise.
Elas esto fundamentadas nos contextos coletados ou foram sugeridas pelo especialista
consultado.






277


10. Sinnimo (s)
As relaes sinonmicas, indicaes dos diferentes significantes da UCE que possuem
o mesmo significado, esto registradas. Em todos os verbetes viro repetidos os dados
coletados para facilitar a consulta por parte do usurio final. Dessa forma, o verbete principal,
com a definio, refere-se UCE mais freqente; o sinnimo menos freqente tambm
apresentado com um contexto especfico e, no verbete, se encontrar tambm a definio
idntica ao de seu (s) sinnimo (s).

11. Remissiva (s)
As remissivas, simbolizadas por Cf., relacionam UCEs que fazem parte do repertrio.
Implicam que so UCEs complementares, foram citadas tanto na definio quanto nas
observaes lingsticas ou enciclopdicas ou mesmo que pertenam a uma classificao da
UCE analisada. Sero apresentadas no mximo trs remissivas, a no ser nos casos em que
haja uma classificao, onde todas as UCEs pertencentes mesma estaro presentes.














278


IV.2. Abreviaturas utilizadas
adj adjetivo
Cf. Conferir
f feminino
Fras. Dados fraseolgicos
m masculino
p. pgina (s)
P Parte
Sin. Sinnimo (s)
v verbo
V Volume
Var. Variante
















279


IV.3. ndice remissivo das unidades de conhecimento especializado
14 princpios P I 312
4 Ps do servio P III 586
abordagem por projetos P II 462
abordagem por sistemas P II 462
ao corretiva P III 586
adaptabilidade P III 587
adequao ao uso P I 312
administrao P II 463
administrao ambulante (MBWA) P II 463
administrao da qualidade P II 463
administrao da qualidade total (TQM) P II 464
administrao de marketing P II 465
administrao de operaes P II 465
administrao de servios P II 466
administrao estratgica P II 466
administrao multifuncional P II 467
administrao orientada para o processo P II 467
administrao orientada para o resultado P II 467
administrao participativa P II 468
administrao por objetivos (APO) P II 468
administrao superior P II 468
adotar a nova filosofia P I 313
aferidor de maturidade da gerncia da qualidade P II 469




280


agncia P I 313
agncia de corporate P I 313
agncia private P I 314
agir como pequeno porte P III 587
alavancagem P I 314
alcanar o seis sigma P III 587
alegria P III 588
alta administrao P II 469
alta-direo P II 470
ambiente da organizao P I 315
ambiente de marketing P I 315
amostragem aleatria P II 470
amplitude do processo P II 470
anlise competitiva P III 588
anlise de Pareto P II 471
anlise de processo P II 471
anlise do valor (AV) P II 472
antimarketing P I 315
aperfeioamento contnuo P III 588
aperfeioamento da qualidade P III 589
aperfeioar o sistema P III 589
aprimoramento do processo P III 590
Associao Brasileira de Normas Tcnicas (ABNT) P I 316
atender s necessidades do cliente P II 472




281


atendimento P II 473
atendimento eletrnico P II 473
atendimento face nica P II 473
atividades de marketing P II 474
atividades em pequenos grupos (APGs) P II 474
auditoria P II 475
auditoria da qualidade P II 475
auditoria da qualidade do processo P II 476
auditoria da qualidade do servio P II 476
auditoria de certificao P II 477
auditoria de conformidade P II 477
auditoria de eficcia P II 477
auditoria do fornecedor P II 478
auditoria do sistema da qualidade P II 478
auditoria do usurio P II 478
auditoria externa da qualidade P II 479
auditoria interna da qualidade P II 479
auto-servio P I 316
autocontrole P II 480
banco virtual P I 316
bancos P I 317
benchmarking P III 590
brainstorming P I 317
brainwriting P I 318




282


brief do servio P I 318
cadeia cliente-fornecedor P I 319
cadeia de clientes P I 319
cadeia de valor P I 320
clculo da qualidade P II 480
campo de servios P I 320
canal de distribuio P I 320
canal de distribuio de servios P I 321
capacidade do processo P II 481
capacidade do servio P II 481
caracterstica intangvel dos servios P I 321
caracterstica tangvel dos servios P I 322
caractersticas da qualidade P I 322
caractersticas do marketing de servios P I 322
caractersticas do servio P I 323
caracterizao de processo P I 323
carta de controle (C. C.) P II 482
carta de tendncias P II 482
carta programada de processo de deciso (PDPC) P II 483
causa acidental P II 483
causa aleatria P II 484
causa atribuvel P II 484
causa comum P II 485
causa especial P II 485




283


causa no-natural P II 486
causa natural P II 486
CB-25 P I 324
clula P II 487
clula confusa P II 487
clula focalizada P II 487
certeza P III 591
certificao de agncia bancria P II 488
certificao de sistema da qualidade P II 488
certificao ISO 9000 P II 488
certificado de conformidade com as normas ISO 9000 P II 489
certificado ISO 9000 P II 490
cessar a aprovao de oramentos com base no preo P I 324
checklist P I 324
ciclo da garantia da qualidade P III 591
ciclo da qualidade P I 325
ciclo de controle P II 490
ciclo de Deming P III 592
ciclo de melhorias P III 592
ciclo de realimentao P III 592
ciclo de rotina P II 491
ciclo de servio P II 491
ciclo de Shewhart P III 593
ciclo de vida do cliente (CVC) P II 491




284


ciclo de vida do produto (CVP) P II 492
ciclo de vida do servio P II 492
ciclo do fracasso P II 493
ciclo do sucesso P II 493
ciclo PaFVA P II 493
ciclo PDCA (PDCA) P III 593
ciclo PFVL P III 594
crculos de controle da qualidade (CCQ) P II 494
classificao dos servios P I 325
cliente P I 326
cliente de servios P I 326
cliente externo P I 327
cliente final P I 327
cliente freqente P I 327
cliente institucional P I 328
cliente intermedirio P I 328
cliente interno P I 328
cliente misterioso P I 329
cliente novo P I 329
cliente particular P I 330
cliente perdido P I 330
cliente potencial P I 330
cliente recuperado P I 331
cliente-fantasma P I 331




285


clientelizao P I 332
coeficiente de capacidade do processo (Cpk) P II 494
coeficiente de potencial do processo (Cp) P II 495
colaborador P I 332
comit da qualidade P I 333
communication-mix do banco P III 594
companhia P I 333
competncia essencial P III 595
competio seis sigma P III 595
complexidade P I 333
composto de marketing P III 596
comprador de servios P I 334
comprador fantasma P I 334
comunicao com o pblico P I 335
conceito de marketing P I 335
conceito de servio P I 335
conceito de servio self-service P I 336
concorrncia com base no tempo P III 596
conferncia de desenvolvimento P I 336
confiabilidade P II 495
confiana do cliente P I 337
conformao P II 496
conformidade P II 496
conformidade do servio P II 497




286


conselho da qualidade P I 337
constncia de propsito P I 338
consultor P I 338
consumerismo P I 338
consumidor P I 339
controle da qualidade (CQ) P II 497
controle da qualidade amplo empresarial (CQAE) P II 498
controle da qualidade de Shewhart P II 498
controle da qualidade defensivo P II 499
controle da qualidade do servio P II 499
controle da qualidade na empresa inteira (CWQC) P II 499
controle da qualidade ofensivo P II 500
controle da qualidade total (TQC) P II 501
controle do destino P III 596
controle do processso P II 501
controle estatstico P II 502
controle estatstico da qualidade (CEQ) P II 502
controle estatstico do processo (CEP) P II 503
cooperao P I 339
credenciamento P III 597
criar constncia de propsito P I 339
cultivo da marca P III 597
cultura P I 340
curva de fidelidade P III 598




287


custo da baixa qualidade P I 340
custo da m qualidade (CMQ) P I 341
custo da no-qualidade P I 341
custo da qualidade (CDQ) P I 342
custo da qualidade ruim P I 342
custo de avaliao P I 342
custo de avaliao da qualidade P I 343
custo de falha externa P I 343
custo de falha interna P I 344
custo de falha no verificvel P I 344
custo de falha verificvel P I 344
custo de obteno da qualidade (COQ) P I 345
custo de preveno P I 345
custo de recuperao P I 346
custo de troca de fornecedor P I 346
custo do servio P I 346
custo-alvo P I 347
customizao macia P II 503
dados demogrficos P III 598
dados psicogrficos P III 598
deciso por consenso P III 599
defeitos por millho (DPM) P II 504
defeitos por milho de oportunidades (DPMO) P II 505
defeitos por unidade (DPU) P II 505




288


definio operacional P II 505
delegao P I 347
delegar competncia P I 348
demanda de servio P I 348
demarketing P III 599
desafio do seis sigma P III 600
desdobramento da funo qualidade (DFQ) P III 600
desempenho P III 601
desenvolvimento da qualidade P III 601
desenvolvimento de pessoal P I 349
desenvolvimento de recursos humanos P I 349
desenvolvimento do produto P I 349
design do servio P II 506
despertar P III 601
desvio padro P II 506
diagrama corrido P II 507
diagrama de afinidade (D/Af) P II 507
diagrama de anlise de dados matriciais P II 507
diagrama de rvore (D/Ar) P II 508
diagrama de atividades (D/At) P II 508
diagrama de causa e efeito (DCE) P II 509
diagrama de disperso P II 510
diagrama de flechas P II 510
diagrama de fluxo P II 510




289


diagrama de Ishikawa P II 511
diagrama de matriz (D/Ma) P II 511
diagrama de Pareto P II 512
diagrama de relaes (D/Re) P II 512
diagrama espinha de peixe P II 513
diagrama PDPC P II 513
diligenciamento da qualidade P II 514
dimenso da qualidade P I 350
dimenso da qualidade de servios P I 350
dimenso determinante P III 602
dimenso importante P III 602
dinmica da qualidade P III 602
diretriz da qualidade P III 603
disponibilidade P II 514
disseminao de informaes P I 350
distribuio binomial P II 515
distribuio de Poisson P II 515
distribuio normal P II 515
divergncia P I 351
dono do processo P II 516
durao do servio P II 516
economia da qualidade P II 517
economia de escala P II 517
economia de escopo P II 517




290


economia de integrao P II 518
efeito corrente P II 518
efeito paradigma P I 351
efeito sinergia P I 352
elementos bsicos da viso estratgica de servios P I 352
elementos do servio P II 518
elementos integrativos da viso estratgica de servios P I 352
eliminar a necessidade de inspeo em massa P I 353
eliminar as barreiras entre os departamentos P I 353
eliminar lemas, exortaes e metas P I 353
eliminar o medo P I 354
eliminar padres de trabalho P I 354
embalagem de servios P III 603
empowerment P I 355
empregado P I 355
empresa P I 355
empresa de classe mundial P I 356
empresa de servios P I 356
empresa financeira P I 357
empresa prestadora de servios P I 357
empresa virtual P III 603
empresa-cliente P I 357
encantar o cliente P I 358
enchanted customer P I 358




291


endomarketing P III 604
enfoque na organizao P I 359
enfoque no cliente P I 359
enfoque no processo P I 359
enfoque no produto P I 360
engajar todos na realizao da transformao P I 360
engenharia da qualidade P I 360
envolvimento dos empregados (EE) P I 361
equipe de melhoria contnua P I 361
equipe de melhoria da qualidade P I 362
erradicao da causa de erros (ECE) P III 605
erros por milho (EPM) P II 519
erros por milho de oportunidades (EPMO) P II 519
erros por unidade (EPU) P II 520
esclarecimento P III 605
esforo sobre-humano P III 606
especializao flexvel P II 520
especificao P I 362
especificao do servio P I 363
espiral da qualidade P I 363
estabilidade dinmica P III 606
estao de trabalho P II 520
estado de controle estatstico P II 521
estratgia de acompanhamento da demanda P I 363




292


estratgia de criar switching costs P III 607
estratgia de diferenciao P I 364
estratgia de distribuio para servios P I 364
estratgia de nivelamento da qualidade P I 365
estratgia de operaes P I 365
estratgia de operaes focalizada P I 366
estratgia de servios P I 366
estratgia empresarial P I 367
estratgia essencial P III 607
estratificao P II 521
estudo da potencialidade do processo (CpK) P II 521
estudo de mercado bancrio P I 367
excelncia de execuo P III 608
excelncia em servios P III 608
executivo de marketing P I 368
expectativa do cliente P I 368
extremidades do servio P III 609
fbrica de servios P I 368
facilitador P I 369
farmcia financeira P II 522
feedback P III 609
ferramentas do marketing de servios P III 610
fidelidade do cliente P III 610
fila de espera P II 522




293


filosofia Deming P I 369
floating P I 370
fluxo de processo do servio (FPS) P II 523
fluxograma P II 523
foco P I 371
folha de coleta de dados P II 524
folha de verificao P II 524
fool proof P II 525
fornecedor P I 371
fornecedor de servio P I 372
fornecimento de servio P I 372
franquia P I 372
funo P I 373
funo de linha de frente P I 373
funo de marketing P I 374
funo de operaes P II 525
funo de payoff P II 526
funo de perda (FP) P II 526
funo de retaguarda P II 526
funo de tolerncia P II 527
funo mercadolgica P I 374
funo qualidade P I 375
funcionrio P I 375
funcionrio potencializado P I 375




294


garantia da qualidade (GQ) P III 611
garantia de servio P III 611
generosidade P III 612
gerncia da qualidade P II 527
gerncia de campo P II 528
gerncia de marketing P II 528
gerncia de processos P II 529
gerncia de produto P II 529
gerncia participativa P II 530
gerenciamento da qualidade P II 530
gerenciamento da qualidade por toda a empresa (CWQI) P II 531
gerenciamento da qualidade total (GQT) P II 532
gerenciamento de produo just-in-time P II 532
gerenciamento por objetivos (GPO) P II 533
gesto P II 533
gesto da qualidade (GQ) P II 533
gesto de operaes P II 534
gesto estratgica P II 534
gesto estratgica da qualidade (GEQ) P II 535
gesto estratgica dos servios P II 535
gesto orientada para o processo P II 535
gesto orientada para o resultado P II 536
gesto participativa P II 536
gesto pela qualidade total (GQT) P II 537




295


gesto pela qualidade total em servios (GQT em Servios) P II 537
gesto por objetivos P II 538
grfico corrido P II 538
grfico de controle (GC) P II 539
grfico de controle de Shewhart P II 539
grfico de Gantt P II 540
grfico de Pareto P II 540
grfico PERT P II 540
gravidade, urgncia e tendncia (GUT) P II 541
grupo de melhoria P III 612
grupo de sntese P I 376
hardware P I 376
heterogeneidade P I 377
histograma P II 541
homem de marketing P I 377
humanware P I 378
implementao P II 542
incerteza P I 378
indicador da qualidade (IQ) P II 542
ndice Cpk (Cpk) P II 543
indstria de servios P I 378
infopreneurs P III 613
informao P III 613
informao experimental P III 613




296


informao gerencial P III 614
informao operativa P III 614
informatizao P II 543
inovao P III 615
input P I 379
insatisfao do cliente P III 615
inseparabilidade P III 616
inspeo P II 544
instituio financeira P I 379
instituir liderana P I 380
instituir programa de educao e retreinamento P III 616
instituir treinamento P I 380
instrumentos de marketing P I 380
intangibilidade P III 616
integrao P I 381
integridade P III 617
interao P I 381
interface P I 382
International Organization for Standardization (ISO) P I 382
investimento no sucesso dos colaboradores P III 617
item de controle P II 544
item de demanda dependente P I 383
item de demanda independente P I 383
item de verificao P II 545




297


itens de servio P II 545
just-in-time (JIT) P II 545
kairyo P III 618
kaizen P III 618
lei de Pareto P II 546
lies aprendidas P III 618
lder P I 383
liderana P I 384
liderana baseada em valores P III 619
liderana da qualidade P III 619
limite inferior de controle (LIC) P II 547
limite inferior de especificao (LIE) P II 547
limite superior de controle (LSC) P II 547
limite superior de especificao (LSE) P II 548
limites de controle (LC) P II 548
limites de especificao (LE) P II 549
linha de fluxo P II 549
lista de conferncia P I 384
lista de controle P I 384
lista de verificao P I 385
lucro social P III 620
macromarketing P I 385
manual da qualidade (MQ) P I 386
manutenibilidade P II 549




298


mapa da turbulncia do mercado P III 620
mapa de desenvolvimento do produto P I 386
mapa perceptivo P I 387
marketing P III 621
marketing bancrio P III 621
marketing de servios P III 622
marketing defensivo P III 622
marketing extensivo P III 623
marketing intensivo P III 623
marketing interativo P III 624
marketing interno (MI) P III 624
marketing mix P III 625
marketing ofensivo P III 625
marketing share P III 626
mass customized P I 387
matriz de priorizao (M/Pr) P II 550
matriz de relaes (M/Re) P II 550
medida da qualidade P III 626
melhoramento de servio P III 627
melhoria contnua P III 627
melhorias P III 628
memria social P I 387
mercado P I 388
mercado de consumo P I 388




299


mercado de servios P I 389
mercado potencial P I 389
meta P I 389
mtodo 5W 1H P II 551
mtodo de anlise e soluo de problemas (MASP) P II 551
mtodo de teste P II 551
mtodo estatstico P II 552
mtodo estatstico de amostragem P II 552
mtodo para anlise e melhoria do processo (MAMP) P III 628
mtodo PGP P III 628
metodologia de pesquisa TARP P III 629
metodologia M/PCpS (M/PCpS) P II 553
micromarketing P I 390
misso da empresa P I 390
misso do servio P I 391
modelo das cinco falhas P I 391
modelo de sustentabilidade do sucesso P III 629
momentos da verdade P III 630
momentos de contato P III 631
motivao extrnseca P I 392
motivao intrnseca P I 392
multiplicador P I 392
no-conforme P II 553
no-conformidade P II 554




300


necessidade do cliente P I 393
nvel da qualidade (NQ) P II 554
nvel de capacidade do servio P II 555
nvel de demanda P II 555
nvel de qualidade aceitvel (NQA) P II 556
nvel de servio P II 556
nvel timo da qualidade (NOQ) P II 557
norma ISO 9000 (ISO 9000) P I 393
norma ISO 9001 (ISO 9001) P I 394
norma ISO 9002 (ISO 9002) P I 395
norma ISO 9003 (ISO 9003) P I 395
norma ISO 9004 (ISO 9004) P I 396
norma ISO 9004-2 (ISO 9004-2) P I 397
nova filosofia P I 397
novos servios P III 631
objetivo da qualidade P I 398
objetivo dinmico P III 632
operao de servio P II 557
organizao P I 399
organizao de classe universal P I 399
organizao de qualidade total P I 399
organizao de servios P I 400
organizao fornecedora P I 400
organizao holding P I 400




301


organizao multidivisionria P I 401
organizao por funes P I 401
organizao por mercado P I 402
organizao por produto P I 402
organizao prestadora de servios P I 403
organizao unificada P I 403
otimizao do sistema P II 557
output P I 404
Ps do posicionamento do servio P I 404
package P III 632
pacote de servios P I 405
padro P II 558
padro de demanda P II 558
padro de qualidade P II 558
padro de servio P II 559
pagamento pela percia P III 633
paradigma P I 405
paradigma da produo em massa P I 406
partes por milho (PPM) P II 559
pdca amplo-empresarial P III 633
percepo P I 406
perfil de variedade e customizao P III 633
persistncia do servio P I 406
pesquisa de marketing P I 407




302


planejamento a longo prazo P I 407
planejamento da qualidade P I 408
planejamento da qualidade dos servios P I 408
planejamento de marketing do banco P I 409
planejamento do processo P I 409
planejamento e desenvolvimento do produto bancrio P I 409
planejamento estratgico (P. E.) P I 410
planejamento estratgico da qualidade P I 410
planejamento ttico P I 411
planilha de planejamento da qualidade P I 411
plano P I 411
plano da qualidade P I 412
plano de marketing do banco P I 412
poka-yoke P II 560
poltica da qualidade P I 413
poltica de preo P I 413
ponto de equilbrio mvel P II 561
pontualidade P II 561
portflio P I 413
posicionamento P I 414
preo P I 415
prmio nacional da qualidade (PNQ) P III 634
prestao de servios P II 562
prestador de servios P II 562




303


previso de demanda P I 415
previso de vendas P I 416
previsibilidade P II 562
pricing P I 416
princpio da continuidade P I 417
princpio da proximidade P I 417
princpio da similaridade P I 417
princpio de Pareto P II 563
princpio dos 80/20 P II 563
problema de amanh P II 564
problema de hoje P II 564
problema de qualidade P II 564
problema de servio P II 565
procedimento operacional padro (POP) E (SOP) P II 565
processador unitrio P II 566
processo P I 418
processo de melhoria contnua P III 634
processo de melhoria da qualidade P III 635
processo de prestao de servios P II 566
processo de produo P II 566
processo de servio P II 567
processo estvel P II 567
processo loja de servios P II 568
processo sob controle estatstico P II 568




304


produo de servios P II 568
produtividade P II 569
produto do servio P II 569
produto intangvel P II 569
programa 5 S (5S) P III 635
programa brasileiro da qualidade e produtividade (PBQP) P I 418
programa certifique-se P III 636
programa da qualidade P I 419
programa da qualidade de servio P I 419
programa da qualidade do fornecedor P I 420
programa da qualidade seis sigma P I 420
programa da qualidade total (PQT) P I 421
programa de controle da qualidade (PCQ) P I 422
programa de marketing P I 422
programa de melhora da qualidade (PMQ) P III 636
projetar para a produtibilidade (DFM) P I 423
projetar para as operaes (DFO) P I 423
projeto de qualidade P I 423
projeto de servio P I 424
promessa de servio P I 424
proprietrio do processo P II 570
prossumidor P III 637
pudim instantneo P III 637
QFD real time P III 637




305


qualidade (Q) P I 425
qualidade assegurada (QA) P III 638
qualidade de produo P II 570
qualidade de projeto P I 425
qualidade de vida (QV) P III 638
qualidade de vida no trabalho (QVT) P III 639
qualidade do fornecedor P I 425
qualidade do servio P I 426
qualidade do servio bancrio P I 426
qualidade estratgica P I 427
qualidade institucional da organizao P I 427
qualidade na gesto bancria P I 427
qualidade naturalista P I 428
qualidade operacional P II 570
qualidade percebida P I 428
qualidade total (QT) P III 639
qualidade total em servios P III 640
qualimetria P II 571
quality function deployment (QFD) P III 640
quantidade de pedido econmico (EOQ) P II 571
quarteirizao P III 641
quatorze pontos de Deming P I 429
quatro categorias da qualidade de servios P II 572
quatro parmetros universais do desempenho do servio P II 572




306


rastreabilidade P II 572
reao em cadeia P I 429
rede de servios P III 641
rede de servios de ncleo central nico P III 642
reengenharia P III 642
regra FIFO P III 643
relacionamento baseado em confiana P III 643
remover as barreiras ao orgulho da execuo P I 430
representante de servios P I 430
requisitos da qualidade P I 430
respeito P III 644
retrabalho P II 573
retribuio indevida P I 431
reverter a pirmide P III 644
reviso do projeto P I 431
reviso do sistema da qualidade P III 644
rotina P II 573
sabedoria P III 645
saber profundo P I 431
satisfao do cliente P II 573
scorecard P III 645
segmentao de mercado P I 432
segmento-alvo de mercado P I 432
seis sigma P II 574




307


servio P I 433
servio ampliado P I 433
servio bancrio P I 433
servio de massa P I 434
servio essencial P I 434
servio financeiro P I 435
servio individual P I 435
servio interno P I 435
servio ncleo P I 436
servio perceptvel P I 436
servio profissional P I 437
servio revolucionrio P I 437
servio substituto P I 438
servio tecnolgico P I 438
servio total P I 439
servios P I 439
servios customizados P I 440
servios de comparao P I 440
servios de convenincia P I 440
servios especiais P I 441
servios facilitadores P I 441
servios humanos P I 442
servios industriais P I 442
servios personalizados P I 442




308


sete ferramentas bsicas da qualidade (7FBQ) P II 575
sete ferramentas estatsticas da qualidade total P II 575
sete ferramentas gerenciais da qualidade (7FGQ) P III 646
sete novas ferramentas (7NF) P III 647
setor bancrio P I 443
setor de servios P I 443
shake dow P III 647
sigma P II 576
simultaneidade P III 648
sndrome da pizzaria P III 648
sistema P I 443
sistema prova de falhas P II 576
sistema americano de produo P I 444
sistema da qualidade (SQ) P I 444
sistema de distribuio de servios P I 445
sistema de garantia da qualidade (SGQ) P I 445
sistema de informao da qualidade (SIQ) P I 446
sistema de informao de marketing (SIM) P I 446
sistema de marketing P I 447
sistema de medio P I 447
sistema de operaes P I 448
sistema de prestao de servios P I 448
sistema de prestao de servios opo fixa P I 449
sistema de produo em massa P I 449




309


sistema de produo interface/suporte P I 450
sistema de servios P I 450
sistema estvel P I 450
sistema flexvel P I 450
sistema Ringi P I 451
sistema self-service P I 451
sob controle estatstico P II 577
software P I 452
subotimizao P I 452
superar as expectativas do cliente P III 649
suporte P I 452
tarefa P II 577
taxa de resposta P II 577
tcnica de anlise da avaliao do programa (PERT) P II 578
tcnica estatstica P II 578
tcnicas de amostragem P II 579
tecnologia de informao P II 579
tecnologia de materiais P II 579
tecnologia de mtodos P II 580
tecnologia flexvel P II 580
tempestade de idias P I 453
tempestade de idias escritas P I 453
tempo de ao P II 581
tempo de acesso P II 581




310


tempo de ciclo do sistema P II 581
tempo de espera P II 582
tempo do servio P II 582
teoria das filas P II 582
terceirizao P III 649
terceiro sistema bancrio P I 454
time da qualidade P I 454
total quality control (TQC) P II 583
total quality management (TQM) P III 650
trabalho em equipe P III 650
transao de servio P II 584
treinamento P III 651
treinamento de reciclagem P III 651
treinamento em mltiplas funes P III 652
treinamento inicial P III 652
treinamento integrado P III 652
trilogia da qualidade P I 454
trilogia Juran P I 455
triplo papel (TRIPOL) P I 456
unidade de negcio P I 456
unidade de servio P II 584
usurio P I 456
utilidade P I 457
valor agregado P I 457




311


valor fornecido P I 458
valor percebido P I 458
vantagem competitiva P I 459
variabilidade P II 584
variabilidade do processo P II 585
variao aleatria P II 585
venda negativa P I 459
venda pessoal P I 459
venda positiva P I 460
verificao P II 585
viso estratgica de servios P I 460
voz do cliente P III 653
warusa-kagen P III 653
zero cliente perdido P III 654
zero defeito (ZD) P III 654
zona de atuao da agncia P I 461












312


IV.4. Repertrio das unidades de conhecimento especializado relacionadas ao
planejamento da gesto pela qualidade total em servios
14 princpios sm
Fras. 14 princpios de Deming
Nmero total de idias que consubstancia a essncia da filosofia de Deming e aplica-
se a qualquer tipo de organizao, tanto na indstria de manufaturados quanto na de
servios, com aceitao universal.
Os <14 princpios> constituem a base para a transformao da indstria norte-
americana e dos servios. A adoo destes <14 princpios>, acompanhada da ao
correspondente, um indicativo de que a administrao pretende manter a empresa
em atividade, e visa a proteger os investidores e os empregos. (DEMING, W. E.,
1990, p. 17)
Nota Iniciaram-se por dez princpios em 1930 e o autor continuou aperfeioando-os at
alcanar o nmero atual de quatorze.
Sin. filosofia Deming; nova filosofia; quatorze pontos de Deming
Cf. adotar a nova filosofia; aperfeioar o sistema; cessar a aprovao de oramento
com base no preo; criar constncia de propsito; eliminar a necessidade de
inspeo em massa; eliminar as barreiras entre os departamentos; eliminar
lemas, exortaes e metas; eliminar o medo; eliminar padres de trabalho;
engajar todos na realizao da transformao; instituir liderana; instituir
programa de educao e retreinamento; instituir treinamento; remover as
barreiras ao orgulho da execuo

adequao ao uso sf
Capacidade que um servio/produto tem de corresponder satisfatoriamente s
necessidades do cliente quando o mesmo lhe prestado/entregue.
Em um manual como este, todavia, mais conveniente dar palavra "qualidade" uma
definio simples. Na terceira edio, qualidade foi definida como <"adequao ao
uso">. Essa definio, na verdade, conseguiu uma ampla aceitao. Com base nesse
fato, a quarta edio adotar a mesma definio, embora reconhecendo que ela no
tem aceitao universal. (JURAN, J. M.; GRYNA, F. M., 1991, p. 21, (v. I).)
Nota Proposto inicialmente pelo Dr. Juran, um conceito simplificado da qualidade que




313


tem por base a existncia de caractersticas e desempenho de um material, item,
produto ou servio necessrios e suficientes para o fim a que se destina.
Cf. necessidade do cliente

adotar a nova filosofia v
Despertar para o desafio, evitando a ocorrncia de procedimentos j enraizados na
organizao e realizando o processo de acordo com os novos parmetros da qualidade.
<Adotar a nova filosofia> quer dizer, na verdade, para mim, uma transformao da
administrao. A administrao tem tido estruturas que tero que ser desmontadas.
H 20 anos que no servem. Nunca foram certas, mas num mercado em expanso,
no se podia perder. As fraquezas apareceram quando surgiu a concorrncia.
(WALTON, M., 1989, p. 63.)
Nota Constitui o segundo dos 14 princpios.
Cf. 14 princpios

agncia sf
Forma institucionalizada da distribuio dos produtos e dos servios bancrios,
constituindo uma descentralizao geogrfica da matriz.
No Brasil, as <agncias> dos grandes bancos comerciais vendem praticamente os
mesmos tipos de produtos e asseguram, em geral, os mesmos tipos de servios
fundamentais, embora, s vezes, com rtulos diferentes. A especializao, em termos
de mercado, quase uma exceo, como, por exemplo, o posto de servio mantido
pelo Banespa na Cidade Universitria (USP). (TOLEDO, G. L., 1978, p. 211.)
Cf. servio bancrio

agncia de corporate sf
Unidade de servio de uma organizao bancria especializada na intermediao de
prestao de servios a pessoas jurdicas.
A empresa pretende, ainda em 1998, instalar e certificar SGQ em <agncias de
corporate> (destinadas ao atendimento de pessoas jurdicas que negociam volumes
mais expressivos em modalidades operacionais mais sofisticadas) e agncia private
(especializada no atendimento aos clientes pessoas fsicas que exigem, pelo volume e




314


natureza de suas necessidades operacionais, atendimento diferenciado). (ALMEIDA,
R. C. de, 1998, p. 73.)
Nota destinada ao atendimento de pessoas jurdicas que negociam volumes mais
expressivos em modalidades operacionais mais sofisticadas.
Cf. prestao de servios; unidade de servio

agncia private sf
Unidade de servio de uma organizao bancria especializada na intermediao de
prestao de servios a pessoas fsicas.
A empresa pretende, ainda em 1998, instalar e certificar SGQ em agncias de
corporate (destinadas ao atendimento de pessoas jurdicas que negociam volumes
mais expressivos em modalidades operacionais mais sofisticadas) e <agncia
private> (especializada no atendimento aos clientes pessoas fsicas que exigem, pelo
volume e natureza de suas necessidades operacionais, atendimento diferenciado).
(ALMEIDA, R. C. de, 1998, p. 73.)
Nota destinada ao atendimento de pessoas fsicas que exigem, pelo volume e natureza de
suas necessidades operacionais, atendimento diferenciado.
Cf. prestao de servios; unidade de servio

alavancagem sf
Fras. alavancagem de valor/custo; alavancagem do lucro
Aumento do valor do servio prestado por meio da qualidade concomitantemente com
a reduo dos custos.
Em muitas empresas de servios, grande nfase dada obteno de maiores lucros
atravs do aumento da produtividade e da eficincia. As empresas de servios
revolucionrios buscam a <alavancagem> do lucro, principalmente, aumentando o
valor atravs da qualidade, ao mesmo tempo que reduz seus custos. (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 28.)
Nota um dos elementos integrativos da viso estratgica de servios e utilizada para
atingir alta qualidade a baixo custo.
Cf. elementos integrativos da viso estratgica de servios; viso estratgica de
servios




315


ambiente da organizao sm
Fras. ambiente interno da organizao; ambiente operacional da organizao
Conjunto de fatores que influencia os negcios de uma organizao e que esta no
possui condies para alter-lo.
Quer dizer que, se ns acreditarmos que no haver mudana no <ambiente da
organizao> e que a estratgia atual ir permanecer, podemos dizer que neste caso
o planejamento a longo prazo ser igual ao planejamento estratgico?
(FISCHMANN, A. A.; ALMEIDA, M. I. R. de, 1991, p. 20.)

ambiente de marketing sm
Conjunto de fatores que influencia o marketing de certo produto/servio de uma
organizao e que esta possui condies para alter-lo.
Adotando uma concepo analtica menos rigorosa, esse trabalho considera o
<ambiente de marketing> como o conjunto de foras e de entidades que envolvem e
exercem influncia sobre o marketing de certo produto, distinguindo apenas dois
nveis. O primeiro corresponde ao ambiente organizacional onde o servio se insere,
compreendendo a empresa, suas divises, departamentos e seus canais de
distribuio. O segundo nvel abrange o ambiente externo prximo empresa, ou
seja, o mercado, a concorrncia, a tecnologia e a legislao. (TOLEDO, G. L., 1978,
p. 100.)

antimarketing sm
Fras. atitude antimarketing
Conjunto de estudos e medidas por meio do qual o lanamento e a manuteno de um
servio/produto no mercado no pode converter-se em consumo e no garante o bom
xito comercial da iniciativa.
Enfim, a situao prevalecente, que o tempo se havia encarregado de cristalizar,
refletia o exemplo mais completo de <antimarketing>. A rigidez de atitudes, as praxes
sedimentadas e as diferenas de concepes filosficas dos negcios certamente no
deixaram margem a um ingresso solene do marketing nos bancos. De qualquer modo,
esse ingresso ocorreu mediante a nica alternativa vivel: o mercado dos clientes
particulares. (TOLEDO, G. L., 1978, p. 66.)




316


Associao Brasileira de Normas Tcnicas sf
Sigla ABNT
Organizao no-governamental responsvel pela auditoria e publicao/traduo de
normas tcnicas internacionais, com o objetivo de compatibilizar interesses entre
clientes e fornecedores e subsidiar contratos comerciais.
Para aqueles interessados em analisar a norma ISO 9004-2 com maior profundidade
recomendo adquirir um exemplar traduzido nos escritrios da <Associao Brasileira
de Normas Tcnicas (ABNT)>, que publicou a norma em 1993, equivalente de 1990,
comentada neste captulo. (LAS CASAS, A. L., 1999, p. 163.)
Nota Sociedade civil sem fins lucrativos, foi fundada em 28 de setembro de 1940, com o
objetivo de elaborar normas tcnicas para atividades de cunho cientfico, comercial e
industrial, e incentivar a padronizao de medidas no pas, sendo representante no
mesmo na International Organization for Standardization (ISO).
Cf. International Organization for Standardization (ISO)

auto-servio sm
Produto da atividade humana em uma organizao em que o cliente presta o servio a
si mesmo.
Segundo a dimenso do grau de participao do cliente, os servios podem ser vistos
como uma seqncia de transaes, as quais podem classificar-se em algum ponto
entre os extremos: servio total, em que todas as atividades so executadas pelo
servidor, seja em front office ou back room, e <auto-servio (self-service)>, em que
quase todas as atividades so executadas pelo cliente, cabendo ao servidor apenas a
preparao. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 43.)

banco virtual sm
Parte da economia cuja atividade consiste na guarda e emprstimo de dinheiro,
transaes com ttulos de crdito e venda de servios realizada eletronicamente.
A opo por <bancos virtuais> parece-nos irreversvel. O mundo j aceitou o <banco
virtual> como sendo o banco do futuro. Pesquisas realizadas nos EUA demonstraram
que as pessoas ficam felizes quando usam a tecnologia bancria, desde que possam




317


falar com um Ser humano quando quiserem. (REIS, L. F. S. D., 1998, p. 82.)
Nota Seu processo consiste em migrar as formas de atendimento ao cliente para canais
eletrnicos, como ATMs, terminais de informao, drive-thrus, telefones inteligentes,
smart-cards, home banking, entre outros.

bancos sm
Fras. bancos atacadistas; bancos varejistas
Parte da economia cuja atividade consiste na guarda e emprstimo de dinheiro,
transaes com ttulos de crdito e venda de servios.
Mesmo antes da implementao do Plano Real, analistas das mais diversificadas
correntes de pensamento tm procurado mostrar opinio pblica o grande mal que
se abateu sobre os <bancos> com o fim da inflao, ou com sua drstica reduo.
(ALMEIDA, R. C. de, 1998, p. 45.)
Sin. setor bancrio

brainstorming sm
Var. brain-storming; brainstorm
Fras. brainstorming de causa-e-efeito; brainstorming estruturado; brainstorming no-
estruturado; reunio de brainstorming; sesso de brainstorming
Tcnica oral utilizada na coleta de dados para a construo de diagramas e que auxilia
um grupo a criar idias no menor tempo possvel.
Durante o <brainstorming>, o importante a quantidade de idias. No se deve
criticar nenhuma idia, por mais absurda que ela possa parecer. Tambm no se deve
tentar defender nenhuma idia. (...) Cabe aqui observar que o <brainstorming>, s
vezes grafado tambm como <brain-storming> tende a ser mais rico e criativo quanto
mais heterognea for a equipe. Isto particularmente importante na construo do
D/Af., na qual se deve buscar a contribuio das diversas reas ou departamentos
envolvidos. // O <brainstorm> e outras tcnicas so freqentemente usadas na
construo de um diagrama. (MOURA, E. C., 1994, p. 13 e 27. //
SCHERKENBACH, W. W., 1990, p. 107.)
Nota Emprstimo do ingls cuja traduo tempestade de idias, mas a melhor seria livre
debate. H dois tipos: o estruturado, no qual so feitas rodadas em que cada




318


participante expe suas idias seqencialmente, e o no-estruturado, no qual as idias
so oferecidas livremente. Nos EUA, h ainda a utilizao de creative thinking para
designar o mesmo conceito.
Desenvolveu-se a partir de 1930 e baseia-se em dois princpios (estruturado e no-
estruturado) e trs fases distintas (gerao, classificao e avaliao).
Sin. tempestade de idias

brainwriting sm
Tcnica escrita utilizada na coleta de dados para a construo de diagramas e que
auxilia um grupo a criar idias no menor tempo possvel.
Listar os diversos itens a serem priorizados (por exemplo, um <brainwriting> seguido
de anlise e discusso). Se alguns itens ou opes forem parecidos ou equivalentes,
eles devem ser agrupados. Os itens devem estar visveis a todos da equipe. Cada item
deve receber uma letra do alfabeto. (MOURA, E. C., 1994, p. 114.)
Nota Emprstimo do ingls cuja traduo mais comum tempestade de idias escrita, mas a
melhor seria livre debate escrito.
Sua origem creditada ao Instituto Battelle de Frankfurt, na Alemanha.
Sin. tempestade de idias escritas

brief do servio sm
Var. brief; briefing
Fras. brief de projeto; service brief
Documento que define as necessidades dos clientes e relaciona as capacidades da
organizao de servios como um conjunto de requisitos que formam a base do design
de um servio.
Este <brief> um resumo que resulta de uma pesquisa de mercado, anlise e
determinao das obrigaes dos fornecedores. Estes elementos so inludos e
salientados, pois h uma recomendao para que as atividades de marketing sejam
programadas e estudadas para que tenham bons resultados. Enfatiza a importncia
da pesquisa e a determinao dos nveis de satisfao e exigncia dos clientes. (...) A
clusula 6.2.6. trata da reviso do design do servio. Neste sentido menciona que a
cada fase de concluso de um servio um documento formal de reviso deve ser




319


comparado com o <brief do servio>. // Providncia muito interessante vinha sendo
adotada na empresa: a de iniciar todos os eventos administrativos (principalmente as
reunies de departamento e de agncias) com um <briefing> sobre qualidade. (LAS
CASAS, A. L., 1999, p. 158 e 161. // ALMEIDA, R. C. de, 1998, p. 65.)
Nota Emprstimo do ingls cuja traduo resumo do servio, mas sua utilizao no
original, apesar de estar lexicalizado o derivado briefing que, no mbito jornalstico,
indica as instrues prvias para a realizao de uma cobertura.
Cf. design do servio; necessidade do cliente; organizao de servios

cadeia cliente-fornecedor sf
Var. cadeia fornecedor-cliente
Interligao de processos iniciada a partir do cliente externo ou interno em que este o
fornecedor e o seguinte o cliente.
Na relao da <cadeia cliente-fornecedor>, encontra-se o duplo aspecto que j
enfatizamos na definio da qualidade: o bom produto e o produto bom, o bom
servio e o servio bom, a eficcia e a eficincia. // Manter os elos da corrente
devidamente interligados e com a mesma fora (resistncia) na <cadeia fornecedor-
cliente>, condio fundamental para a obteno de servios com qualidade.
(TEBOUL, J., 1991, p. 116. // REIS, L. F. S. D., 1998, p. 24.)
Cf. cliente; fornecedor

cadeia de clientes sf
Interligao de processos resultante da disposio dos recursos de acordo com a
seqncia em que fluem os produtos/servios.
O lado bom da natureza humana inclui sentimentos de prazer em servir bem e de
realizao ao participar de um programa de aprimoramento. Tais sentimentos so
incentivados pela organizao que montou a <cadeia de clientes>, e passam por sua
vez a apoi-la. (SCHONBERGER, R. J., 1992, p. 34.)
Nota Ela preconiza uma parceria de longo prazo, alcanando a fonte de demanda e receita
com dinamismo.






320


cadeia de valor sf
Interligao de processos onde a ordem dos itens vai da personalizao de servios em
torno de produtos ou servios pardronizados nos elos de marketing e distribuio,
progride para tcnicas mais penetrantes e bsicas que exigem mudanas mais drsticas
at aperfeioamento em toda a organizao, incluindo desenvolvimento e produo.
Nenhum desses mtodos so mutuamente exclusivos e, na prtica, normalmente se
soprepem; muitas companhias utilizam uma combinao de vrios deles e,
ocasionalmente, de todos. Juntos, eles proporcionam caminhos alternativos que uma
empresa imersa na Produo em Massa pode ser para a Customizao Macia em
cada elo-chave da sua <cadeia de valor>, conforme mostrado na Figura 8.1. (PINE
II, B. J., 1994, p. 184.)
Cf. marketing; servios personalizados

campo de servios sm
Parte da economia responsvel pela execuo de tarefas que objetivam atender a
terceiros dentro ou fora da organizao.
Esse dilema agravado quando se considera o <campo de servios> em um contexto
mais amplo, de forma a abranger aqueles prestados por organizaes sem finalidade
lucrativa, as quais podem recorrer aos mesmos princpios e estratgias j bem
desenvolvidos para o marketing de bens tangveis. (TOLEDO, G. L., 1978, p. 22.)
Sin. setor de servios

canal de distribuio sm
Conjunto de organizaes envolvidas na movimentao de um produto/servio, do
produtor/prestador para o comprador.
O objetivo das decises que implicam escolha dos <canais de distribuio> o
mesmo, quer se trate de comercializao de produtos ou de servios: escolher canais
que iro maximizar a posio de lucro da empresa a longo prazo atravs de um
servio superior oferecido a um custo mnimo. Entretanto, quando as decises de
escolha de canal dizem respeito ao setor de servios, alguns aspectos particulares
devem ser levantados, de forma a adaptar a ele o conceito de <canal de distribuio>
desenvolvido para os produtos. (TOLEDO, G. L., 1978, p. 45.)




321


Nota um dos principais instrumentos de marketing que est sob o controle da organizao
e que pode afetar a implantao e a aceitao do servio pelo mercado. Pode ser
direto, no caso de o fabricante vender diretamente ao consumidor, ou pode conter um
ou mais intermedirios institucionais.
Cf. instrumentos de marketing; marketing

canal de distribuio de servios sm
Caminho pelo qual os servios seguem desde o produtor ou fornecedor at o
consumidor, por meio de um complexo de organizaes que existe para distribu-lo,
incluindo agentes e intermedirios.
J mencionamos anteriormente as vantagens na utilizao de <canais de distribuio
de servios>. O efeito maior a especializao. Conforme Kotler, medida que os
intermedirios se especializam e conseguem economias, devido a suas escalas de
operaes e conhecimentos, o produtor poder ganhar pela transferncia de algumas
das funes de canal para eles. (LAS CASAS, A. L., 2000, p. 99.)
Nota Apesar de comum a venda direta na distribuio de servios, vrios canais so
possveis, como fornecedor para consumidor ou usurio industrial e fornecedor para
representante ou para clientes ou usurio industrial.
Cf. fornecedor

caracterstica intangvel dos servios sf
Conjunto de propriedades de uma prestao de servio que no visualizado nos
momentos da verdade, mas que existe concomitantemente caracterstica tangvel
com o intuito de atender certas necessidades do cliente.
A ausncia de escolhas razoavelmente especficas, agravada pela <caracterstica
intangvel dos servios>, faz com que muitos consumidores fiquem indecisos quando
pretendem definir as caractersticas e atributos mais adequados do servio.
(TOLEDO, G. L., 1978, p. 21.)
Cf. atender s necessidades do cliente; caracterstica tangvel dos servios; momentos
da verdade






322


caracterstica tangvel dos servios sf
Conjunto de propriedades de uma prestao de servio que visualizado nos
momentos da verdade e que existe concomitantemente caracterstica intangvel com
o intuito de atender certas necessidades do cliente.
A caracterstica intangvel dos servios constitui a diferena mais marcante entre
esses e os produtos. A <caracterstica tangvel dos servios> no apresentada sob
aspectos que apelem para os sentidos, o que faz gerar problemas de promoo
diferentes daqueles encontrados no campo dos produtos fsicos. (TOLEDO, G. L.,
1978, p. 27.)
Cf. atender s necessidades do cliente; caracterstica intangvel dos servios;
momentos da verdade

caractersticas da qualidade sf
Fras. caractersticas da qualidade do processo
Conjunto de propriedades que pode ser avaliado em funo do grau de satisfao dos
clientes ou dos requisitos determinados.
As causas de problemas da qualidade so todas por falta de algo. So de seis origens
ou fontes e j foram citadas anteriormente. Com base nesses seis conjuntos, as
<caractersticas da qualidade> so exigir na organizao, comprovadamente, apoio
da alta administrao, liderana, organizao, recursos, tempo e treinamento. A falta
de qualquer um desses gera riscos para a sobrevivncia da empresa. (CERQUEIRA
NETO, E. P. de, 1993, p. 71.)
Sin. requisitos da qualidade
Cf. satisfao do cliente

caractersticas do marketing de servios sf
Conjunto de propriedades de um servio que visa a atender certas necessidades
mercadolgicas da organizao.
Os dois grficos apresentados procuram mostrar a necessidade de tratamento
diferenciado para os diferentes nveis de servios. Esta sem dvida uma importante
considerao, pois orienta quais ferramentas mercadolgicas devero ser mais
usadas. No entanto, convm observar que, independentemente do posicionamento na




323


escala de servio comercializado, todos devem receber um tratamento mercadolgico
que considere as principais <caractersticas do marketing de servios>. (LAS
CASAS, A. L., 1999, p. 24.)
Nota Subdividem-se em heterogeneidade, inseparabilidade, intangibilidade e
simultaneidade.
Cf. heterogeneidade; inseparabilidade; intangibilidade; simultaneidade

caractersticas do servio sf
Fras. caracterstica da qualidade do servio
Conjunto de propriedades de um servio que visa a atender certas necessidades do
cliente.
Como <caracterstica do servio>, a previsibilidade tem dois aspectos; Um deles a
consistncia, a uniformidade dos procedimentos de servios sucessivos. (...) A outra
caracterstica a persistncia - a freqncia da demanda de um servio.
(ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 325.)
Nota Subdividem-se em pontualidade, integridade, previsibilidade e satisfao do cliente,
coincidentes com as quatro categorias da qualidade de servios, onde se enquadram os
padres de servios.
Cf. padro de servio; quatro categorias da qualidade de servios

caracterizao de processo sf
Estudo realizado com o intuito de conseguir uma total compreenso de todas as
variveis de sada ou de resposta e seu relacionamento de causa e efeito com todas as
variveis independentes ou de entrada em um processo.
A <caracterizao de processo> um estudo feito para conseguir uma total
compreenso de todas as variveis de sada ou de resposta e seu relacionamento de
causa e efeito com todas as variveis independentes ou de entrada em um processo. O
objetivo final do estudo o de otimizar as variveis de sada atravs da manipulao
das variveis de entrada em um nvel que garanta um desempenho Seis Sigma.
(PEREZ-WILSON, M., 1999, p. 249.)
Nota Seu objetivo final otimizar as variveis de sada por meio da manipulao das
variveis de entrada em um nvel que garanta um desempenho seis sigma.




324


Cf. seis sigma

CB-25 sm
Grupo de estudos da ABNT que organiza e gerencia banco de dados sobre
certificaes e promove a divulgao das Normas ISO 9000 no Brasil em relao
qualidade.
Naquele ano de 1990, juntamente com o PBQP, foi instalado o vigsimo quinto comit
da ABNT, o <CB-25>, "inicialmente suportado por 20 empresas, entre a quais podem
ser citadas Ericson, NEC, Siemens, Petrobrs, Eletrobrs, Atlas e Tenenge".
(ALMEIDA, R. C. de, 1998, p.33.)
Nota A sigla CB significa Comit Brasileiro e o nmero 25 refere-se seqncia em que ele
foi constitudo como grupo de estudos da ABNT, de um total de 36.
Est sediado na cidade do Rio de Janeiro.
Cf. Associao Brasileira de Normas Tcnicas (ABNT); ISO 9000

cessar a aprovao de oramentos com base no preo v
Buscar novas polticas de aquisio, pois o preo no tem sentido sem uma medida da
qualidade que est sendo adquirida.
Precisamos deixar bem claro que o preo dos servios no tem sentido sem uma
medida adequada da qualidade. Sem tal requisito de medidas rigorosas de qualidade,
cada negcio ser fechado com a proposta de mais baixo preo, e o resultado
inevitvel ser baixa qualidade e altos custos. Vemos isto acontecer em todas as
indstrias e no governo dos EUA, ou seja, necessrio <cessar a aprovao de
oramentos com base no preo> como resultado de regras que do o negcio para a
proposta de menor preo. (DEMING, W. E., 1990, p. 148.)
Nota Constitui o quarto dos 14 princpios.
Cf. 14 princpios

checklist sf
Var. check list
Documento que facilita a coleta de informaes e fornece dados que sero acumulados
para uma possvel anlise posterior.




325


Muitas medies esto sendo realizadas atualmente com a finalidade de produzir
peas dentro dos limites das especificaes. As <checklist> so uma ferramenta para
registro rpido e anlise posterior do processo. // Devem ser atualizados e validados
pelos operadores e seus chefes, que prepararo <"check lists"> de operao para a
formao, guias de operao para o controle de pontos sensveis que merecem
ateno particular. (SCHERKENBACH, W. W., 1990, p. 114. // TEBOUL, J., 1991,
p. 104.)
Nota Emprstimo do ingls cuja traduo lista de verificao.
A maior limitao de sua utilizao que, muitas vezes, o que no foi listado passa
desapercebido.
Sin. lista de conferncia; lista de controle; lista de verificao

ciclo da qualidade sm
Modelo conceitual de interao das atividades interdependentes que influenciam a
qualidade de um servio/produto/processo ao longo de seus vrios estgios, desde a
identificao das necessidades dos clientes at a avaliao da satisfao das mesmas.
O <ciclo da qualidade> iniciava e devia terminar na assistncia tcnica do ps-
venda. O enfoque de prevenir falhas substitui o enfoque de correo de falhas,
adotado pela inspeo e controle estatstico da qualidade. (CERQUEIRA NETO, E.
P., 1993, p. 24.)
Nota Considera a aplicao de maior cuidado e tempo no planejamento de cada ao e o
controle das fases seguintes da execuo.
Sin. espiral da qualidade

classificao dos servios sf
Determinao das categorias em que o produto da atividade humana, sem assumir a
forma de um bem material, dividido em seu conjunto.
Aqui vemos uma <classificao dos servios> incluindo a "fbrica de servios"
(caracterizada geralmente pelas unidades geradoras de eletricidade) em um extremo
e o "servio profissional" (lembrando os servios de consultoria legal, mdica e
gerencial) no outro extremo. A <classificao dos servios> inclui ainda servios de
massa como restaurantes de "fast-food" e servios tecnolgicos como servios de




326


informao via computador. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L.,
1994, p. 237.)
Nota Sua origem creditada a David Maister e Christopher Lovelock que, com base no grau
de personalizao e de contato com os clientes em relao ao gerenciamento dos
servios, propuseram a mesma em fbrica de servios, servio profissional, servio
tecnolgico e servio de massa.
Cf. fbrica de servios; servio de massa; servio profissional; servio tecnolgico

cliente sm
Fras. percepo do cliente
Indivduo ou organizao que adquire ou recebe os resultados de um processo e
beneficirio dos mesmos.
O Dr. Deming vm afirmando h dcadas que o <cliente> a parte mais importante
da linha de produo. // Existe uma tendncia cada vez maior de ampliar o
significado da palavra "<cliente>" para incluir pessoas e unidades organizacionais
internas que sofram o impacto do produto. // No devemos esquecer que o <cliente>
tambm pode dar sua opinio sobre a concepo do servio ou sobre a sua evoluo.
(SCHERKENBACH, W. W., 1990, p. 1. // JURAN, J. M.; GRYNA, F. M., 1991, p.
142, (v. I). // TEBOUL, J., 1991, p. 204.)
Nota A evoluo do conceito est cada vez mais acentuado, resultando at em obrigaes
legais, pois o que eram metas a se atingir nos Cdigos de Proteo ao Consumidor,
agora so obrigaes percebidas pelas organizaes de projeo como o mnimo
aceitvel.
Sin. consumidor; usurio
Cf. processo

cliente de servios sm
Fras. cliente de servios bancrios
Indivduo ou organizao que adquire ou recebe os resultados de um servio e
beneficirio do mesmo.
Referindo-se aos <clientes de servios>, Ferreira (1996:60) inicia artigo afirmando
que os <clientes de servios> devem ser atendidos em "... Suas necessidades e




327


expectativas buscando satisfazer seus desejos a um preo que ele esteja disposto a
pagar..." (ALMEIDA, R. C. de, 1998, p. 47.)
Cf. servios

cliente externo sm
Indivduo ou organizao que adquire um servio/produto para uso prprio e no
pertence organizao que o presta/produz.
Como conseqncia das deficincias do produto temos o cliente insatisfeito. Os
<clientes externos> expressam essa insatisfao na forma de reclamaes,
devolues e queixas. Se a resposta a essa insatisfao inadequada, ou se a
extenso da insatisfao muito grande, o <cliente externo> pode parar de comprar
o produto/servio. (JURAN, J. M.; GRYNA, F. M., 1991, p. 14. (v. I).)
Sin. cliente final

cliente final sm
Indivduo ou organizao que adquire um servio/produto para uso prprio e no
pertence organizao que o presta/produz.
Existe uma linha de produo. E haver um cliente. Chama-lo-ei de <cliente final>.
H que se prestar ateno no <cliente final>. preciso conduzi-lo. Vocs tm que lhe
dizer o que ele vai precisar daqui a trs ou cinco anos e apront-lo. (WALTON, M.,
1989, p. 31.)
Sin. cliente externo

cliente freqente sm
Indivduo ou organizao que, tendo recebido o servio, teve suas expectativas
atendidas, sentiu-se satisfeito e retorna para ser servido pelo mesmo fornecedor do
servio.
O <cliente freqente> tem, em geral, um grau maior de fidelidade ao prestador de
servio (dado que qualquer outro fornecedor desconhecido gera percepo de risco
maior na compra), aceitando ter seu comportamento modificado pelo prestador do
servio, de modo a adequar as caractersticas da demanda s caractersticas do
sistema de operaes de servio. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 76.)




328


Nota Ele geralmente tem percepo de risco menor que o cliente novo, conhece mais seu
papel no processo de prestao de servio, o que requer menos treinamento, e sabe o
que esperar do servio, em termos de seu processo e resultado.
Cf. cliente novo; fornecedor de servio

cliente institucional sm
Organizao que adquire os resultados de um processo dos bancos e beneficirio dos
mesmos.
Sob o ngulo da demanda, os bancos, especificamente os comerciais,
tradicionalmente dividem seu mercado em dois amplos segmentos: o dos cliente finais
e o dos <clientes institucionais> (industriais). Estabelecendo uma analogia com a
linguagem industrial, poder-se-ia dizer que os bancos trabalham com dois enfoques:
no varejo e no atacado. (TOLEDO, G. L., 1978, p. 53.)
Nota Ele apresenta-se em forma de uma demanda derivada, inelstica, altamente flutuante,
mas possui mais informaes sobre suas transaes com os bancos do que o cliente
particular.
Cf. cliente particular

cliente intermedirio sm
Indivduo ou organizao que torna o servio/produto disponvel ao cliente final ou
externo.
No ambiente fsico, respondeu o consultor, teramos a ecologia local, reunindo
plantas e animais que habitam o mesmo lugar. J no ambiente empresarial, temos as
organizaes e pessoas que se relacionam com a empresa, como: concorrentes,
fornecedores, prestadores de servios e <clientes intermedirios>. (FISCHMANN,
A. A.; ALMEIDA, M. I. R. de, 1991, p. 72.)
Cf. cliente final

cliente interno sm
Fras. cliente-fornecedor interno
Colaborador de uma organizao a quem repassado o trabalho concludo para que
ele possa realizar outra tarefa tendo em vista servir a outros clientes at chegar ao




329


cliente final.
Dentro de uma empresa existem vrias situaes nas quais os departamentos ou as
pessoas fornecem produtos ou servios uns aos outros. Os receptores so
denominados <clientes internos>. (JURAN, J. M.; GRYMA, F. M.,1991, p.13, (v.1).)
Cf. cliente final

cliente misterioso sm
Fras. metodologia mistery shopping
Indivduo que realiza uma investigao informal para levantamento de informaes
sobre a concorrncia a fim de avaliar as vrias etapas do atendimento.
Para avaliar os nveis de satisfao dos clientes, por exemplo, o banco vem utilizando
o mtodo de pesquisa denominado mistery shopping (tambm chamado de <cliente
misterioso>), observao que se repetiu vrias vezes ao longo da pesquisa.
(ALMEIDA, R. C. de, 1998, p. 69.)
Nota uma traduo do emprstimo em ingls mistery shopping.
Prtica de carter informal onde informaes so levantadas junto a outras empresas
por um representante no identificado, muito comum no setor varejista. Est sendo to
amplamente aceita que comeam a surgir empresas especializadas em envi-lo para
elaborao de relatrios sobre os resultados.
Sin. cliente-fantasma; comprador fantasma

cliente novo sm
Indivduo ou organizao que ainda no adquiriu ou recebeu os resultados de um
processo de determinado fornecedor e, por conseqncia, no conhece o servio nem o
processo.
O <cliente novo> geralmente traz certa ansiedade em buscar a cada momento,
durante o processo de prestao do servios, pistas para avaliar sua qualidade e,
portanto, estar mais atento a cada evento deste processo, comparando sua
percepo do que recebeu com suas expectativas prvias. (GIANESI, I. G. N.;
CORRA, H. L., 1996, p. 75.)
Nota Ele geralmente tem percepo alta de risco pois no consegue avaliar o servio antes
da compra e tem de se basear em informaes da prpria organizao ou de terceiros.




330


Cf. processo

cliente particular sm
Indivduo que adquire os resultados de um processo dos bancos e beneficirio dos
mesmos.
Com as mudanas internas e externas organizao, e tendo de enfrentar o problema
de atrair e doutrinar o mercado "novo" de <clientes particulares>, os bancos vero
seus produtos tornarem-se cada vez mais complexos, e os contatos com esse mercado
devero revestir-se de uma honestidade e de um rigor extremos por parte do
vendedor. (TOLEDO, G. L., 1978, p. 67.)
Nota Apresenta-se como um maior contingente de consumidores, menor poder de compra e
maior disperso geogrfica.

cliente perdido sm
Indivduo ou organizao que, tendo recebido o servio, no teve suas expectativas
atendidas e, por isso mesmo, atra-lo torna-se uma tarefa mais difcil e mais custosa do
que atrair um cliente novo.
Um <cliente perdido> uma fonte de referncias negativas sobre o servio para
clientes potenciais, como foi visto anteriormente. Como uma das principais fontes de
informao para clientes novos so as recomendaes de clientes antigos, clientes
insatisfeitos afetam fortemente a competitividade do fornecedor do servio. O esforo
de algumas empresas em supercompensar clientes insatisfeitos, visando recuper-los,
evidencia este fato. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 76.)
Nota Ele geralmente tem aumentada sua percepo de risco, tornando-se ainda maior do que
aquela referente a um fornecedor desconhecido, ou seja, o cliente novo para a
concorrncia com uma percepo e senso crtico mais acentuado que o cliente novo
normal.
Cf. cliente novo

cliente potencial sm
Indivduo ou organizao que possui condio para adquirir ou receber os resultados
de um processo e ser beneficirio dos mesmos.




331


Curiosamente, muito pouca informao fornecida a <clientes potenciais> pela
maioria dos gerentes de servios sobre as melhores ocasies e lugares para comprar
e usar os servios. Esta informao de benefcio mtuo, porque no somente
distribui a demanda, como tambm possibilita ao prestador de servios oferecer um
servio de melhor qualidade. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W.
L., 1994, p. 160.)
Nota Os meios atuais de comunicao criaram uma espcie de peneira atingindo um grande
pblico na oferta de servios, mas somente investindo nestes clientes que do retorno
a esta primeira chamada.
Cf. processo

cliente recuperado sm
Indivduo ou organizao que, tendo recebido o servio, no teve suas expectativas
atendidas mas, por um esforo da organizao de servios, foi possvel transform-lo
de um cliente insatisfeito e furioso em um cliente satisfeito e fiel.
De fato, um cliente que somente tenha tido boas experincias com um fornecedor de
servio ainda percebe certo risco em relao eventualidade de uma falha. Se o
processo de recuperao da falha for realmente eficaz, o <cliente recuperado> pode
tornar-se, portanto, mais fiel do que um cliente freqente, tendo um impacto positivo
no poder de competitividade do fornecedor. (GIANESI, I. G. N.; CORRA, H. L.,
1996, p. 76.)
Nota Ele geralmente tem diminuda sua percepo de risco quando percebe que a
organizao de servios procura demonstrar seu potencial de prestao de servio, seu
processo e seu procedimento em caso de falhas.
Cf. organizao de servios

cliente-fantasma sm
Indivduo que realiza uma investigao informal para levantamento de informaes
sobre a concorrncia a fim de avaliar as vrias etapas do atendimento.
Com o resultado das pesquisas, das reunies de especialistas, mais a avaliao dos
consumidores complementada com as visitas dos <clientes-fantasmas>, o empresrio
tem clara viso do ponto de partida para corrigir os problemas de qualidade. (LAS




332


CASAS, A. L., 1999, p. 83.)
Nota Prtica de carter informal onde informaes so levantadas junto a outras empresas
por um representante no identificado, muito comum no setor varejista. Est sendo to
amplamente aceita que comeam a surgir empresas especializadas em envi-lo para
elaborao de relatrios sobre os resultados.
Sin. cliente misterioso; comprador fantasma

clientelizao sf
Atendimento personalizado e diverso, oferecido aos clientes pelas organizaes
bancrias, com valor agregado para suprir suas necessidades.
Segundo Alvin Toffler, o mundo caminha para a <clientelizao> e a diversidade no
custa mais caro do que a uniformidade. O que se torna necessrio agregar valor aos
produtos e servios, do ponto de vista do cliente. Vejamos alguns exemplos de
"<clientelizao>" que organizaes do ramo de prestao de servios esto
oferecendo, o que, por outras palavras, pode significar atender o cliente sob medida.
(REIS, L. F. S. D., 1998, p. 77.)
Cf. valor agregado

colaborador sm
Indivduo que executa funes dentro de uma organizao.
As excees que so levadas ao conhecimento da alta gerncia so, comumente, casos
especiais que poderiam ser tratados pelos gerentes da rea. Sua tarefa como
administrador deveria ser trabalhar sobre um sistema de situaes normais. Myron
Tribus, diretor do Center for Advanced Engineering Studies do MIT (Massachusetts
Institute of Technology), inteligentemente, afirmou que o administrador trabalha
sobre o sistema e seus <colaboradores> trabalham no sistema. (SCHERKENBACH,
W. W., 1990, p. 52.)
Nota uma traduo do que os americanos denominam por stakeholders.
Vrios estudiosos da QT, assim como de RH, j estendem o conceito para
fornecedores e clientes intermedirios.
Sin. empregado; funcionrio
Cf. cliente intermedirio; fornecedor; organizao




333


comit da qualidade sm
Equipe de altos executivos, composta por representantes da alta administrao,
encarregada de planejar, organizar, dirigir e controlar a gesto pela qualidade total na
organizao.
O Banco pode decidir por estabelecer subcomits com direito a ter um representante
no <Comit da Qualidade> que ter por misso elaborar o planejamento estratgico
para a implantao e operacionalizao do processo de Mudana/Qualidade e
realizar o acompanhamento do sistema. (REIS, L. F. S. D., 1998, p. 152.)
Nota Suas principais responsabilidades incluem identificar as prioridades da organizao,
definir a poltica da qualidade, definir a viso e os valores, motivar e reconhecer os
trabalhos dos times da qualidade, analisar e autorizar recursos para implementar aes
corretivas.
Sin. conselho da qualidade
Cf. alta administrao; poltica da qualidade; time da qualidade

companhia sf
Fras. companhia de servios; companhia prestadora de servios
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir de insumos recebidos de fornecedores e
beneficiados/manufaturados com recursos humanos e tecnolgicos.
vantajoso que o departamento de qualidade seja independente e tenha garantias
que possibilitem liberdade para percorrer os caminhos organizacionais dentro da
<companhia> sem que haja medo de retaliao por parte dos departamentos de
Operao. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 342.)
Sin. empresa; organizao
Cf. atender s necessidade do cliente; fornecedor

complexidade sf
Nmero de etapas projetadas na produo e fornecimento do servio.
importante assegurar que os procedimentos adotados em cada etapa so
internamente consistentes e transmitem uma "mensagem" clara aos potenciais
clientes, sobre o quanto de <complexidade> e divergncia eles podem esperar do




334


servio e a maneira como ele ser oferecido, bem como sobre as diferenas para as
empresas concorrentes. Para a maioria dos servios, a mesma abordagem seria
necessria para o processo das etapas de retaguarda (back room). (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 80.)
Nota Sua origem creditada a Lynn Shostack, consultora e ex-executiva de servios, que
props que a atividade de posicionamento deva ser levada a cada passo do processo de
fornecimento do servio, centralizando o esforo de deciso de modo a selecionar uma
direo estratgica de cada vez.
Cf. posicionamento

comprador de servios sm
Indivduo ou organizao que decide pela compra do servio depois que o iniciador e
o influenciador alocaram suas consideraes e disponibilizaram o mesmo ao usuro.
O <comprador de servios> seleciona os fornecedores valendo-se de certos critrios
que julga imprescindveis para os objetivos da empresa. Igualmente, esses so alguns
dos itens que podem ser do conhecimento dos mercadlogos da rea de servios.
(LAS CASAS, A. L., 2000, p. 35.)
Nota Entre suas caractersticas, est a prpria incerteza do consumidor diante do servios
que est prestes a consumir, o tipo de servio e quem est qualificado a prest-lo.
Cf. usurio

comprador fantasma sm
Indivduo que realiza uma investigao informal para levantamento de informaes
sobre a concorrncia a fim de avaliar as vrias etapas do atendimento.
A auditoria do sistema imprescindvel aos gerentes de empresas de servio, como
forma de deteco e preveno de erros em potencial. Os pilotos executam uma
verificao de sistemas de seus avies antes de cada vo. Os <compradores
fantasmas> esto acostumados a verificar a capacitao do sistema de uma loja de
varejo. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 88.)
Nota Prtica de carter informal onde informaes so levantadas junto a outras empresas
por um representante no identificado, muito comum no setor varejista. Est sendo to
amplamente aceita que comeam a surgir empresas especializadas em envi-lo para




335


elaborao de relatrios sobre os resultados.
Sin. cliente-fantasma; cliente misterioso

comunicao com o pblico sf
Transmisso de mensagens entre uma fonte e um destinatrio por meio da propaganda
que procura representar as qualidades mais importantes que a organizao deseja
transmitir e que espera serem reconhecidas.
O vnculo produtor-consumidor, caracterstico dos servios, sugere que se dedique
ateno especial ao problema da <comunicao com o pblico>, visando transmitir-
lhe uma imagem favorvel do servio e da organizao. (TOLEDO, G. L., 1978, p.
48.)
Nota um dos principais instrumentos de marketing que est sob o controle da organizao
e que pode afetar a implantao e a aceitao do servio pelo mercado.
Cf. instrumentos de marketing; marketing

conceito de marketing sm
Hierarquia de eventos que se inicia com os consumidores atuais e potenciais da
organizao e procura atingir os objetivos dessa por meio da criao da satisfao dos
mesmos e adoo de um programa de marketing integrado.
Levitt aponta a atuao das empresas cinematogrficas de Hollywood no passado
como um exemplo do que no adotar o <conceito de marketing>, atitude que
restringiu-lhe a viso a respeito da prpria atividade e dos negcios em que estavam
envolvidas, pois seus executivos julgavam-se militantes da indstria cinematogrfica,
quando, na realidade, deveriam identificar-se como membros da indstria de
diverso. (TOLEDO, G. L., 1978, p. 20.)
Cf. programa de marketing

conceito de servio sm
Hierarquia de eventos utilizada na criao de um novo modelo de prestao de servio
e sua colocao no mercado, constituindo a definio daquilo que o sistema de
operaes tem que realizar para atingir a excelncia.
O ponto de partida de franqueadores bem sucedidos uma avaliao do valor do




336


<conceito de servio>, estratgia operacional, nome e pacote de apoio a um
franqueado potencial. Isto pode ser traduzido em um fluxo de receitas com um valor
presente calculado. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p.
226.)
Nota um dos elementos bsicos da viso estratgica de servios e definido em termos
dos resultados alcanados pelos consumidores.
Sin. misso do servio
Cf. elementos bsicos da viso estratgica de servios; sistema de operaes

conceito de servio self-service sm
Hierarquia de eventos utilizada no emprego de clientes como parte do sistema de
prestao de servios.
<Conceito de servio self-service> emprega clientes como parte do sistema de
prestao de servios. (...) notvel a gama de atividades nas quais os clientes esto
dispostos a se engajarem. Bombeando sua prpria gasolina, como faz a maioria dos
consumidores dos Estados Unidos, limpando seus prprios pratos ou carregando suas
prprias compras de mveis, os clientes permitem que os prestadores de servios
reduzam a demanda ao sistema de prestao de servios durantes os perodos de pico,
oferecendo, desse modo, incentivos na forma de preos menores para encorajar os
clientes a aumentar mais sua participao. (HESKETT, J. L.; SASSER JR., W. E.;
HART, C. W. L., 1994, p. 166.)
Nota Os mais eficazes asseguram que os clientes so treinados, por meio de instrues
claras, em como podem ser bons colaboradores.
Cf. sistema de prestao de servios

conferncia de desenvolvimento sf
Exame sistemtico, formal, abrangente e documentado de um projeto para avaliar os
requisitos da qualidade e as condies de atend-los, alm de identificar problemas e
propor medidas corretivas.
As revises do projeto, tambm chamadas grupos de sntese ou <conferncias de
desenvolvimento>, tm como objetivo submeter o projeto chegado a um certo estgio
de elaborao a uma anlise crtica de todas as suas funes para simplific-lo ou




337


destacar o mais cedo possvel os problemas em potencial, antes que os planos e
especificaes no se tornem definitivos. (TEBOUL, J., 1991, p. 127.)
Nota A auto-reviso do projeto no suficiente para garantir projeto apropriado, por isso a
reviso dever ser feita por profissionais de reas distintas.
Sin. grupo de sntese; reviso do projeto
Cf. requisitos da qualidade

confiana do cliente sf
Sentimento que a organizao de servios deve despertar no cliente at transformar-se
no ativo mais precioso para a mesma, e cuja execuo dia aps dia um elemento
fundamental.
Reforar a <confiana dos clientes> no se trata de fazer promessas e sim de mant-
las. Quando uma empresa de servios perde a <confiana do cliente>, ela perde tudo.
Isso foi o que aconteceu com a Valujet. (BERRY, L. L., 2001, p. 13.)
Cf. organizao de servios

conselho da qualidade sm
Equipe de altos executivos, composta por representantes da alta administrao,
encarregada de planejar, organizar, dirigir e controlar a gesto pela qualidade total na
organizao.
Assim, formamos <conselhos da qualidade> em cada rea. Tanto nos Estados Unidos
como na Europa, os profissionais da qualidade reuniram-se para se ajudarem
mutuamente e determinarem os tipos de programas requeridos pelo staff da empresa.
(CROSBY, P. B., 1999, p. 23.)
Nota Suas principais responsabilidades incluem identificar as prioridades da organizao,
definir a poltica da qualidade, definir a viso e os valores, motivar e reconhecer os
trabalhos dos times da qualidade, analisar e autorizar recursos para implementar aes
corretivas.
Sin. comit da qualidade
Cf. alta administrao; poltica da qualidade; time da qualidade






338


constncia de propsito sf
Fras. constncia de propsito pela qualidade
Manuteno, pela alta administrao, dos valores e princpios adotados, tambm em
relao aos clientes e fornecedores, mesmo diante de situaes adversas.
Por exemplo, ser que a administrao de uma empresa pode adotar a <constncia
de propsito> de ter, no futuro, produtos e servios vendveis como a razo principal
da existncia da companhia? Ser que pode permanecer nos seus cargos por tempo
suficiente para comear a trilhar essa estrada? (DEMING, W. E., 1990, p. 112.)
Cf. alta administrao; cliente; fornecedor

consultor sm
Profissional capacitado, com bagagem terica e prtica, que se utiliza de conceitos e
ferramentas de psicologia e da qualidade, com vistas a fazer com que aqueles
diretamente envolvidos na consultoria obtenham as melhores solues em seus
processos.
Nas atividades administrativas e operacionais, respondeu o <consultor>, possvel
contratar um tcnico, e este poder resolver o seu problema. Mas, na determinao
da estratgia, ele s conseguir faz-lo se tiver toda a autoridade para dirigir a
empresa, pois o presidente de uma empresa o responsvel pelos seus aspectos
estratgicos. (FISCHMANN, A. A.; ALMEIDA, M. I. R. de, 1991, p. 142.)
Cf. processo

consumerismo sm
Fras. consumerismo bancrio
Movimento desencadeado pelos consumidores que exigem produtos/servios com
qualidade superior em razo de suas complexidades e alto grau de conhecimento.
Da mesma forma como aconteceu s grandes empresas industriais nos pases mais
adiantados, os bancos bem cedo tero de enfrentar a presena dos fenmenos de
proteo ao consumidor, a qual traz uma srie de implicaes, englobadas sob a
denominao de <"consumerismo">. (TOLEDO, G. L., 1978, p. 70.)
Nota Sua origem creditada aos Estados Unidos da Amrica na dcada de 70 do sculo
XX, como reao dos consumidores em relao ao descontentamento diante dos




339


produtos/servios comprados e das organizaes por eles responsveis.
Cf. consumidor

consumidor sm
Fras. consumidor de servios; consumidor fantasma; consumidor final; consumidor
individual; consumidor interno
Indivduo ou organizao que adquire ou recebe os resultados de um processo e
beneficirio dos mesmos.
O contato pessoal extensivo tambm estabelece algumas relaes que so
inerentemente desconfortveis para o <consumidor>. Para garantir alguns servios,
o cliente renuncia propriedade, submetendo-a custdia da empresa prestadora de
servio, por exemplo, a bagagem que deve ser transportada ou um automvel que
necessita de reparo. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 309.)
Nota A evoluo do conceito est cada vez mais acentuado, resultando at em obrigaes
legais, pois o que eram metas a se atingir nos Cdigos de Proteo ao Consumidor,
agora so obrigaes percebidas pelas organizaes de projeo como o mnimo
aceitvel.
Sin. cliente; usurio
Cf. processo

cooperao sf
Participao intencional e coordenada dos membros de uma equipe ou de toda uma
organizao em funo de uma ao comum.
Sem dvida, a <cooperao> pode ser estendida gesto dos fluxos, entre o
fornecedor e o cliente. Ao informar desde logo e de maneira bem completa, possvel
reduzir os estoques. (TEBOUL, J., 1991, p. 134.)

criar constncia de propsito v
Aceitar obrigaes, como alocar recursos para planejamento de longo prazo em
pesquisa e formao, e melhorar constantemente o projeto do servio e/ou produto.
Os problemas de amanh referem-se primordialmente a <criar constncia de
propsitos> e dedicao melhora da posio competitiva a fim de manter a




340


empresa viva e proporcionar emprego a seus funcionrios. (DEMING, W. E., 1990,
p. 19.)
Nota Constitui o primeiro dos 14 princpios.
Cf. 14 princpios

cultura sf
Fras. cultura da empresa; cultura organizacional; cultura para a qualidade
Conjunto de fatores da estrutura organizacional e de psicologia que determina a fora
total da organizao a longo prazo, incluindo a capacidade de prestar servios/produzir
produtos de qualidade de forma econmica.
No entanto, todos os gerentes tm esses dois padres (kaisen/lucros a curto prazo) de
comparao em mente quando tomam decises, embora as consideraes de
<cultura> sejam freqentemente sutis e latentes e a maioria dos gerentes nem mesmo
percebe... (IMAI, M., 1992, p. 203.)
Nota a personalidade da organizao e formada pelo conjunto dos profissionais que a
administram.

custo da baixa qualidade sm
Quantia dispendida resultante de defeitos, no-conformidades, erros e deficincias na
prestao de servios/produo que necessitam de correo.
O registro detalhado do <custo da baixa qualidade> (conforme discutido no Captulo
4, Volume I, Custos da Qualidade), parece no ser mantido na maioria dos bancos.
(ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 411.)
Nota Tipicamente, diz-se que esse custo situa-se entre 15% e 30% das vendas totais, que
destinado a pagar refugos, retrabalho, reprogramao, horas extras e outros distrbios
internos, alm de despesas com garantias, devolues, tempo para apaziguar clientes
nervosos e outros gastos externos.
Sin. custo da m qualidade
Cf. retrabalho







341


custo da m qualidade sm
Sigla CMQ
Fras. custo da m qualidade em servios
Quantia dispendida resultante de defeitos, no-conformidades, erros e deficincias na
prestao de servios/produo que necessitam de correo.
Estimar os <custos da m qualidade> como um estudo nico, usando posteriormente
os resultados desse estudo para identificar os projetos especficos para o
aperfeioamento. (JURAN, J. M.; GRYNA, F. M., 1991, p. 85, (v. I).)
Nota Tipicamente, diz-se que esse custo situa-se entre 15% e 30% das vendas totais, que
destinado a pagar refugos, retrabalho, reprogramao, horas extras e outros distrbios
internos, alm de despesas com garantias, devolues, tempo para apaziguar clientes
nervosos e outros gastos externos.
Sin. custo da baixa qualidade
Cf. retrabalho

custo da no-qualidade sm
Var. custo da no qualidade
Somatrio da quantia gasta em decorrncia da falta de obteno da qualidade
satisfatria na primeira vez em que o processo desencadeado.
Assim, ser possvel chegar a controlar e tornar o processo insensvel o suficiente
para se passar automatizao sem superviso. Os controles sero progressivamente
integrados ao processo em si, e o <custo da no-qualidade> diminuir ainda mais. A
qualidade e a produtividade comparecero, caso se invista suficientemente no
conhecimento do processo fsico. // Os <custos da no qualidade> (refugo e
retrabalho) so apurados? (TEBOUL, J., 1991, p. 91. // LAS CASAS, A. L, 1999, p.
109.)
Nota Em algumas organizaes, ele atinge valores da ordem de 20% a 40% do faturamento
bruto.
Cf. processo







342


custo da qualidade sm
Sigla CDQ
Fras. custo da qualidade do servio; custo operacional da qualidade; tcnicas de
clculo do custo da qualidade
Conjunto de fatores econmicos da qualidade relacionado aos gastos necessrios que
visam assegur-la e garanti-la, assim como a cobrir as perdas decorrentes da
prestao de servios/produo defeituosas.
Uma discusso em grupo foi feita na Qualiplus para definir uma posio com relao
abordagem clssica de <custos da qualidade (CDQ)>, dentro de um programa de
qualidade total. (MOURA, E. C., 1994, p. 31.)
Nota Ele classificado em quatro categorias: preveno, avaliao, falhas internas e falhas
externas. No obstante a complexidade em se calcular tais custos, notrio que a
despesa deva se concentrar em 2,5% do faturamento de uma organizao.
Cf. custo de avaliao; custo de falha externa; custo de falha interna; custo de
preveno

custo da qualidade ruim sm
Somatrio da quantia gasta em decorrncia do reconhecimento do valor da
manuteno e do aprimoramento da qualidade.
Este problema composto pela tpica situao na qual os sistemas internos no
recebem as informaes sobre as queixas dos clientes a respeito da qualidade dos
servios. Como resultado, sistemas que criem um incentivo para que os clientes
demonstrem sua insatisfao so fundamentais para que se avalie o <custo da
qualidade ruim>. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p.
90.)

custo de avaliao sm
Somatrio da quantia gasta em decorrncia das atividades de inspeo, controle e
auditoria da qualidade de produtos/servios, com o objetivo de determinar o nvel de
qualidade dos produtos/servios finais.
A qualidade tem um preo real e mensurvel, embora como custo se dilua em relao
aos benefcios. Os custos de um programa de TQC podem ser distribudos em quatro




343


grupos: (...) <custos de avaliao>, ou seja, os gastos efetivados para avaliar a
qualidade dos produtos, medida indispensvel manuteno dos nveis da qualidade
desejados; ... (CERQUEIRA NETO, E. P. de, 1993, p. 49.)
Nota Insere-se no custo de um programa de TQC e seus principais elementos compreendem
a inspeo, o controle e a auditoria da qualidade.
Cf. auditoria da qualidade; inspeo; total quality control (TQC)

custo de avaliao da qualidade sm
Somatrio da quantia gasta em decorrncia das atividades de inspeo, controle e
auditoria da qualidade de produtos/servios, com o objetivo de determinar o nvel da
qualidade obtido.
Os <custos de avaliao da qualidade> normalmente encarados nos meios
manufatureiros como sendo os custos de inspeo dos erros nos vrios estgios do
processo produtivo, tem vrios componentes, incluindo inspees, testes e auditorias
do sistema. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 87.)
Nota Seus vrios componentes so inspeo/ensaios de recebimento de materiais, ensaios e
controles durante a fabricao/prestao de servios, preparao para inspeo e
testes, auditorias da qualidade de produtos/servios, homologaes e aprovaes
externas, manuteno e aferio de equipamentos de inspeo e testes, verificao do
trabalho final e reviso de dados relativos a testes e inspees.
Cf. auditoria da qualidade; inspeo; nvel da qualidade

custo de falha externa sm
Somatrio da quantia gasta em decorrncia de erros experimentados pelos clientes.
A qualidade tem um preo real e mensurvel, embora como custo se dilua em relao
aos benefcios. Os custos de um programa de TQC podem ser distribudos em quatro
grupos: (...) <custos de falhas externas> que passam a existir quando produtos
defeituosos ou no conformes atingem o cliente. (CERQUEIRA NETO, E. P. de,
1993, p. 49.)
Nota Insere-se no custo de um programa de TQC e seus principais elementos compreendem
as reclamaes dos clientes, assistncia tcnica e rejeio/devoluo do
produto/servio.




344


Cf. custo da qualidade; inspeo; total quality control (TQC)

custo de falha interna sm
Somatrio da quantia gasta em decorrncia de defeitos descobertos pelo
produtor/prestador de servios, antes de eles alcanarem os clientes.
A qualidade tem um preo real e mensurvel, embora como custo se dilua em relao
aos benefcios. Os custos de um programa de TQC podem ser distribudos em quatro
grupos: (...) <custos de falhas internas>, abrangendo os gastos decorrentes de
materiais defeituosos e no conformes, bem como os gastos efetuados com produtos
que, por no se enquadrarem nas especificaes da empresa, no traro retorno
financeiro. o caso dos refugos, dos retrabalhos e dos itens danificados.
(CERQUEIRA NETO, E. P. de, 1993, p. 49.)
Nota Insere-se no custo de um programa de TQC e seus principais elementos compreendem
o refugo, o retrabalho e a desclassificao/desquaficao de produtos/servios.
Cf. custo da qualidade; retrabalho; total quality control (TQC)

custo de falha no verificvel sm
Somatrio da quantia gasta em decorrncia de defeitos ocultos e difceis de mensurar,
referentes insatisfao do cliente que no informada ao produtor/prestador do
servio.
Os <custos de falhas no verificveis> incluem custos diretos para o consumidor,
assim como custo de tempo e aborrecimento. Os chamados seguros contra acidentes
que, tipicamene, asseguram apenas contra custos verificveis referentes perda de
propriedade, dificilmente podem ser chamados de seguros. (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 87.)

custo de falha verificvel sm
Fras. custo de falha externa verificvel
Somatrio da quantia gasta em decorrncia de defeitos experimentados pelos clientes e
trazidos presena dos colaboradores da organizao.
Em servios, passageiros de companhias areas que so retirados de seus vos como
resultado de superlotao, so freqentemente compensados com passagens gratuitas,




345


criando assim um <custo de falha verificvel>. Devido intangibilidade do servio,
tais <custos de falhas verificveis> tendem a ser muito mais baixos em servios do
que no caso de bens tangveis. Por exemplo, o que um espectador que assiste a uma
pea de teatro ruim deve receber como compensao? (HESKETT, J. L.; SASSER
JR., W. E.; HART, C. W. L., 1994, p. 86.)

custo de obteno da qualidade sm
Sigla COQ
Somatrio da quantia gasta em decorrncia do total de esforos colocados para se
evitar, filtrar ou tratar a no-qualidade.
Na verdade, este <custo de obteno da qualidade> representa o total dos esforos
para se evitar, filtrar ou tratar a no-qualidade. O nvel do <COQ> sobe at cobrir
todos os problemas, um pouco como o nvel da gua de um rio que deve ultrapassar o
nvel dos calhaus e dos blocos que o obstraem. Esse custo total pode facilmente
atingir 20% das vendas de uma empresa no momento em que ela se d conta.
(TEBOUL, J., 1991, p. 139.)

custo de preveno sm
Somatrio da quantia gasta em decorrncia do planejamento, implementao e
manuteno de um sistema da qualidade, com o objetivo de assegurar a conformidade
s especificaes da qualidade em nveis econmicos.
Assim, aumentando-se o <custo de preveno> de 1, pode-se diminuir o custo de mau
funcionamento em 1.000. Esses fatores podem ainda ser mais elevados em alguns
servios. Por exemplo, um erro inicial de escrita no detectado num programa pode
causar conseqncias nefastas para o cliente. (TEBOUL, J., 1991, p. 141.)
Nota Insere-se no custo de um programa de TQC e seus principais elementos encontram-se
na engenharia da qualidade, controle da qualidade, planejamento da qualidade e
treinamento na funo qualidade.
Cf. conformidade; custo da qualidade; total quality control (TQC)







346


custo de recuperao sm
Somatrio da quantia gasta em decorrncia do empenho para compensar lapsos da
qualidade do servio prestado, antes que ocorram problemas com os clientes.
Gerentes de empresas de servios revolucionrios no vem deste modo.
Primeiramente, eles medem os <custos de recuperao> e observam seu declnio
juntamente com os custos de falhas de servio (incluindo os custos de falhas externas
conforme referenciado na Figura 5-1), medida em que a qualidade aumenta.
(HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 95.)

custo de troca de fornecedor sm
Conjunto de fatores econmicos do servio relacionado aos gastos necessrios para
assegurar a fidelidade do cliente.
Uma vez que os consumidores investem na mudana de um fornecedor difcil faz-
los retornar ao servio anterior. Esta a razo por que fornecedores de servios
revolucionrios investem tanto esforo na criao de <custos de troca de
fornecedor>. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 51.)
Nota uma traduo do emprstimo ingls switching costs.
A fidelidade de um cliente a um fornecedor de servios funo no s de incentivos
positivos, como tambm de um desejo natural de evitar ter que aprender novas rotinas
de servio.
Cf. fidelidade do cliente; fornecedor de servios

custo do servio sm
Fras. custo do servio para o fornecedor
Conjunto de fatores econmicos do servio relacionado aos gastos necessrios para
assegur-lo e garanti-lo em toda a organizao.
A Fig. 14 um diagrama de Ishikawa que apresenta os componentes do <custo do
servio> para o cliente. As Figs. 15 e 16 so grficos de controle utiizados na sala de
caldeiras e para os servios aos clientes. (DEMING, W. E., 1990, p. 179.)
Nota influenciado, entre outros, pela natureza do servio oferecido, pela estratgia de
operaes da organizao, por seu sistema de prestao de servios, pelo grau no qual
a capacidade da organizao utilizada e pelas necessidades e atitudes dos




347


colaboradores.
Cf. sistema de prestao de servios

custo-alvo sm
Conjunto de fatores econmicos relacionado aos gastos necessrios que o mercado
suportar, sendo dividido e alocado para cada componente do produto/servio e para
departamentos ou fornecedores responsveis pelo mesmo.
Os <custos-alvo> no so "lanados contra a parede" dos fornecedores nem nos seus
departamentos internos. Pelo contrrio, as companhias trabalham junto com eles
para atingir os <custos-alvo> e as redues a qualquer tempo, estando dispostas a
sustent-los com ajuda tcnica, inovaes nos processos at mesmo com horas
extraordinrias, quando necessrio. (PINE II, B. J., 1994, p. 134.)
Nota Dentro da customizao macia, a estratgia-chave de custo no projetar o
produto/servio e ento determinar seus custos.
Cf. customizao macia

delegao sf
Fras. delegao de poder; estratgia de delegao
Colocao do poder de deciso o mais prximo possvel da ao.
As falhas em obter os resultados pegou os gerentes de hierarquia superior de
surpresa. O conceito de <delegao> vital para toda a atividade administrativa.
(JURAN, J. M.; GRYNA, F. M., 1991, p. 324, (v. I).)
Nota Deming acreditava que colaboradores dotados de autonomia tendiam a tomar decises
mais rpidas e mais pautadas pelo mercado, embora a delegao tenha gerado um
certo desconforto no mbito gerencial pois ela no isenta os superiores da
responsabilidade, ou seja, delega-se deciso sobre a ao, mas mantm-se a
responsabilidade pelos resultados.
Sin. empowerment








348


delegar competncia v
Colocar o poder de deciso o mais prximo da ao com base em procedimentos
escritos e testados.
A habilidade para <delegar competncia> um atributo essencial do bom gerente.
Entretanto, a anlise de algumas das falhas mostra que existem alguns pontos srios
na estratgia de delegao. (JURAN, J. M.; GRYNA, F. M., 1991, p. 324, (v. I).)
Nota O lder toma decises sobre o inusitado, o imprevisto, o fora da normalidade e as
demais so tomadas pelo colaborador com base em procedimentos escritos e testados.

demanda de servio sf
Var. demanda por servio
Correlao existente entre o nmero de clientes que todas as organizaes de servios
querem atender e aqueles que so efetivamente atendidos por uma em particular.
Tendncias quanto lucratividade, fatias de mercado e <demanda de servio> so
indicadoras no s da sade econmica como tambm do desempenho da qualidade.
As empresas de servios acham bastante til apresentar os dados sobre lucros e
perdas de uma forma que permita sua comparao com as medies da qualidade. //
Esta caracterstica no teria maiores conseqncias se a <demanda por servios>
fosse constante. Infelizmente no . Ao contrrio, tipicamente apresenta
comportamento cclico com grande variao entre picos e vales. (ZIMMERMAN, C.
D. III; ENELL, J. W., 1991, p. 331. // GIANESI, I. G. N.; CORRA, H. L., 1996, p.
34.)
Nota Administrar a demanda e o fornecimento exige uma espcie diferente de entendimento
sobre a natureza da demanda para um conceito de servio, assim como esforos para
coordenar a administrao de ambos, clientes e pessoal que os atende, como nica
determinante importante da lucratividade.
Cf. cliente; conceito de servio; organizao de servios









349


desenvolvimento de pessoal sm
Conjunto de atividades que objetiva fornecer aos colaboradores condies para
exercerem determinadas funes por meio de conhecimentos e habilidades adquiridos
em treinamento.
O processo de organizao consiste em duas atividades principais: 1. Projeto da
estrutura da organizao - definio do trabalho a ser feito e da responsabilidade de
cada nvel hierrquico por esse trabalho... 2. Recrutamento, treinamento e
<desenvolvimento de pessoal> que ir compor a estrutura. (JURAN, J. M.; GRYNA,
F. M., 1991, p. 261, (v. I).)
Sin. desenvolvimento de recursos humanos

desenvolvimento de recursos humanos sm
Conjunto de atividades que objetiva fornecer aos colaboradores condies para
exercerem determinadas funes por meio de conhecimentos e habilidades adquiridos
em treinamento.
Neste sentido recomenda-se que cada empresrio considere em seu processo de
gesto estratgica: (...) desenvolver programa de <desenvolvimento de recursos
humanos> que contemple treinamento em todos os nveis, e, se for o caso,
implantao de crculos de controle da qualidade na empresa. Por favor, sem
improvisao. (CERQUEIRA NETO, E. P. de, 1993, p. 114.)
Sin. desenvolvimento de pessoal

desenvolvimento do produto sm
Processo de fornecer a um novo produto intangvel ou a um produto/servio
modificado as caractersticas da qualidade que atendam as necessidades e as
expectativas do cliente.
Inicialmente, deve-se admitir que o <desenvolvimento do produto>, (servio), as
polticas e a estratgia do produto ocorrem em uma grande diversidade de cenrios,
alguns muito recentes. De forma geral, pode-se dizer que quanto mais centralizado no
trabalho humano for o servio, mais ele se afastar do tratamento convencional do
"elemento produto" em marketing. Por outro lado, quanto mais regulamentado ou
mais profissional for o servio, maior ser a dificuldade de relacion-lo com os




350


aspectos de marketing tradicional. (TOLEDO, G. L., 1978, p. 40.)
Nota um dos principais instrumentos de marketing que est sob o controle da organizao
e que pode afetar a implantao e a aceitao do servio pelo mercado.
Cf. atender s necessidades do cliente; instrumentos de marketing; produto
intangvel

dimenso da qualidade sf
Conjunto de atributos visto como requisito essencial para que os produtos/servios
cheguem aos clientes respondendo a um determinado nvel de expectativa.
Em busca da Qualidade Total, dever ser observado o atendimento a cinco aspectos,
tambm conhecidos como <Dimenses da Qualidade>: 1. Qualidade intrnseca (...) 2.
Custo (...) 3. Atendimento (...) 4. Moral (...) 5. Segurana. Por ltimo, sem que isso
implique menor importncia, surge a necessidade do zelo pela segurana, no que se
refere ao produto em relao ao cliente e no que se refere ao pessoal envolvido no
processo produtivo. (ALMEIDA, R. C. de, 1998, p. 20.)
Nota constituda pela qualidade intrnseca, custo, atendimento, moral e segurana.

dimenso da qualidade de servios sm
Conjunto de atributos visto como requisito essencial para que os momentos da verdade
ocorram de acordo com determinado nvel de expectativas dos clientes.
Os atributos tm certas dimenses, sendo elas principalmente: confiabilidade,
segurana, aspectos tangveis, empatia e receptividade. Estes so os ingredientes
principais das <dimenses da qualidade de servios>, segundo o Marketing Science
Institute. (LAS CASAS, A. L., 1999, p. 79.)
Nota constituda pela confiabilidade, segurana, aspectos tangveis, empatia e
receptividade.
Cf. expectativa do cliente; momentos da verdade

disseminao de informaes sf
Conhecimentos que devem ser adquiridos pelos colaboradores em relao ao negcio,
misso, grandes propsitos e planejamento da qualidade na organizao.
Os pontos principais da diretriz da qualidade, no meu entender, so saber que: (...)




351


Ateno <disseminao de informaes> deve ser dada ao processo de educao e
treinamento das pessoas, inclusive quanto diretriz da qualidade adotada pela
empresa: ... (CERQUEIRA NETO, E. P. de 1993, p. 111.)
Nota Pr-requisito para a implantao da gesto pela qualidade total, cabendo ao
coordenador do processo de implantao detectar elementos-chave que no s possam
ser treinados, como tornarem-se multiplicadores no seu meio.
Cf. gesto pela qualidade total (GQT); multiplicador; planejamento da qualidade

divergncia sf
Grau de padronizao que o servio oferece.
Isto requer que se construa um fluxograma para o servio, identificando a abordagem
tradicional ou atual para cada etapa, desenhando alternativas de menores
<divergncias> e complexidades e decidindo que prtica adotar em cada etapa do
processo. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 79.)
Nota Sua origem creditada a Lynn Shostack, consultora e ex-executiva de servios, que
props que a atividade de posicionamento deva ser levada a cada passo do processo de
fornecimento do servio, centralizando o esforo de deciso de modo a selecionar uma
direo estratgica de cada vez.
Cf. posicionamento

efeito paradigma sm
Ao simultnea de vrios elementos que descrevem a maneira pela qual os indivduos
condicionam-se a uma forma especfica relativa resoluo de problemas.
Quando analisamos que as expectativas so elevadas ns assumimos atend-las com a
tecnologia presente. Mas as empresas devem sempre procurar aplicar o <efeito
paradigma>, que consiste em aumentar os servios e diminuir os preos. Nas
companhias mais bem administradas, a estrutura de custos mais eficiente e elas so
mais produtivas. A tecnologia do futuro poder permitir bons servios e preos
competitivos. (LAS CASAS, A. L., 1999, p. 198.)







352


efeito sinergia sm
Ao simultnea de vrios elementos que, em conjunto, tem um efeito total maior do
que a soma de todas as suas contribuies individuais.
Sem dvida, a cooperao pode ser estendida gesto dos fluxos, entre o fornecedor
e o cliente. Ao informar desde logo e de maneira bem completa, possvel reduzir os
estoques. Ao regularizar os programas de fornecimento, possvel obter fluxos com
menos folgas (mais "esticados"). Ao se compreender de que maneira as matrias-
primas e os componentes so utilizados, possvel encontrar <efeitos sinergias> /
"casamentos" que possam reduzir os custos. (TEBOUL, J., 1991, p. 134.)

elementos bsicos da viso estratgica de servios sm
Objetos essenciais de uma estratgia empresarial vencedora nos servios.
A este ponto, deveria ser aparente que existem profundas diferenas do modo comum
para o modo como os gerentes de servios revolucionrios vem cada elemento da
viso estratgica de servios. Eles nos sugeriram que os <elementos bsicos da viso
estratgica de servios> so importantes para o desenvolvimento da estratgia, mas
que os elementos integrativos da viso estratgica de servios - posicionamento,
alavancagem e integrao - e a aplicao interna da viso so "onde a ao est",
para colocar uma viso estratgica de servios em funcionamento. (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 32.)
Nota Comportam o segmento-alvo de mercado, o conceito de servio, a estratgia de
operaes e o sistema de prestao de servios.
Cf. conceito de servio; estratgia de operaes; segmento-alvo de mercado; sistema
de prestao de servios; viso estratgica de servios

elementos integrativos da viso estratgica de servios sm
Objetos complementares de uma estratgia empresarial vencedora nos servios.
A este ponto, deveria ser aparente que existem profundas diferenas do modo comum
para o modo como os gerentes de servios revolucionrios vem cada elemento da
viso estratgica de servios. Eles nos sugeriram que os elementos bsicos da viso
estratgica de servios so importantes para o desenvolvimento da estratgia, mas
que os <elementos integrativos da viso estratgica de servios> - posicionamento,




353


alavancagem e integrao - e a aplicao interna da viso so "onde a ao est",
para colocar uma viso estratgica de servios em funcionamento. (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 32.)
Nota Compreendem o posicionamento, a alavancagem e a integrao.
Cf. alavancagem; integrao; posicionamento

eliminar a necessidade de inspeo em massa v
Buscar a qualidade na melhoria do processo, priorizando a internalizao da
qualidade, pois a inspeo total no constitui ao corretiva sobre o mesmo.
Deixar de depender da inspeo para atingir a qualidade. <Eliminar a necessidade
de inspeo em massa>, dando, antes de mais nada, qualidade ao produto.
(SCHERKENBACH, W. W., 1990, p. 19.)
Nota Constitui o terceiro dos 14 princpios e o conceito muito importante na qualidade de
servios, onde a inspeo de cada atividade seria difcil e onerosa.
Cf. 14 princpios; ao corretiva

eliminar as barreiras entre os departamentos v
Manter todos os envolvidos acompanhando e interferindo no processo para se atingir
os resultados de um bom planejamento.
O trabalho em equipe uma necessidade crucial na empresa como um todo.
<Eliminar as barreiras entre os departamentos> significa que um cliente com tal tipo
de reclamao pode vir a mandar seu cheque com um desconto, acompanhado da
explicao. (DEMING, W. E., 1990, p. 48.)
Nota Constitui o nono dos 14 princpios, pois o trabalho em equipe, alm de constante ao
na motivao, exige severa disciplina.
Cf. 14 princpios

eliminar lemas, exortaes e metas v
Retirar do ambiente de trabalho dizeres inoperantes, uma vez que os mesmos tm um
impacto momentneo, pois as causas da insatisfao dos colaboradores encontram-se
no sistema.
<Eliminar lemas, exortaes e metas>, e os cartazes incentivando-os a aumentar a




354


produtividade. "Seu trabalho seu auto-retrato. Voc o assinaria?" A resposta no
(no quando o trabalhador recebe uma tela com defeitos, tintas inadequadas, pincis
gastos. Cartazes e slogans desta natureza nunca ajudaram ningum a fazer um
trabalho bem feito. (DEMING, W. E., 1990, p. 49.)
Nota Constitui o dcimo dos 14 princpios e as campanhas motivacionais, por outro lado,
devem considerar o nvel de compreenso da equipe.
Cf. 14 princpios

eliminar o medo v
Criar uma atmosfera de respeito mtuo para que um sistema de gerenciamento com
base estatstica possa funcionar.
Outro prejuzo resultante do medo a incapacidade de servir aos interesses da
empresa devido necessidade de satisfazer determinadas regras. preciso <eliminar
o medo>, de tal forma que todos trabalhem de modo eficaz para a empresa.
(DEMING, W. E., 1990, p. 46.)
Nota Constitui o oitavo dos 14 princpios.
Cf. 14 princpios

eliminar padres de trabalho v
Destituir a importncia que se d s cotas no processo, assim como administrao
por objetivos numricos.
<Eliminar padres de trabalho> pois eles tendem tambm a confundir a compreenso
das pessoas do que seja exatamente sua tarefa. Devem realizar tantas funes por
hora ou atender s necessidades do cliente? (SCHERKENBACH, W. W., 1990, p.
86.)
Nota Constitui o dcimo primeiro dos 14 princpios e est subdividido em relao aos
colaboradores e administrao, pois o nmero estabelecido s ser vlido se nele
contiver os padres de qualidade e as especificaes tcnicas definidas.
Cf. 14 princpios; administrao por objetivos (APO); padro de qualidade







355


empowerment sf
Colocao do poder de deciso o mais prximo possvel da ao.
O leitor deve lembrar do termo <empowerment>, que significa dar fora aos
funcionrios. O termo tem sido mencionado por alguns consultores que dizem que
para um servio ser bem feito, em nvel de satisfao dos clientes, deve-se dar poder
aos funcionrios a fim de decidirem muitas das coisas que ajudam o cliente no local
em que o servio prestado. (LAS CASAS, A. L., 1999, p. 150.)
Nota Emprstimo do ingls cuja traduo delegao, potencializar e dar permisso,
embora j ocorra o uso de autorizar e autorar de forma menos freqente.
Deming acreditava que colaboradores dotados de autonomia tendiam a tomar decises
mais rpidas e mais pautadas pelo mercado, embora a delegao tenha gerado um
certo desconforto no mbito gerencial pois ela no isenta os superiores da
responsabilidade, ou seja, delega-se deciso sobre a ao, mas mantm-se a
responsabilidade pelos resultados.
Sin. delegao

empregado sm
Fras. empregado da linha de frente
Indivduo que executa funes dentro de uma organizao.
As avaliaes de desempenho so ineficazes, imprecisas, desnecessrias e
freqentemente embaraosas, de acordo com duas pesquisas feitas em mais de 400
empresas. Essas pesquisas descobriram que uma falha importante das revises de
desempenho a incapacidade dos gerentes de conversarem com os <empregados>
sobre seus pontos fortes e fracos. (SCHERKENBACH, W. W., 1990, p. 51.)
Sin. colaborador; funcionrio

empresa sf
Fras. empresa como processo; empresa competitiva; empresa orientada ao cliente
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir de insumos recebidos de fornecedores e
beneficiados/manufaturados com recursos humanos e tecnolgicos.
Uma <empresa>, grupo, firma ou empreendimento, quer seja sociedade annima ou




356


no, pblica ou privada, uma organizao. Reserva-se o termo <empresa> para se
referir a uma primeira parte interessada em um negcio, cujo objetivo fornecer um
produto ou servio. (CERQUEIRA NETO, E. P. de, 1993, p. 60.)
Sin. companhia; organizao
Cf. atender s necessidades do cliente; fornecedor

empresa de classe mundial sf
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir de um enfoque no cliente ou no processo.
As <empresas de classe mundial> fecham almoxarifados, jogam fora as
empilhadeiras, desmancham as prateleiras, vendem os recipientes e se livram dos
equipamentos para controlar os inventrios e registrar cada operao que envolva
mo-de-obra. Se todos os dispositivos estiverem funcionando bem, o resultado
"querida, encolhi a fbrica", que agora tem menos investimento em espao e
equipamento - mesmo enquanto as vendas decolam. (SCHONBERGER, R. J., 1992, p.
187.)
Sin. organizao de classe universal
Cf. atender s necessidades do cliente

empresa de servios sf
Fras. empresa de prestao de servios; empresas prestadoras de servios; empresa
lder em servios
Parte interessada e dedicada execuo de tarefas que objetivam atender a terceiros
dentro ou fora de suas estruturas.
O ativo mais importante de uma <empresa de servios> o seu quadro de
funcionrios. A qualidade do resultado depende muito, pois, do recrutamento, da
formao e da conservao desse ativo. Investir na preveno investir
essencialmente no recrutamento e na formao. (TEBOUL, J., 1991, p. 220.)
Sin. indstria de servios; organizao de servios
Cf. organizao






357


empresa financeira sf
Pessoa fsica ou jurdica cuja atividade principal ou acessria consiste na coleta,
intermediao ou aplicao de recursos prprios ou de terceiros, em moeda nacional
ou estrangeira, e a custdia de valor de propriedades de terceiros.
Para cumprir sua misso e atingir seus objetivos organizacionais e de adaptao s
foras do ambiente, a <empresa financeira> dever dispor de um vasto arsenal de
ferramentas em suas vrias reas, as quais devero funcionar de forma integrada.
(TOLEDO, G. L., 1978, p. 72.)
Sin. instituio financeira

empresa prestadora de servios sf
Parte interessada em prestar o atendimento s necessidades dos clientes a partir de
insumos recebidos de fornecedores e beneficiados/manufaturados com recursos
humanos e tecnolgicos.
A pesquisa de marketing, embora se tenha tornado uma atividade bsica no campo
dos produtos, somente agora tem sido levada em considerao pelas <empresas
prestadoras de servios>. Tal reconhecimento tardio dos benefcios provenientes da
utilizao da pesquisa apresenta suas vantagens. (TOLEDO, G. L., 1978, p. 38.)
Sin. organizao prestadora de servios
Cf. necessidade do cliente

empresa-cliente sf
Var. empresa cliente
Parte interessada que recebe servios de outras organizaes que so suas fornecedoras
de insumos e parceiras na prestao do servio final.
J que o servio nada mais que o trabalho executado por algum, muitos
consumidores encaram a <empresa-cliente> de prestao de servio como algo
parecido com a relao patro/empregado. // Alm disso, a CompuServe auxilia
<empresas clientes> a organizar e operar redes internas de comunicao, bem como
redes que as ligam a seus clientes e fornecedores. (ZIMMERMAN, C. D. III; ENELL,
J. W., 1991, p. 317. // HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994,
p. 179.)




358


Cf. organizao

encantar o cliente v
Atender no s as expectativas do cliente, como tambm super-las, com oferecimento
de prestao de servios/produto que impressionam pela valorizao do investimento,
pela individualidade e pela exclusividade.
A qualidade torna-se mais do que simples satisfao do cliente, termo este um pouco
neutro, incolor e tcnico. A qualidade dever seduzir e <encantar o cliente>, para
retomar a expresso forjada por Tom Peters. (TEBOUL, J., 1991, p. 20.)
Nota Sua origem creditada a Tom Peters, famoso consultor da qualidade, de nacionalidade
americana.
Sin. enchanted customer
Cf. expectativa do cliente

enchanted customer sm
Atender no s as expectativas do cliente, como tambm super-las, com oferecimento
de prestao de servios/produto que impressionam pela valorizao do investimento,
pela individualidade e pela exclusividade.
Nesse ponto, oportuno chamar a ateno do leitor para uma expresso que est em
evidncia e que <"enchanted customer">. Tremo, ao pensar em algum anunciando,
prematuramente, em sua organizao, um programa do tipo "Encantemos Nossos
Clientes". "Vamos colocar musiquinha nos telefones, para eles ouvirem enquanto
esperam. Vamos melhorar o nosso processo de concesso de notas de crdito para
compensar nossos erros e defeitos de nossos produtos. (ALMEIDA, L. G., 1995, p. 7.)
Nota Emprstimo do ingls cuja traduo encantar o cliente.
Sua origem creditada a Tom Peters, famoso consultor da qualidade, de
nacionalidade americana.
Sin. encantar o cliente
Cf. expectativa do cliente







359


enfoque na organizao sm
Tcnica administrativa que converge para o agrupamento tendo em vista a prpria
organizao.
O organograma mostra uma empresa que possui uma cadeia de lanchonetes, uma
pista de corrida, vrias companhias manufatureiras e um oleoduto? Se for esse o
caso, h uma total falta de <enfoque na organizao> como um todo. Hoje em dia os
conglomerados esto fora de moda - e, esperam os clientes, para todo o sempre. Nos
ltimos anos, muitas grandes empresas sem enfoque se desfizeram de algumas de suas
partes com o propsito de ficar focalizadas. A idia a seguinte: ou ns o fazemos, ou
uma companhia intrusa o faz antes de ns e leva todo o dinheiro. (SCHONBERGER,
R. J., 1992, p. 36.)

enfoque no cliente sm
Tcnica administrativa que converge para o agrupamento tendo em vista as
necessidades dos clientes em uma organizao e que acarreta um fluxo rpido de
informaes.
Eles seguem aquilo que deveria ser um axioma do foco: procure alcanar o <enfoque
no cliente> primeiro, e depois no produto. O <enfoque no cliente> tem prioridade
mxima, porque a ligao com um cliente cria oportunidades para o aprimoramento
do processo - ao conjunta para resolver problemas que poderiam destruir o
relacionamento entre cliente e fornecedor. (SCHONBERGER, R. J., 1992, p. 36.)
Cf. necessidade do cliente

enfoque no processo sm
Tcnica administrativa que converge para o agrupamento tendo em vista as funes
inerentes de uma organizao e que acarreta a burocratizao da mesma, impedindo
um fluxo rpido de informaes.
Mesmo que se encontrem referncias acadmicas sobre a noo de <enfoque no
processo>, uma idia descabida, uma contradio de termos. Agrupar por processo
comum uma abordagem antifoco, e quando se analisam os efeitos que ela causa,
parece uma tragicomdia: o processsamento de um pedido trivial pode envolver
atrasos interminveis e um fluxo labirintoso de linhas cruzadas que passam por todo




360


lugar. (SCHONBERGER, R. J., 1992, p. 35.)
Cf. funo

enfoque no produto sm
Tcnica administrativa que converge para o agrupamento tendo em vista o fluxo dos
produtos/servios no atendimento do pedido em uma organizao e que acarreta um
fluxo rpido de informaes.
A quinta fase o atendimento do pedido, o que requer dezenas de separadores de
estoque, empacotadores, e carregadores num armazm que contm milhares de itens.
Uma das opes organizar essas pessoas em uma ou mais cadeias, no estilo de
longas equipes de apagar incndios com baldes, com <enfoque no produto>, para
separar, empacotar e carregar. (SCHONBERGER, R. J., 1992, p. 36.)

engajar todos na realizao da transformao v
Comprometer todos, a comear pela alta administrao, no processo de realizar a
mudana em direo qualidade total.
A administrao dever assumir e enfrentar cada um dos 13 princpios acima. Os
administradores devero <engajar todos na realizao da transformao> e todos
devero chegar a um consenso relativamente ao significado de cada um. (DEMING,
W. E., 1990, p. 65.)
Nota Constitui o dcimo quarto dos 14 princpios.
Cf. 14 princpios; alta administrao

engenharia da qualidade sf
Ramo da engenharia responsvel pelos princpios e pela prtica de anlise do sistema
da qualidade em todos os seus estgios e providncias para maximizar a qualidade, o
controle e a garantia da qualidade de processos, produtos e servios.
Assim, os engenheiros da qualidade podem determinar de que modo o produto ser
inspecionado, testado e controlado no decorrer de sua vida dentro e fora da
companhia. Especificar esses requisitos, treinar o pessoal para cumpri-los e calcular
os resultados o que significa <engenharia da qualidade>. (CROSBY, P. B., 1999,
p. 86.)




361


Nota parte fundamental de um sistema da qualidade e deve zelar pela qualidade geral de
uma organizao para que o todo alcance os resultados propostos.
Cf. garantia da qualidade; sistema da qualidade (SQ)

envolvimento dos empregados sm
Sigla EE
Tcnica administrativa que preconiza o abandono do modelo manipulativo e oferece
aos colaboradores da organizao o conhecimento, as ferramentas e as tarefas de
resoluo de problemas.
O terremoto do <envolvimento dos empregados (EE)> balanou os velhos conceitos
sobre trabalho e pessoal, e abriu o caminho para o esclarecimento. Devemos tambm
mudar as palavras que usamos. A Tabela 5.1 contrasta a terminologia pr-terremoto e
a esclarecida. (SCHONBERGER, R. J., 1992, p. 90.)
Cf. colaborador

equipe de melhoria contnua sf
Equipe pequena, composta por um representante de cada setor da organizao,
encarregada de dar apoio implantao, execuo e continuidade do sistema da
qualidade.
Todos os membros de uma <equipe de melhoria contnua> tm a oportunidade de
contribuir com idias, planos e nmeros; mas qualquer um deve esperar ver algumas
de suas melhores idias submergirem em face do consenso da equipe. Poder ter nova
oportunidade, em outra retomada do ciclo. Uma boa <equipe de melhoria contnua>
ter memria social. (DEMING, W. E., 1990, p. 67.)
Nota O processo de implantao da gesto pela qualidade total em servios refora o
conceito quando ento so formados os auditores internos que contribuem para um
clima de cooperao e motivao em relao aos objetivos traados.
Sin. equipe de melhoria da qualidade; time da qualidade
Cf. sistema da qualidade (SQ)







362


equipe de melhoria da qualidade sf
Equipe pequena, composta por um representante de cada setor da organizao,
encarregada de dar apoio implantao, execuo e continuidade do sistema da
qualidade.
Estabelecendo formalmente uma <equipe de melhoria da qualidade> que represente
todos os departamentos, o esclarecimento declara com nitidez que o assunto envolve a
todos. No h operao singularizada, ningum "dedurado". "Estamos juntos nessa
histria." Palavras mgicas. Sem a necessidade de arquitetar planos para proteger o
departamento, todos trabalham juntos. O progresso rpido e imediato,
naturalmente. (CROSBY, P. B., 1999, p. 66.)
Nota O processo de implantao da gesto pela qualidade total em servios refora o
conceito quando ento so formados os auditores internos que contribuem para um
clima de cooperao e motivao em relao aos objetivos traados.
Sin. equipe de melhoria contnua; time da qualidade
Cf. sistema da qualidade (SQ)

especificao sf
Documento que estabelece formalmente as necessidades, agrupadas por natureza, a
serem satisfeitas, com as quais a prestao do servio/produo do produto tm de
estar conforme.
O estgio denominado <especificao> nada mais do que uma representao de um
sistema de informaes sobre o processo produtivo ou a prestao do servio.
(CERQUEIRA NETO, E. P., 1993, p. 90.)
Nota to abrangente que pode ser aplicada a produtos, servios, processos, assim como a
conceitos e metodologias. A exigncia do manual da qualidade , na realidade, uma
especificao da poltica da qualidade e das estruturas do sistema da qualidade
implantadas nessa organizao.
Cf. manual da qualidade (MQ); poltica da qualidade; sistema da qualidade (SQ)








363


especificao do servio sf
Documento que estabelece formalmente o servio a ser prestado, as necessidades,
agrupadas por natureza, a serem satisfeitas, com as quais a prestao do servio tem de
estar conforme.
A <especificao dos servios> de entrega e qualidade so os documentos bsicos
para os servios e no devem ser trocados sem justa causa e considerao. No
entanto, observa-se que o controle de qualidade deve fazer parte do processo de
qualidade integrante. (LAS CASAS, A. L., 1999, p. 161.)
Nota to abrangente que pode ser aplicada a servios, processos, assim como a conceitos
e metodologias.

espiral da qualidade sm
Fras. espiral do progresso em qualidade
Modelo conceitual de interao das atividades interdependentes que influenciam a
qualidade de um processo ao longo de seus vrios estgios, desde a identificao das
necessidades dos clientes at a avaliao da satisfao das mesmas.
Juran havia tido uma inspirao semelhante quando criou a <espiral da qualidade>,
na qual todos os departamentos participam da qualidade final (sem falar em Deming,
ardente defensor do controle estatstico no nvel de cada um dos processos).
(TEBOUL, J., 1991, p. 16.)
Nota Considera a aplicao de maior cuidado e tempo no planejamento de cada ao e o
controle das fases seguintes da execuo.
Sin. ciclo da qualidade

estratgia de acompanhamento da demanda sf
Disposio e combinao de todas as foras disponveis para casos em que as
demandas so transitrias e imprevisveis, a estrutura de custos pode ser administrada
de forma varivel e h uma oferta de mo-de-obra de baixa qualificao para trabalhos
que exigem treinamento limitado.
As conseqncias indesejveis da operao por longos perodos de tempo com as
<estratgias de acompanhamento da demanda> levaram prestadores de servios
revolucionrios, que se confrontavam com demandas transitrias e imprevisveis, a




364


procurarem meios de modificar essas estratgias. (HESKETT, J. L.; SASSER JR., W.
E.; HART, C. W. L., 1994, p. 163.)
Nota Dentro do gerenciamento do fornecimento de servio, W. Earl Sasser Jr. sugere como
combinao maximizar a eficincia da prestao do servio durante os perodos de
pico, utilizar colaboradores em tempo parcial ou alugar equipamento, treinar
colaboradores para executarem duas ou mais tarefas com diferentes padres de
demanda, compartilharem a capacidade entre atividades e aumentarem a participao
do cliente na prestao do servio.
Cf. fornecimento de servio

estratgia de diferenciao sf
Disposio e combinao de todas as foras disponveis relacionadas ao nvel de
qualidade oferecido pelo servio prestado para barrar a entrada da concorrncia no
mercado.
A <estratgia de diferenciao>, portanto, estaria mais ligada ao nvel de qualidade
do servio prestado, o qual pode ser difcil de ser igualado, pois depende de
competncia na gesto de operaes. A diferenciao cria barreiras entrada, pois
fora os ingressantes potenciais a investir para quebrar a lealdade dos consumidores
s empresas consideradas excelentes em seu campo de atuao. (GIANESI, I. G. N.;
CORRA, H. L., 1996, p. 56.)
Cf. nvel da qualidade; mercado

estratgia de distribuio para servios sf
Disposio e combinao de todas as foras disponveis que auxiliam a alterar a
demanda em funo da capacidade disponvel.
Podem ser desenvolvidas <estratgias de distribuio para servios>, que auxiliam a
alterar a demanda em funo da capacidade disponvel. Assim, cadeias lderes de
hotis muitas vezes agrupam seus recursos, construindo duas ou mais unidades nos
grandes centros metropolitanos. Isto lhes permite encorajar os clientes, que esto
procura de hospedagem em um hotel lotado, a aceitar um quarto em um hotel prximo
da mesma rede. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p.
160.)




365


estratgia de nivelamento da capacidade sf
Disposio e combinao de todas as foras disponveis para casos em que a demanda
menos transitria e previsvel, as conseqncias de um mal servio so srias e h
uma necessidade de mo-de-obra de alta qualificao para trabalhos que exigem
treinamento significativo.
Em contraste, a <estratgia de nivelamento da capacidade> pode ser empregada nos
casos em que a demanda menos transitria e mais previsvel, as conseqncias de
um servio mal desempenhado so srias e h a necessidade de prestadores de
servios experientes com treinamento significativo (ou equipamento dispendioso,
complexo e especializado). (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L.,
1994, p. 163.)
Nota Dentro do gerenciamento do fornecimento de servio, W. Earl Sasser Jr. sugere como
combinao maximizar a eficincia da prestao do servio evitando os perodos de
pico, utilizar colaboradores em tempo integral, treinar colaboradores para executarem
apenas uma tarefa especializada no mesmo padro de demanda e evitar a participao
do cliente na prestao do servio.
Cf. fornecimento de servio

estratgia de operaes sf
Var. estratgia operacional
Fras. estratgia de operaes de servios
Disposio e combinao de foras disponveis como uma forma de alavancar a
percepo do consumidor do valor do servio em relao ao seu custo.
Em seguida, ele colocou uma <estratgia de operaes>, incluindo organizao e
controle, junto a polticas financeira, de marketing e de operaes, que asseguraram
que ele poderia fornececer o conceito de servio prometido. (...) Formidvel, no
acha? Apenas no sentido em que Fred Smith e seus colegas entendem claramente o
poder de um <estratgia operacional>, que realmente desenvolve redes e tecnologia
de informao para obter vantagem estratgica. Estes so temas que unem uma
<estratgia operacional> e um sistema de prestao de servios diretamente a um
conceito de servio, como sugerido na Figura 9-1. (HESKETT, J. L.; SASSER JR.,
W. E.; HART, C. W. L., 1994, p. 24 e 174.)




366


Nota um dos elementos bsicos da viso estratgica de servios e inclui fortes convices
sobre o tipo de pessoa que deve ser empregada, o modo como esta organizada,
controlada e a autonomia que lhe deve ser dada para gerenciar, bem como as polticas
operacional, financeira e de marketing empregadas pela administrao.
Cf. elementos bsicos da viso estratgica de servios

estratgia de operaes focalizada sf
Disposio e combinao de foras disponveis em que os objetivos priorizados pelo
mercado-alvo e visados pelo sistema de operaes no apresentam conflitos que
inviabilizem o alto desempenho simultneo.
Um dos conceitos mais importantes na rea de estratgia de operaes o
desenvolvimento de uma <estratgia de operaes focalizada>. Uma fbrica que se
focaliza em uma tarefa de operaes estreita, para um nicho de mercado especfico,
ir desempenhar-se melhor do que uma fbrica que vise a uma misso mais
abrangente e difusa. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 115.)
Nota Ela permite conhecer melhor as necessidades dos clientes e conhecer melhor as
atividades da empresa, possibilitando aprimoramentos de qualidade e produtividade.
Cf. necessidade do cliente; sistema de operaes

estratgia de servios sf
Fras. estratgia de complementaridade de servios
Disposio e combinao de todas as foras disponveis levando-se em considerao
as reaes externas e internas.
Ao implementar <estratgias de servios> os administradores podem escolher: eles
tm a oportunidade de se beneficiar do conhecimento dos erros dos seus pares da
manufatura; ou podem incorrer nos mesmos erros que levaram alienao do
trabalhador. (DEMING, W.E., 1990, p. X.)









367


estratgia empresarial sf
Posicionamento da organizao, em suas relaes com setores da sociedade e
ambiente de negcios, que fundamental para a manuteno e o crescimento de suas
atividades.
Como exemplo, temos a viso de qualidade total como novo paradigma administrativo
e <estratgia empresarial>... e a necessidade imperativa de liderana gerencial para
tanto - conforme preconizado j nas dcadas de 1950 e 1960 por Juran, Deming e
Feingenbaum. Desde ento, magistralmente implementada e enriquecida no Japo, a
qualidade total s a partir dos anos 80 vem sendo assimilada pelo Ocidente.
(MOURA, E. C., 1994, p. X.)
Nota O desenvolvimento de polticas da qualidade, como item obrigatrio da ISO 9000 e o
surgimento da ISO 14000, amplia a mesma em suas relaes com o meio ambiente e
seus vizinhos.
Cf. norma ISO 9000; poltica da qualidade

estudo de mercado bancrio sm
Conhecimento da natureza da atividade bancria e do ambiente de marketing do
banco, de forma que cada participante do sistema tenha condies de nele situar-se
mais adequadamente em confronto com a concorrncia.
As referncias a respeito dos <estudos de mercado bancrio> desenvolvidos pelos
bancos so raras na literatura bancria. Entre os motivos dessa escassez de material
podem ser citados, de um lado, o nmero exguo de estudos levados a efeito pelos
bancos e, de outro, a recente histria dos mesmos, o que certamente no acontece
com o setor industrial. (TOLEDO, G. L., 1978, p. 85.)
Nota Seu objeto a pesquisa e a anlise de dois elementos que, em conjunto, definem os
aspectos mais significativos do mercado bancrio: um aspecto psicolgico,
compreendendo os gostos, necessidades, atitudes e aspiraes da clientela adquirida e
potencial, e um aspecto estatstico, compreendendo a evoluo e o desenvolvimento de
determinado esforo de explorao de mercado e medindo, objetivamente, para dado
perodo de tempo, o grau de saturao ou os provveis subdesenvolvimentos.
Cf. ambiente de marketing





368


executivo de marketing sm
Fras. executivo de marketing bancrio
Indivduo responsvel pelo planejamento, implantao e gerenciamento das atividades
de marketing em uma organizao.
Os dados obtidos de fontes internas ou externas s podero ser utilizados
eficientemente pelos <executivos de marketing> aps receberem um tratamento
quantitativo adequado. Os mtodos quantitativos, que podem figurar como
instrumentos poderosos de tratamento de informaes, pertencem ao campo
disciplinar da estatstica e da pesquisa operacional. (TOLEDO, G. L., 1978, p. 86.)
Sin. homem de marketing
Cf. atividades de marketing

expectativa do cliente
Desejo do cliente, em relao a um servio/produto, que deve ser atendido.
O produto ou servio deve responder s <expectativas do cliente>, algumas das quais
so latentes ou formuladas de maneira confusa, mas certamente no a todas as
expectativas, todas as exigncias, todas as particularidades, porque o objetivo
global, pode-se dizer mundial. (TEBOUL, J., 1991, p. 172.)
Nota O diferenciador entre organizaes bem sucedidas e suas concorrentes a antecipao
das necessidades de seus clientes, por meio de pesquisas permanentes desses desejos e
da identificao de novas tecnologias que gerem melhor relao custo/benefcio.
Cf. necessidade do cliente

fbrica de servios sf
Produto da atividade humana que, sem assumir a forma de um bem material, exige
baixo grau de personalizao e contato com os clientes.
Mesmo assim, a rotatividade na <fbrica de servios> em geral muito desigual, com
menor rotatividade do pessoal de superviso ou quase-superviso e uma parte da
fora de trabalho renovando-se diversas vezes por ano. Isto permite que muitas
<fbricas de servios> pratiquem estratgias de "acompanhamento da demanda" nas
quais os nveis de pessoal so ajustados para mais ou para menos, conforme a
demanda dos clientes. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994,




369


p. 239.)
Nota Dentro da classificao dos servios, nessa diviso o recrutamento pouco seletivo,
com base em conhecimento bsico, sade e atitude, o treinamento realizado no
trabalho, com algum exemplo, as atribuies visam a tarefas rotineiras para padronizar
os cargos, a remunerao varivel, com base no tempo no cargo e o objetivo
minimizar custos de treinamento com rotatividade mnima apenas para pessoal-chave.
Cf. classificao dos servios

facilitador sm
Fras. facilitador do grupo; facilitador do servio
Colaborador treinado para disseminar os conceitos e as tcnicas da qualidade, assim
como a poltica e as estratgias da organizao.
Algumas empresas recorrem a <facilitadores> para ajudar os grupos de melhoria.
Como o nome indica, um facilitador um recurso colocado disposio do grupo
para ajud-lo, sobretudo na fase de diagnstico, mas nunca poder tomar o lugar da
hierarquia. O chefe hierrquico o chefe natural do grupo de melhoria. (TEBOUL,
J., 1991, p. 236.)
Nota Suas reas de atuao compreendem assistncia no planejamento e compatibilizao
de atividades no conselho da qualidade, facilitao e suporte nas reunies dos times da
qualidade, participao em programas de sensibilizao e motivacionais, educao e
treinamento, comunicao vertical e horizontal e programas com participao de
colaboradores.
Sin. multiplicador
Cf. conselho da qualidade; time da qualidade

filosofia Deming sf
Nmero total de idias que consubstancia a essncia da filosofia de Deming e aplica-
se a qualquer tipo de organizao, tanto na indstria de manufaturados quanto na de
servios, com aceitao universal.
Um Deming User Group (DUG) em particular tem sido muito ativo em seus esforos
para difundir essa filosofia. o DUG de San Diego, sob a coordenao cuidadosa da
Dra. Laurie Broedling. O "American Quality and Productive Institute (AQPI)", sob a




370


orientao do Dr. Myron Tribus uma fonte inesgotvel de informaes sobre a
<filosofia Deming>. O AQPI publica um boletim e patrocina conferncias sobre a
<filosofia Deming>. A lista aumenta dia-a-dia. (SCHERKENBACH, W. W., 1990, p.
146.)
Nota Iniciou-se por dez princpios em 1930 e o autor continuou aperfeioando-os at
alcanar o nmero atual de quatorze.
Sin. 14 princpios; nova filosofia; quatorze pontos de Deming
Cf. adotar a nova filosofia; aperfeioar o sistema; cessar a aprovao de oramento
com base no preo; criar constncia de propsito; eliminar a necessidade de
inspeo em massa; eliminar as barreiras entre os departamentos; eliminar
lemas, exortaes e metas; eliminar o medo; eliminar padres de trabalho;
engajar todos na realizao da transformao; instituir liderana; instituir
programa de educao e retreinamento; instituir treinamento; remover as
barreiras ao orgulho da execuo

floating sm
Recurso financeiro confiado pelo cliente, por motivos vrios e temporariamente, ao
banco que, por sua vez, aplica-o da maneira que mais lhe convm, objetivando
obteno de receitas.
"No primeiro semestre de 1994 (antes, portanto, da implementao do Plano Real), os
219 mais importantes [o autor do artigo no explicitou seu critrio de avaliao da
importncia] bancos brasileiros tiraram 63,4% de suas receitas do <floating> (...) No
mesmo perodo desse ano, essa proporo caiu para 4,7%." So nmeros
extremamente significativos. (ALMEIDA, R. C. de, 1998, p. 15.)
Nota Embora a traduo desse emprstimo do ingls seja financiamento, os especialistas
ampliaram o conceito.










371


foco sm
Fras. foco orientado ao cliente; foco orientado ao servio; foco orientado aos
clientes e ao servio; natureza do foco
Ponto de convergncia que facilita o acmulo de informaes a respeito dos clientes e
da oferta de servios que podem influenciar a demanda de clientes para propiciar-lhe
benefcios.
O <foco> pode criar vantagens competitivas significativas. Isto pode ser alcanado
pelo oferecimento de uma larga gama de servios voltados a um grupo limitado de
consumidores, de um "cardpio limitado" e focalizado de servios voltados a uma
ampla faixa de consumidores ou ainda de uma limitada gama de servios voltados a
um conjunto de consumidores extremamente especfico. (HESKETT, J. L.; SASSER
JR., W. E.; HART, C. W. L., 1994, p. 56.)
Nota Ele pode criar vantagens competitivas significativas a partir do oferecimento de uma
larga gama de servios voltados a um grupo limitado de consumidores, de um cardpio
limitado e focalizado de servios voltados a uma ampla faixa de consumidores ou
ainda de uma limitada gama de servios voltados a um conjunto de consumidores
extremamente especfico.

fornecedor sm
Fras. fornecedor aprovado; fornecedor assegurado; fornecedor bsico;
fornecedor certificado; fornecedor constante; fornecedor externo;
fornecedor homologado; fornecedor interno; fornecedor nico
Entidade, colaborador ou setor que fornece insumos como produtos, servios ou
informaes ao processo em questo.
Trata-se, aqui, de medir e analisar as disfunes que surgiram na relao entre
cliente e <fornecedor>, como os blocos de pedra no curso do rio que impedem o seu
bom escoamento. (TEBOUL, J., 1991, p. 120.)
Nota Ele pode ser de natureza externa ou interna e o responsvel pelos inputs necessrios
ao desempenho das atividades da organizao prestadora de servios e ao
desenvolvimento eficiente do produto.
Cf. input; processo





372


fornecedor de servio sm
Fras. fornecedor de servio revolucionrio
Entidade, colaborador ou setor que fornece insumos ao processo em questo.
Os sistemas e as condies de qualidade de possveis <fornecedores de servios> ou
produtos crticos podem ser avaliados por intermdio de uma equipe de pesquisa da
organizao compradora antes que os contratos sejam assinados e as amostras
avaliadas. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 384.)
Nota Ele pode ser de natureza interna ou externa.
Cf. processo

fornecimento de servio sm
Var. fornecimento do servio
Entrega ao cliente do servio adquirido em conformidade com os requisitos do pedido
de compra.
At o momento, assumimos que o <fornecimento de servios> era fixo, como
apresentado na Figura 8-2. Isto um caso raro. Os prestadores de servios criativos
encontraram muitos meios de administrar com antecedncia o <fornecimento do
servio> para padres de demanda previsveis ou no. (HESKETT, J. L.; SASSER
JR., W. E.; HART, C. W. L., 1994, p. 163.)
Nota Para o seu gerenciamento, pode ser adotada a estratgia de acompanhamento da
demanda, a estratgia de nivelamento da capacidade e o planejamento antecipado da
instalao.

franquia
Var. franqueamento
Conceito de financiamento no sentido mais amplo, onde h o uso do nome do
franqueador, gerenciado como extenses de uma estratgia de recursos humanos, para
atrair talentos incomuns e motivados para uma organizao ampliada.
O objetivo? Uma cobiada <franquia> do McDonald's, geralmente considerada a
mais lucrativa no setor de refeies rpidas. E um parceiro que conhecido por
proporcionar suporte connuo aos franqueados. Mesmo os detentores de
<franqueamentos> McDonald's que no tiveram sucesso elogiam o apoio recebido




373


pela empresa em tempos difceis. (HESKETT, J. L.; SASSER JR., W. E.; HART, C.
W. L., 1994, p. 222.)
Nota uma traduo do emprstimo do original ingls franchising.
Ela foi inicialmente desenvolvida em grande escala pelos fabricantes de automveis
dos Estados Unidos que, logo no incio de seu desenvolvimento, decidiram no vender
seus produtos e prestar servios de manuteno para os mesmos, concentrando seu
capital limitado no processo de manufatura de capital intensivo. Nos contratos de
franquias so exigidos, como retorno pelo uso do nome do franqueador, conceito de
servio, estratgia operacional, publicidade e assistncia gerencial como seleo da
localizao, programas de treinamento, manuais de operao e aconselhamento
contnuo.

funo sf
Conjunto de atividades que caracteriza um material, item, produto ou servio e serve a
um propsito til, atendendo a uma necessidade real do cliente ou usurio.
Suponhamos duas <funes> de uma mesma organizao, a de fabricao e a de
vendas. Quando vendas recebe os produtos da fbrica, vendas o cliente. O bom
desempenho de vendas depende de quo bem os produtos atendam s especificaes e
do cumprimento dos prazos de entrega compromissados. Fabricao, por sua vez,
cliente de vendas quando recebe daquela <funo> as previses de vendas, que so
elementos bsicos para seu bom planejamento e desempenho. (ALMEIDA, L. G.,
1995, p. 18.)
Cf. necessidade do cliente

funo de linha de frente sf
Var. funo de front office
Conjunto de atividades executadas em contato direto com os clientes, em atendimento
s expectativas e necessidades dos mesmos.
Os executivos de servios que se destacam precisam administrar a tenso entre
diferenciao e integrao. Eles encontram uma diversidade de formas de faz-lo. Isto
inclui esforos de focalizao em torno das <funes de linha de frente> ou <"front
office"> e de retaguarda ou "back office", ao mesmo tempo em que se procura meios




374


para coordenar as funes de marketing e de operaes, atravs de meios como
contratao de servios internos. (HESKETT, J. L.; SASSER JR., W. E.; HART, C.
W. L., 1994, p. 242.)
Nota Os especialistas tm utilizado as duas formas, a traduzida e o emprstimo, sem muitos
critrios.
Este conceito um desenvolvimento de um conceito anterior apresentado por
Wilckham Skinner denominado focalizao da fbrica, onde a argumentao d
conta de que servios personalizados, diferentes para cada cliente, exigem um
tipo de fbrica do tipo anlogo ao processo job shop da manufatura, e que
servios repetitivos, que envolvem pouco ou diferentes tipos de julgamentos,
deveriam ser realizados em alguma instalao que se assemelhasse mais a uma
linha de montagem.
Cf. expectativa do cliente; necessidade do cliente

funo de marketing sf
Conjunto de atividades humanas que facilita a realizao de trocas, situando-se no
mbito especfico de pelo menos duas partes que apresentaro algo considerado de
valor pela outra.
A <funo de marketing> no campo de servios emerge de forma natural da
concepo apresentada, a qual focaliza explicitamente aquilo que se entende como o
cerne de marketing: facilitar a realizao de trocas, entendidas no contexto amplo do
exposto at o presente. (TOLEDO, G. L., 1978, p. 17.)
Nota Ela est relacionada com a arte ou a tcnica de bem realizar as trocas.

funo mercadolgica sf
Conjunto de atividades por meio das quais se define requisitos que iro caracterizar o
produto/servio requerido pela necessidade do cliente.
A <funo mercadolgica> necessita definir o sistema de informao que lhe permita,
em base regular, obter informaes sobre o desempenho do produto ou servio.
(CERQUEIRA NETO, E. P. de, 1993, p. 66.)
Cf. necessidade do cliente





375


funo qualidade sf
Conjunto de atividades por meio das quais se atinge a adequao ao uso, em
atendimento s expectativas e necessidades dos clientes, no importa em que parte da
organizao as mesmas so executadas.
No caso da <funo qualidade>, a identificao de conceitos universais segue um
curso incerto. O conceito de inspeo e testes tem milhares de anos e representa o
conceito da medio. A aplicao de mtodos estatsticos <funo qualidade> um
fenmeno do sculo XX. Os esforos significativos para identificar os processos
administrativos inerentes <funo qualidade> no haviam surgido at a segunda
metade do sculo XX. (JURAN, J. M.; GRYMA, F. M., 1991, p. 17.)
Nota Ela se classifica em qualidade, garantia da qualidade, inspeo (verificao) e controle
da qualidade (preveno).
Cf. adequao ao uso; controle da qualidade; garantia da qualidade

funcionrio sm
Fras. funcionrio da interface; funcionrio da linha de frente; funcionrio de
servios; funcionrio interno
Indivduo que executa funes dentro de uma organizao.
Eles esto tratando cada ponto como se fosse uma causa especial e como se a reao
do <funcionrio> a cada feedback se constitusse num inevitvel aumento da
variabilidade originada pelo controle em excesso (veja Captulo 3).
(SCHERKENBACH, W. W., 1990, p. 52.)
Sin. colaborador; empregado
Cf. organizao

funcionrio potencializado sm
Indivduo que executa funes dentro de uma organizao com um grau de autonomia
para atender s necessidades e expectativas dos clientes, de forma responsvel onde a
autoridade seja compatvel com a responsabilidade.
<Funcionrios "potencializados"> procuraro, de imediato, resolver o problema do
cliente e encontrar a soluo para que ele no volte a ocorrer. Aquela velha questo
de que a "Responsabilidade no minha ou do meu departamento" termina quando as




376


pessoas esto potencializadas e conscientes da sua responsabilidade pela Qualidade
do processo de prestao de servios em toda a Organizao. (REIS, L. F. S. D.,
1998, p. 156.)
Cf. atender s necessidades do cliente; expectativa do cliente

grupo de sntese sm
Exame sistemtico, formal, abrangente e documentado de um projeto para avaliar os
requisitos da qualidade e as condies de atend-los, alm de identificar problemas e
propor medidas corretivas.
As revises do projeto, tambm chamadas <grupos de sntese> ou conferncias de
desenvolvimento, tm como objetivo submeter o projeto chegado a um certo estgio de
elaborao a uma anlise crtica de todas as suas funes para simplific-lo ou
destacar o mais cedo possvel os problemas em potencial, antes que os planos e
especificaes no se tornem definitivos. (TEBOUL, J., 1991, p. 127.)
Nota A auto-reviso do projeto no suficiente para garantir projeto apropriado, por isso a
reviso deve ser feita por profissionais de reas distintas.
Sin. conferncia de desenvolvimento; reviso do projeto
Cf. requisitos da qualidade

hardware sm
Conjunto de mquinas, equipamentos e material de que dispe uma organizao.
A tecnologia em um sentido mais amplo, que inclui o software assim como o
<hardware> e abrange mtodos e materiais, tem sido uma fora potente nas
estratgias competitivas de servios revolucionrios. Sua aplicao generalizada a
servios , entretanto, considerada por muitos como tendo produzido, algumas vezes,
resultados desapontadores e atualmente fonte de alguma auto-anlise. (HESKETT,
J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 197.)
Nota Emprstimo do ingls cuja traduo equipamento/material.








377


heterogeneidade sf
Fras. caracterstica da heterogeneidade
Carter inconstante da manuteno da qualidade caracterstico dos servios, que requer
um tratamento mercadolgico especial ao compar-lo com outras atividades de
marketing, pois os mesmos so produzidos por seres humanos.
A <heterogeneidade> refere-se impossibilidade de se manter a qualidade do servio
constante. Isto fcil de se concluir, pois como os servios so produzidos pelo ser
humano, que de natureza instvel, a qualidade da produo ser tambm instvel.
difcil manter uma empresa com o mesmo padro de qualidade. Em uma mesma
equipe pode haver diferenas devido capacidade diferenciada. (LAS CASAS, A. L.,
1999, p. 24.)
Nota uma das caractersticas do marketing de servios.
Cf. caractersticas do marketing de servios

homem de marketing sm
Fras. homem de marketing bancrio
Indivduo responsvel pelo planejamento, implantao e gerenciamento das
atividades de marketing em uma organizao.
A atuao do <homem de marketing> visa ao desenvolvimento de uma aliana entre
duas concepes aparentemente incompatveis. Marketing est interessado em
conhecer os interesses, preferncias, desejos e necessidades dos consumidores,
avaliados ao nvel de segmentos homognceos. A atividade bancria, por sua vez, est
voltada para aquelas relaes diretas entre dois "indivduos" (pessoas ou
organizaes), as quais se desenrolam em um contexto moral e psquico prprio e
visam avaliao de um risco associado a cada transao. (TOLEDO, G. L., 1978, p.
61.)
Sin. executivo de marketing
Cf. atividades de marketing








378


humanware sm
Conjunto dos recursos humanos de uma organizao.
O TQC comea pelo <humanware>. S depois que o <humanware> estiver
devidamente colocado que o hardware e o software do negcio devem ser
considerados. (IMAI, M., 1992, p. 37.)
Nota Emprstimo do ingls cuja traduo ser humano, mas possui uma forte ligao com
treinamento.

incerteza sf
Estgio confuso e descompromissado de uma organizao onde a gerncia no
considera a qualidade como um de seus instrumentos positivos e os problemas de no-
conformidade existem por falta de severidade.
Mas a melhoria da qualidade jamais far parte de uma companhia que esteja na era
da <Incerteza>. (...) As companhias da era da <Incerteza> sabem que tm
problemas, porm ignoram por qu - embora saibam que a razo no a falta de
trabalho rduo. Todos os que esto na <Incerteza> trabalham muito, e a maioria
sente-se frustrada devido ao volume de fora bruta necessrio para manter a
operao. (CROSBY, P. B., 1999, p. 44.)
Nota Sua origem creditada a Philip B. Crosby que, em sua obra de 1999, a caracteriza
como o primeiro estgio que compe o aferidor de maturidade da gerncia da
qualidade e mergulha a funo qualidade nas profundezas de um dos departamentos
operacionais.
Cf. aferidor de maturidade da gerncia da qualidade; funo qualidade; no-
conformidade

indstria de servios sf
Fras. indstria de prestao de servios; indstria de prestao de servios
individuais; indstria no-prestadora de servios
Parte interessada e dedicada execuo de tarefas que objetivam atender a terceiros
dentro ou fora de suas estruturas.
Algumas <indstrias de servios> no Japo engajaram-se na melhora da
produtividade a partir de 1950 (por exemplo as Ferrovias Nacionais Japonesas, a




379


Nippon Telegraph and Telephone Public Corporation, o Monoplio do Tabaco e os
Correios). (...) Tais economias de custos, repassadas para fabricantes e outras
<indstrias de servios>, ajudariam a indstria americana a expandir o mercado
para os produtos norte-americanos e, com o tempo, trariam novos negcios para as
empresas transportadoras. A maioria das <indstrias de servios> oferece:
(DEMING, W. E., 1990, p. 11 e 140.)
Sin. empresa de servios; organizao de servios
Cf. organizao

input sm
Fras. input do processo
Conjunto de meios materiais e informaes utilizados em um processo para a
produo de produtos/prestao de servios.
Na sua forma mais simples, um processo a mistura ou a transformao de <inputs>,
tais como pessoal, material, equipamentos, mtodos, e ambientes em resultados.
Alguns desses <inputs> fazem a transformao enquanto outros so transformados.
(SCHERKENBACH, W. W., 1990, p. 19.)
Nota Sua traduo do ingls entrada do processo, mas os especialistas no o utilizam
traduzido.
Em uma organizao comercial, muitos processos esto inter-relacionados e o produto
ou o servio de um processo o input de outro.
Cf. processo

instituio financeira sf
Pessoas fsicas ou jurdicas cuja atividade principal ou acessria consiste na coleta,
intermediao ou aplicao de recursos prprios ou de terceiros, em moeda nacional
ou estrangeira, e a custdia de valor de propriedades de terceiros.
Keyler Rocha afirma que, dentro de um conceito de <instituies financeiras> to
amplo, como o expresso pela Lei n. 4.595, incluindo at mesmo pessoas fsicas que
exeram qualquer atividade voltada para operaes de crdito, o nmero delas
certamente ser maior do que o apresentado na Figura 3.3. (TOLEDO, G. L., 1978,
p. 107.)




380


Sin. empresa financeira

instituir liderana v
Assumir um conjunto de caractersticas por parte da administrao, que vai do
carisma, simpatia at a vivncia dos aspectos administrativos, transformando o
administrador em lder.
A crtica prosseguia. Sobre <instituir liderana> (o stimo ponto), o empregado
informava a Stalnecker: "Sua soluo para todos os problemas que temos trazido
para as reunies tem sido mandar-nos ns mesmos descobrirmos os problemas ou
livrar-se de ns com evazivas. (WALTON, M., 1989, p. 246.)
Nota Constitui o stimo dos 14 princpios, mas anteriormente era melhorar a superviso.
Deming aceitou a sugesto de James Fitzpatrick, da General Motors Company.
Cf. 14 princpios; lder

instituir treinamento v
Conseguir que o colaborador compreenda plenamente o seu cargo, as polticas da
organizao e as necessidades de seus clientes e fornecedores.
A simples mudana nos sistemas da empresa no garante a melhoria contnua.
Precisamos <instituir treinamento> como compromisso para a formao dos
funcionrios. (SCHERKENBACH, W. W., 1990, p. 91.)
Nota Constitui o sexto dos 14 princpios e h uma diferena fundamental entre este e o 13:
este refere-se aos fundamentos do treinamento; o 13 refere-se ao aprimoramento
contnuo para todos.
Cf. 14 princpios

instrumentos de marketing sm
Conjunto de propriedades do marketing de servios que visa a atender as relaes de
troca em uma organizao.
Os servios, pelas suas caractersiticas diferenciadoras, tornam especfica a tarefa de
determinar a intensidade e a qualidade dos ingredientes que iro compor o programa
de marketing da empresa que os produz. Dentre os principais <instrumentos de
marketing> que esto sob o controle da empresa e que podem afetar a implantao e




381


a aceitao do servios pelo mercado, destacam-se os seguintes itens:
desenvolvimento do produto, pricing, distribuio, comunicao e venda pessoal.
(TOLEDO, G. L., 1978, p. 40.)
Nota Subdividem-se em desenvolvimento do produto, pricing, canal de distribuio,
comunicao com o pblico e venda pessoal.
Cf. canal de distribuio; comunicao com o pblico; desenvolvimento do produto;
pricing; venda pessoal

integrao sf
Fras. integrao estratgia
Colocao do servio sem emendas onde o cliente trata com um nico colaborador,
aparentemente capaz de colocar todos os recursos da organizao sua disposio.
Empresas de servios revolucionrios, como o Mark Twain Bancshares, atingem a
<integrao> da estratgia operacional e do sistema de prestao de servio atravs
de pessoas, polticas e instalaes que so cuidadosamente coordenadas para
complementarem-se umas s outras. (HESKETT, J. L.; SASSER JR., W. E.; HART,
C. W. L., 1994, p. 28.)
Nota um dos elementos integrativos da viso estratgica de servios e alcanada por
meio da seleo, desenvolvimento, motivao e controle de pessoal e projeto de
instalao.
Cf. elementos integrativos da viso estratgica de servios

interao sf
Fras. interao com a tecnologia; interao com o processo de realizao do
servio; interao com os funcionrios; interao com os outros clientes
Ao executada entre duas ou mais pessoas para a concretizao da prestao do
servio.
Um servio resulta de uma sucesso de momentos de verdade. Cada um desses
momentos feito de mltiplas <interaes>, difceis de serem controladas do
exterior. O funcionrio, por exemplo, mestre nico a bordo. Ele deve acertar de
primeiro e eventualmente fazer alguns ajustes durante a <interao>. Pois quando o
servio termina difcil voltar atrs para consert-lo. // S h <interao>, portanto,




382


quando h, pelo menos, envolvimento de uma pessoa com a outra. Essa <interao>
se torna mais efetiva medida que este envolvimento passa para o estgio de
comprometimento. Assim, duas pessoas em <interao> se aproximam para se
envolver, e, se envolvem para se comprometer. Muitas vezes se comprometem gerando
conflitos e controvrsias, que precisam ser administrados. (TEBOUL, J., 1991, p. 203.
// CERQUEIRA NETO, E. P. de, 1993, p. 33.)

interface sf
Fras. interface fornecedor-cliente interno
Local de interao entre entrega e consumao do servio.
Na verdade, qualquer que seja a transao realizada com um cliente, servio ou
produto manufaturado, sempre ser encontrada esta separao <interface>/suporte.
Entretanto, no caso de um servio, o tratamento do cliente realiza-se essencialmente
na <interface>, enquanto que no caso de um produto industrial, o papel de suporte da
fbrica, isto , do processo industrial separado do cliente, fundamental. (TEBOUL,
J., 1991, p. 198.)
Cf. interao

International Organization for Standardization sf
Sigla ISO
Organizao no-governamental responsvel pela auditoria e publicao de normas
tcnicas internacionais, alm de cri-las, com o objetivo de compatibilizar interesses
entre clientes e fornecedores e subsidiar contratos comerciais.
Por oportuno, esclarece-se que <ISO> significa <International Organization for
Standardization>, organizao que estabelece padres normativos internacionais. //
Justificando a deciso, o banco elaborou um texto intitulado Agora a vez das
agncias, em que se l: "Afinal, elas so locais em que a qualidade percebida de
forma mais visvel. (...) justamente por isso que a <ISO> est chegando Rede.
(CERQUEIRA NETO, E. P. de, 1993, p. 20. // ALMEIDA, R. C. de, 1998, p. 73.)
Nota A sigla ISO no um acrnimo, mas um prefixo derivado da palavra grega ISOS, que
significa igual. A traduo do ingls Organizao Internacional para Normalizao.
A sigla ISO utilizada em todo o mundo para denotar a International




383


Organization for Standardization, desta forma evitando-se uma abundncia de
acrnimos resultantes das tradues para diferentes lnguas. Ela foi criada em
1945 por 25 pases, entre eles o Brasil, que tem na Associao Brasileira de
Normas Tcnicas (ABNT) sua representao, e est sediada em Genebra, Sua.
um desdobramento do International Electrotechnical Commitee (IEC),
fundado em 1910.
Cf. Associao Brasileira de Normas Tcnicas (ABNT)

item de demanda dependente sm
Objeto ou quantidade cuja demanda depende da demanda de outro item de estoque do
sistema de operaes.
Conforme j foi discutido, para <itens de demanda dependente> o consumo no
precisa ser previsto, mas pode ser calculado. Este clculo feito a partir do consumo
do item do qual o item estudado depende. (GIANESI, I. G. N.; CORRA, H. L., 1996,
p. 192.)
Cf. sistema de operaes

item de demanda independente sm
Objeto ou quantidade cuja demanda no depende da demanda de nenhum outro item
de estoque do sistema de operaes.
O consumo de sangue nos hospitais, em geral, pode ser de dois tipos: aquele para
consumo emergencial (caso de acidentes com grande perda de sangue pelas vtimas),
que podemos considerar como <item de demanda independente>, pois sujeito
influncia dominante de fatores aleatrios, e aquele para consumo em cirurgias
programadas com antecedncia. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 192.)
Cf. sistema de operaes

lder sm
Fras. lder da qualidade; lder do time da qualidade
Indivduo capaz de influenciar outros a se dedicarem inteiramente, em suas
atribuies, satisfao dos clientes.
Vencido este obstculo, as pessoas comearam a discutir o que fazer com relao aos




384


problemas. Surgiram <lderes> para que eles se vissem menos como chefes e mais
como <lderes> que estavam ali para ajudar os empregados a fazer o trabalho,
conforme sugeriu o Dr. Deming. (WALTON, M., 1989, p. 228.)
Cf. satisfao do cliente

liderana sf
Fras. liderana corporativa; liderana estratgica da empresa; nvel de liderana
Capacidade de um indivduo em criar condies e compartilhar com todos os
benefcios e as conseqncias das realizaes de um grupo, por meio de informaes
compactuadas e transmitidas por toda a organizao.
Reunidos sob a <liderana> de um dos membros, eleito pelo prprio grupo, os
integrantes dos Crculos identificam os temas ou problemas que gostariam de estudar
e os submetem apreciao de seu gerente imediato. (CERQUEIRA NETO, E. P. de,
1993, p. 13.)

lista de conferncia sf
Documento que facilita a coleta de informaes e fornece dados que sero acumulados
para uma possvel anlise posterior.
A finalidade bsica de uma Lista de Verificao, tambm conhecida como <lista de
conferncia> ou lista de controle, facilitar a coleta de informaes e fornecer dados
que sero acumulados para uma possvel anlise posterior. (SCHERKENBACH, W.
W., 1990, p. 114.)
Nota A maior limitao de sua utilizao que, muitas vezes, o que no foi listado
passa desapercebido.
Sin. checklist; lista de controle; lista de verificao

lista de controle sf
Documento que facilita a coleta de informaes e fornece dados que sero acumulados
para uma possvel anlise posterior.
A finalidade bsica de uma Lista de Verificao, tambm conhecida como lista de
conferncia ou <lista de controle>, facilitar a coleta de informaes e fornecer
dados que sero acumulados para uma possvel anlise posterior.




385


(SCHERKENBACH, W. W., 1990, p. 114.)
Nota A maior limitao de sua utilizao que, muitas vezes, o que no foi listado passa
desapercebido.
Sin. checklist; lista de conferncia; lista de verificao

lista de verificao sf
Fras. lista de verificao das atividades
Documento que facilita a coleta de informaes e fornece dados que sero acumulados
para uma possvel anlise posterior.
Os benefcios do uso de checklist - <listas de verificao> abaixo citados foram
retirados de um curso dado pela Ford Motor Company intitulado "Um sistema para
estabelecimento da preveno de defeitos e uso de ferramentas para identificao de
problemas. (SCHERKENBACH, W. W., 1990, p. 114.)
Nota A maior limitao de sua utilizao que, muitas vezes, o que no foi listado passa
desapercebido.
Sin. checklist; lista de conferncia; lista de controle

macromarketing sm
Conjunto sistemtico que tem por objetivo abranger toda a atividade de marketing,
bem como o desempenho global do sistema econmico de uma nao.
No mbito do <macromarketing>, a indagao mais importante refere-se a quem
toma as decises. No caso de economias socialistas, as principais decises, bem como
algumas de nvel secundrio, so emanadas de uma entidade planejadora central. Nas
economias baseadas no regime de livre iniciativa, as atividades econmicas so
dirigidas pelo mercado, desaparecendo a figura do planejador central, embora o
Governo possa assumir, atravs de vrios artifcios e dispositivos fiscais e legais,
como o controle da taxa de juros e da oferta de dinheiro, um papel de destaque,
direcionando a economia. (TOLEDO, G. L., 1978, p. 97.)
Nota um dos nveis do sistema de marketing, segundo esclareceu E. Jerome McCarthy em
sua obra Basic Marketing. A Managerial Approach de 1971.
Cf. atividades de marketing; sistema de marketing





386


manual da qualidade sm
Sigla MQ
Fras. manual da qualidade do fabricante; manual da qualidade do fornecedor
Documento que enuncia o sistema da qualidade de uma organizao, especificando a
poltica, diretrizes, atribuies, responsabilidades e procedimentos adotados para a
execuo de todas as atividades que possam influenciar a qualidade, bem como as
formas de controle.
Os instrumentos para a traduo dos produtos administrativos consistem basicamente
no glossrio, na padronizao e no sistema de medio e freqentemente so reunidos
e publicados no <manual da qualidade>. (JURAN, J. M.; GRYNA, F. M., 1991, p.
188, (v. I).)
Nota Diretrizes sobre manuais da qualidade so dadas na Norma ISO 10013 (CNBR ISO
10013). Ele deve conter a poltica da qualidade, os objetivos da qualidade, a estrutura
e responsabilidade da organizao, a descrio do sistema da qualidade, as prticas da
qualidade e a estrutura e distribuio do sistema da qualidade.
Cf. poltica da qualidade; sistema da qualidade (SQ)

mapa de desenvolvimento do produto sm
Ferramenta estruturada para desenvolvimento de produtos/servios e orientada para
uma linha completa dentro de um ciclo de vida.
fcil pensar num possvel <mapa de desenvolvimento do produto> para uma
empresa de saneamento: o negcio principal o lixo residencial. Um servio
melhorado o manejo de lixo industrial para clientes comerciais. Os servios
customizados abrem perspectivas em vrias direes: aterros, reciclagem, lixo
hospitalar, lixo qumico e emisses gasosas, por exemplo. (SCHONBERGER, R. J.,
1992, p. 231.)
Nota uma traduo do emprstimo do original ingls product development maping.
Sua origem creditada a Steven C. Wheelwright e W. Earl Sasser que publicaram um
estudo na Harvard Business Review em maio-junho de 1988.
Cf. ciclo de vida do produto






387


mapa perceptivo sm
Conjunto de impresses que o cliente possui, organizado com o passar dos anos e
resultante da cultura e das experincias vividas, que atuar decisivamente na escolha
da prestao de servios da organizao.
Este <mapa perceptivo> apresenta uma geografia especfica e, como a gua que se
junta no vale corre para o rio, as impresses que temos correm de acordo com certos
esquemas adquiridos, segundo uma geografia traada pela experincia. O <mapa
perceptivo> tem uma funo de filtro que deve ser conhecido e levado em
considerao. (TEBOUL, J., 1991, p. 216.)
Nota Possui uma funo de filtro que definir a opo pelo servio prestado por essa ou
aquela organizao.
Cf. cliente; organizao de servios; prestao de servios

mass customized sm
Atividade caracterizada pela padronizao e eficincia, mas que pode atender tambm
a necessidades especficas dos usurios.
A expresso <mass customized>, embora aparentemente contraditria, significa, para
os autores, um sistema de servios em que os servios de rotina so padronizados e
produzidos com eficincia, mas atendem, tambm, a necessidades especficas dos
usurios. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 28.)
Nota Emprstimo do ingls cuja traduo cliente de massa, mas utilizado apenas no
original pelos especialistas.

memria social sf
Capacidade de uma sociedade em lembrar-se de qual grupo foi mais flexvel no
passado e qual foi mais irredutvel, procurando satisfazer seus prprios interesses, do
ponto de vista econmico-social.
Somente com uma forte <memria social>, visvel e confivel, que os cidados de
uma democracia se submetero a um processo de escolha social. E apenas com uma
escolha social que uma nao pode concentrar seus esforos para resolver
problemas econmico-sociais e, em adio, alcanar o sucesso. , precisamente, esta
capacidade de concentrao que possibilita o desenvolvimento da empresa M e que




388


poder vir a ser aplicado para se obter uma sociedade M. (OUCHI, W. G., 1985, p.
29.)

mercado sm
Fras. mercado de capitais; mercado de crdito; mercado de dinheiro; mercado de
investimentos; mercado financeiro; mercado financeiro internacional
Conjunto de pessoas ou organizaes com necessidades a serem satisfeitas, poder
aquisitivo e desejo comportamental de compra e de uso, que oferece ou procura
produtos/servios e determina o surgimento e as condies dessa relao.
Como se pode notar, na essncia dessa concepo de <mercado> encontra-se o
carter econmico de marketing, cuja origem, como disciplina, remonta s Cincias
Econmicas. As principais influncias do ambiente econmico sobre o marketing
bancrio referem-se ao status econmico dos clientes, ao tipo de concorrncia e
poltica credifcia do Governo, embora esse ltimo aspecto pudesse ser considerado
igualmente em um contexto de ambiente poltico e legal. (TOLEDO, G. L., 1978, p.
101.)

mercado de consumo sm
Conjunto de pessoas ou organizaes com necessidades a serem satisfeitas, poder
aquisitivo e desejo comportamental de compra e de uso, que compra produtos/servios
para consumo prprio ou de suas residncias.
No <mercado de consumo>, dois personagens principais esto presentes no processo
de compra de servios: o usurio, aquele que vai consumir o servio propriamente, e
o decisor, aquele que toma a deciso do processo de compra. Em muitos casos, talvez
na maioria, os dois personagens so incorporados por uma mesma pessoa.
(GIANESI, I. G. N.; CORRA, H. L., 1996, p. 66.)










389


mercado de servios sm
Var. mercado para servios
Conjunto de pessoas ou organizaes que oferece ou procura bens/servios/capitais e
determina o surgimento e as condies dessa relao com base nos desejos e nas
necessidades dos segmentos que pretende servir.
Muitas empresas tm alcanado sucesso no desempenho de suas atividades atravs de
uma definio ampla de seus mercados, alicerada fundamentalmente nos desejos e
nas necessidades dos segmentos que pretendem servir. Com relao ao <mercado de
servios>, tal concepo parece ser muito mais oportuna. Um <mercado para
servios> pode estar associado, por conseguinte, a um conjunto de desejos e
necessidades humanas suficientemente homogneo e que pode ser satisfeito por uma
oferta de servios definida. (TOLEDO, G. L., 1978, p. 38.)
Nota O aforismo consagrado de que mercado so pessoas d lugar, nessa concepo, a uma
definio estabelecida a partir das necessidades e desejos humanos e no propriamente
da tica e dimenso dos servios, que passam a ser interpretados como mecanismos
facilitadores.

mercado potencial sm
Conjunto de pessoas ou organizaes aptas a receber bens/servios/capitais que
respondam a seus desejos e necessidades.
O banco precisa saber, em primeiro lugar, qual o <mercado potencial> para o
servio proposto, bem como sua provvel parcela de participao nesse mercado.
indispensvel ainda que analise os custos em que incorrer para desempenhar o
servio, e at que ponto a compra desse servio conduzir o cliente demanda de
outros servios do banco. (TOLEDO, G. L., 1978, p. 73.)

meta sf
Fras. meta da qualidade
Valor definido do objetivo a ser atingido em um prazo determinado ao longo do
tempo.
A <meta> da qualidade a quantificao do objetivo da qualidade, respondeu Dr.
Carlos, que aquilo que a empresa deseja alcanar. Como, por exemplo, vamos supor




390


que, em funo da estratgia estabelecida, seja definido como um objetivo do Atacado
So Jorge o de alcanar uma expanso do faturamento real de 30% nos prximos trs
anos. A <meta> para o primeiro ano ser crescer 8% reais acima das vendas deste
ano; para o segundo ano a expanso ser de 10%; e 12% para o terceiro ano.
(FISCHMANN, A. A.; ALMEIDA, M. I. R. de, 1991, p. 23.)
Cf. objetivo da qualidade

micromarketing sm
Conjunto sistemtico que tem por objetivo abranger as organizaes, individualmente
consideradas no contexto do sistema econmico do pas onde atua e expostas a uma
srie de restries a seu livre funcionamento, geradas por esse ambiente no qual elas
exercem suas atividades.
No nvel micro - <micromarketing> - encontram-se as empresas, individualmente
consideradas no contexto do sistema econmico e expostas a uma srie de restries a
seu livre funcionamento, restries essas geradas em um ambiente no seio do qual
elas exercem suas atividades. A empresa constitui um subsistema dentro do sistema de
marketing de uma economia. (TOLEDO, G. L., 1978, p. 98.)
Nota um dos nveis do sistema de marketing, segundo esclareceu E. Jerome McCarthy em
sua obra Basic Marketing. A Managerial Approach de 1971.
Cf. sistema de marketing

misso da empresa sf
Linha de ao comum de uma organizao que une seus programas e atividades tendo
em vista o compromisso e o dever da mesma para com a sociedade.
Os empresrios japoneses esto firmemente convencidos de que a <misso da
empresa> principalmente fazer produtos de qualidade que satisfaam as
necessidades do mercado. (IMAI, M., 1992, p. 85.)
Nota Est definida nos documentos legais que regem a organizao e, em particular, em
seus estatutos sociais, auxiliando e orientando o esforo de todos na mesma.







391


misso do servio sm
Hierarquia de eventos utilizada na criao de um novo modelo de prestao de servio
e sua colocao no mercado, constituindo a definio daquilo que o sistema de
operaes tem que realizar para atingir a excelncia.
A definio da <misso do servio> dependente das decises a respeito de qual
segmento de mercado se pretende atender e como a empresa deseja posicionar-se
frente a seus concorrentes, aos olhos de seus consumidores. A definio da misso ou
conceito de servio, portanto, subordinada estratgia competitiva. (GIANESI, I.
G. N.; CORRA, H. L., 1996, p. 106.)
Nota um dos elementos bsicos da viso estratgica de servios e definido em termos
dos resultados alcanados pelos consumidores.
Sin. conceito de servio
Cf. elementos bsicos da viso estratgica de servios; sistema de operaes

modelo das cinco falhas sm
Var. 5 gaps
Paradigma utilizado na anlise das falhas da qualidade em servios.
Um dos mais consistentes trabalhos feitos em termos de qualidade para servios
devido a trs pesquisadores americanos que desenvolveram o modelo chamado de
<"5 gaps">. J foi discutido que a qualidade em servios dada pela comparao
entre a percepo do cliente quanto ao servio prestado e a expectativa que ele tinha,
previamente, quanto ao servio. Se o nvel de percepo estiver aqum do nvel de
expectativa, o cliente levar a impresso de um servio de baixa qualidade e o
<modelo das cinco falhas> poder ser imprescindvel para remov-la. (GIANESI, I.
G. N.; CORRA, H. L., 1996, p. 202.)
Nota Sua origem creditada a V. A. Zeithaml, A. Parasuraman e L. L. Berry,
pesquisadores americanos, que o criaram em 1990 e o apresentaram na obra
Delivering service quality: balancing customers perceptions and experctations.
So elas: falha na comparao expectativa do consumidor-percepo gerencial
(GAP 1), falha na comparao percepo gerencial-especificao da qualidade
do servio (GAP 2), falha na comparao especificao do servio-prestao do
servio (GAP 3), falha na comparao prestao do servio-comunicao




392


externa com o cliente (GAP 4) e falha na comparao expectativa do cliente-
percepo do cliente (GAP 5).
Cf. qualidade do servio

motivao extrnseca sf
Submisso a foras externas que neutralizam a motivao inata em busca de
recompensas numricas.
No trabalho, o prazer de trabalhar, a capacidade de inovar passam a ser secundrios
em relao obteno de uma boa avaliao. Quando se est sob o domnio da
<motivao extrnseca>, a pessoa governada por foras externas. (DEMING, W.
E., 1990, p. XXIII.)

motivao intrnseca sf
Necessidade inata de auto-estima e respeito que auxilia na aprendizagem e
inovao de um processo.
Os administradores que negam a seus empregados dignidade e auto-estima abafaro
a <motivao intrnseca>. (DEMING, W. E., 1990, p. XXIII.)

multiplicador sm
Colaborador treinado para disseminar os conceitos e tcnicas da qualidade, assim
como a poltica e as estratgias da organizao.
O comit de pilotagem tem uma funo de guia, de iniciador, de maestro. Ele
participa portanto da definio das polticas adaptadas empresa, para acompanhar
a mudana. Por exemplo: (...) Quem o responsvel pelo grupo de progresso, o chefe
hierrquico, ou um <"multiplicador">, com formao em mtodos estatsticos e em
dinmica de grupo? (TEBOUL, J., 1991, p. 154.)
Nota Suas reas de atuao compreendem assistncia no planejamento e
compatibilizao de atividades no conselho da qualidade, facilitao e suporte
nas reunies dos times da qualidade, participao em programas de
sensibilizao e motivacionais, educao e treinamento, comunicao vertical e
horizontal e programas de participao de colaboradores.
Sin. facilitador




393


Cf. conselho da qualidade; time da qualidade

necessidade do cliente sf
Expectativa e desejo do cliente em relao a um servio/produto que devem ser
atendidos, como princpio bsico do sistema da qualidade e ponto de partida para se
alcanar a excelncia.
No podemos ser competitivos nos mercados internacionais, a menos que possamos
definir operacionalmente as <necessidades dos clientes>. (SCHERKENBACH, W.
W., 1990, p. 3.)
Nota Manifesta-se nas dimenses de valor ou utilidade, urgncia, forma em que prefere ter
atendida a sua necessidade e capacidade de compra.
Cf. sistema da qualidade (SQ)

norma ISO 9000 sf
Sigla ISO 9000
Fras. ISO srie 9000; normas da srie ISO 9000
Srie de cinco normas internacionais que atuam como modelo para a aplicabilidade
das demais normas, acrescida de algumas definies e conceitos norteadores da srie.
No Brasil, as <normas ISO 9000> j se apresentam traduzidas e constituem a srie
NBR 19000, segundo registro do Instituto Nacional de Metrologia, Normalizao e
Qualidade Industrial (Inmetro). (CERQUEIRA NETO, E. P. de, 1993, p. 96.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Foi criada em 1979, oficialmente publicada em 1987 como Normas ISO Srie
9000, por meio do Technical Committee 176 da ISO, no mundo e, em junho de
1990, foi traduzida e publicada pela ABNT, no Brasil, com o nmero NB/ISO
9000 e registrada no Instituto Nacional de Metrologia, Normalizao e
Qualidade Industrial (Inmetro) com o nmero NBR 19000. Aps a reviso de
1994, no Brasil, a srie ficou composta por cinco normas, mas ela a de
orientao quanto aplicabilidade das demais, e recebeu a denominao tcnica
de ABNT NBR/ISO 9000, Normas de gesto da qualidade e garantia da
qualidade - diretrizes para seleo e uso, com publicao em 1995 e validade




394


at o ano de 2000, quando foi revisada e substituda pela ISO 9000 : 2000 -
Fundamentos e vocabulrio de sistemas de gesto da qualidade -, que cancelou e
substituiu a ISO 8402, a ISO 9000-1 e a ISO 9000-2.
Cf. International Organization for Standardization (ISO)

norma ISO 9001 sf
Sigla ISO 9001
Norma internacional cuja utilizao entre as partes contratantes se dar quando o nvel
de conformidade com os requisitos exigidos pelo cliente tiver necessidade de uma
amplitude de garantia por parte do fornecedor nos estgios de projeto, manufatura,
instalaes e servios associados.
Imagine uma empresa de servios no ramo da construo civil que projeta um
edifcio, o constri e garante a Qualidade ps-venda. Essa construtora, por exemplo,
encaixa-se no modelo da <norma ISO 9001>. (BARROS, C. D'A. C., 1999, p. 115.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Foi criada em 1979, oficialmente publicada em 1987 como Norma ISO 9001 no
mundo e, em 1990, no Brasil, sob o ttulo Sistema da qualidade - modelo para garantia
da qualidade em projetos/desenvolvimento, produo, instalaes e servios
associados, e, juntamente com as normas ISO 9002 e ISO 9003, atende
especificamente ao elemento relao contratual, levando-se em conta a capacidade
organizacional de um fornecedor de bens/servios. Aps sete anos, foi emitida uma
nova verso conhecida como ISO 9001 : 2000 - Requisitos de sistema de gesto da
qualidade -, que cancelou e substituiu a ISO 9001, a ISO 9002 e a ISO 9003, passando
a ser a nica certificadora no sentido de gerar contratos.
Cf. International Organization for Standardization (ISO)










395


norma ISO 9002 sf
Sigla ISO 9002
Norma internacional cuja utilizao entre as partes contratantes se dar quando o nvel
de conformidade com os requisitos exigidos pelo cliente tiver necessidade de uma
amplitude de garantia por parte do fornecedor nos estgios de manufatura, instalaes
e servios associados.
A <norma ISO 9002>, modelo de norma da srie ISO 9000, a que mais se adequa
maioria das organizaes de servios como, por exemplo, revendedores de produtos
j concebidos, comercializadoras de bens e/ou informaes, etc. (BARROS, C. D'A.
C., 1999, p. 115.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Foi criada em 1979, oficialmente publicada em 1987 como Norma ISO 9002 no
mundo e, em 1990, no Brasil, sob o ttulo Sistema da qualidade - modelo para garantia
da qualidade em produo, instalaes e servios associados, e, juntamente com as
normas ISO 9001 e 9003, atende especificamente ao elemento relao contratual,
levando-se em conta a capacidade organizacional de um fornecedor de bens/servios.
Aps sete anos, foi emitida uma nova verso conhecida como ISO 9001 : 2000 -
Requisitos de sistema de gesto da qualidade -, que cancelou e substituiu a ISO 9001,
a ISO 9002 e a ISO 9003, passando a ser a nica certificadora no sentido de gerar
contratos.
Cf. International Organization for Standardization (ISO)

norma ISO 9003 sf
Sigla ISO 9003
Norma internacional cuja utilizao entre as partes contratantes se dar quando o nvel
de conformidade com os requisitos exigidos pelo cliente tiver necessidade de uma
amplitude de garantia por parte do fornecedor nos estgios de inspeo e ensaios finais
dos produtos/servios.
Um exemplo tpico da aplicao da <norma ISO 9003> a certificao de empresas
de servios tipo embaladoras que apenas manipulam produtos, embalagens e
distribuio. Para seleo do mdulo apropriado de garantia da qualidade (ISO




396


9001, 9002 ou 9003), a fonte de consulta sempre a norma-guia (ISO 9000).
(BARROS, C. D'A. C., 1999, p. 115.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Foi criada em 1979, oficialmente publicada em 1987 como Norma ISO 9003 no
mundo e, em 1990, no Brasil, sob o ttulo Sistema da qualidade - modelo para garantia
da qualidade em inspeo e ensaios finais, e, juntamente com as normas ISO 9001 e
9002, atende especificamente ao elemento relao contratual, levando-se em conta a
capacidade organizacional de um fornecedor de bens/servios. Aps sete anos, foi
emitida uma nova verso conhecida como ISO 9001 : 2000 - Requisitos de sistema de
gesto da qualidade -, que cancelou e substituiu a ISO 9001, a ISO 9002 e a ISO 9003,
passando a ser a nica certificadora no sentido de gerar contratos.
Cf. International Organization for Standardization (ISO)

norma ISO 9004 sf
Sigla ISO 9004
Norma internacional que aborda a diretriz do sistema de gesto da qualidade a ser
adotado pela organizao e o referencial na estruturao da metodologia, por meio
dos elementos do sistema da qualidade que garantir o mximo de eficcia no
atendimento s expectativas do cliente.
A organizao justifica a existncia de um guia deste para o desenvolvimento das
empresas devido necessidade e reconhecimento cada vez maior da qualidade e
satisfao do cliente. Por isso, esta parte da <norma ISO 9004> se preocupa em
transmitir os aspectos de administrao de maneira eficiente para atingir estes
objetivos. (LAS CASAS, A. L., 1999, p. 146.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Foi criada em 1979, oficialmente publicada em 1987 como Norma ISO 9004 no
mundo e, em 1990, no Brasil, sob o ttulo Gesto da qualidade e elementos do sistema
da qualidade - diretrizes. Aps sete anos, foi emitida uma nova verso conhecida como
ISO 9004 : 2000 - Diretrizes para melhoria do desempenho da organizao e
satisfao dos clientes e das outras partes interessadas -, que cancelou e substituiu a




397


ISO 9004-1, a ISO 9004-2 e a ISO 9004-3.
Cf. International Organization for Standardization (ISO)

norma ISO 9004-2 sf
Sigla ISO 9004-2
Fras. norma ISO 9004-2 (Servios)
Norma internacional que se baseia nos princpios da norma original, porm
enfatizando a realidade no contexto dos servios, e o referencial na estruturao da
metodologia, por meio dos elementos do sistema da qualidade que garantir o mximo
de eficcia no atendimento aos elementos do marketing e entrega do servio.
Inicialmente, o Banco A aplicou as diretrizes <norma ISO 9004-2>, estabelecendo,
assim, um Sistema de Gesto da Qualidade. A partir da, passou fase de definio
das prioridades. Que unidades deveriam ter seus processos padronizados de modo a
constituir Sistemas de Garantia da Qualidade? Definida a primeira, foram ouvidos os
funcionrios a ser envolvidos no esforo. (ALMEIDA, R. C. de, 1998, p. 56.)
Nota A sigla corresponde a International Organization for Standardization cuja traduo
Organizao Internacional para Normalizao.
Sua primeira edio foi publicada em 1991 no Brasil, sob o ttulo Gesto da qualidade
e elementos do sistema da qualidade - parte 2 - diretrizes para servios, oferecendo os
parmetros bsicos e especficos para servios no estabelecimento e adoo de um
sistema da qualidade em uma organizao. Aps sete anos, foi emitida uma nova
verso conhecida como ISO 9004 : 2000 - Diretrizes para melhoria do desempenho da
organizao e satisfao dos clientes e das outras partes interessadas -, que cancelou e
substituiu a ISO 9004-1, a ISO 9004-2 e a ISO 9004-3.
Cf. International Organization for Standardization (ISO)

nova filosofia sf
Fras. nova filosofia de gesto
Nmero total de idias que consubstancia a essncia da filosofia de Deming e aplica-
se a qualquer tipo de organizao, tanto na indstria de manufaturados quanto na de
servios, com aceitao universal.
necessrio uma boa sacudidela para que as pessoas compreendam que a velha




398


filosofia no adequada a esta nova era econmica, e uma sacudidela ainda mais
forte para convenc-las a aceitarem a <nova filosofia>. As pessoas so iguais em
todo o mundo. preciso uma calamidade para chamar a sua ateno. (...) Mesmo
assim, o aprendizado supersticioso leva algum tempo para ser desfeito e substitudo
pela <nova filosofia>.(SCHERKENBACH, W. W., 1990, p. 11.)
Nota Iniciou-se por dez princpios em 1930 e o autor continuou aperfeioando-os at
alcanar o nmero atual de quatorze.
Sin. 14 princpios; filosofia Deming; quatorze pontos de Deming
Cf. adotar a nova filosofia; aperfeioar o sistema; cessar a aprovao de oramento
com base no preo; criar constncia de propsito; eliminar a necessidade de
inspeo em massa; eliminar as barreiras entre os departamentos; eliminar
lemas, exortaes e metas; eliminar o medo; eliminar padres de trabalho;
engajar todos na realizao da transformao; instituir liderana; instituir
treinamento; instituir programa de educao e retreinamento; remover as
barreiras ao orgulho da execuo

objetivo da qualidade sm
Var. objetivo de qualidade
Fras. objetivos corporativos da qualidade; objetivo estratgico da qualidade
Documento que enuncia os resultados a serem atingidos em relao qualidade, em
um perodo de tempo previamente estabelecido.
A partir de uma longa experincia, desenvolvemos uma lista dos critrios a serem
seguidos por aqueles que estabelecem os <objetivos da qualidade>. // Para obter
<objetivos de qualidade>, a administrao deve estabelecer uma estrutura de
qualidade para o efetivo controle, avaliao e melhoria do servio em todos os
estgios da prestao dos servios. (JURAN, J. M.; GRYNA, F. M., 1991, p. 162, (v.
I). // LAS CASAS, A. L., 1999, p. 150.)
Nota O planejamento o fator prepoderante na implantao da GQT, por isso deve ter
definido os objetivos da qualidade a serem alcanados como resultados de aes. A
partir de Juran, passou a ter uma nfase notvel nos processos pois uma de suas
virtudes maiores foi reduzir o tempo total, j que com o planejamento elimina-se fases
operacionais ou redundantes.




399


Cf. gesto pela qualidade total (GQT); qualidade

organizao sf
Fras. organizao piramidal
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir de insumos recebidos de fornecedores e
beneficiados/manufaturados com recursos humanos e tecnolgicos.
Se os gerentes estiverem preocupados basicamente com os lucros imediatos, eles
relutaro em dedicar tempo e esforos para o melhoramento da cultura e, a longo
prazo, a <organizao> pode deixar de ser competitiva. (IMAI, M., 1992, p. 203.)
Sin. companhia; empresa
Cf. atender s necessidades do cliente; fornecedor

organizao de classe universal sf
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir de um enfoque no cliente ou no processo.
A instabilidade e tumulto provocados pela reorganizao contnua, de efeito menor ou
maior, no so benficos. As organizaes rgidas tambm no so boas. A
<organizao de classe universal> fluida, mas tem um enfoque constante nos
clientes e produtos. (SCHONBERGER, R. J., 1992, p. 63.)
Sin. empresa de classe mundial
Cf. atender s necessidades do cliente

organizao de qualidade total sf
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo, geradas a partir dos 14 princpios de Deming.
Nosso objetivo construir uma <organizao de qualidade total> - onde seja
proveitoso trabalhar, investir, comprar ou vender, e a qual bom ter em nossa
comunidade. Ter uma organizao certinha no cria automaticamente a qualidade
total, mas mesmo assim algo essencial. (SCHONBERGER, R. J., 1992, p. 63.)
Cf. 14 princpios; necessidade do cliente





400


organizao de servios sf
Fras. organizao eficaz de prestao de servios; organizao prestadora de servios
Parte interessada e dedicada execuo de tarefas que objetivam atender a terceiros
dentro ou fora de suas estruturas.
Nmeros publicados pelo censo mostram que de cada 100 pessoas, 75 esto
empregadas em <organizaes de servios>. Se somarmos a este nmero as pessoas
empregadas nas indstrias e que esto envolvidas com servios, veremos que de cada
100 pessoas, 86 esto envolvidas com servios, deixando apenas 14 para fabricar
coisas que podemos dirigir, usar, usar mal, derrubar ou quebrar, e essas 14 incluem a
agricultura - alimentos, frutas, algodo e tabaco. (DEMING, W. E., 1990, p.137.)
Sin. empresa de servios; indstria de servios
Cf. organizao

organizao fornecedora sf
Parte interessada em atender s necessidades dos clientes, por meio da prestao de
servios/produo.
A responsabilidade bsica de satisfazer os padres de qualidade do comprador fica a
cargo da <organizao fornecedora>. Porm, a pesquisa ou auditoria da qualidade
observada dos produtos ou servios entregues pode revelar falhas nos sistemas de
qualidade do fornecedor. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 384.)
Cf. atender s necessidades do cliente

organizao holding sf
Var. organizao H
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir da constituio do capital exclusivamente de aes de outras
organizaes e de todos os aspectos da administrao estratgica, que so assim por
ela controlada e cujo controle a sua nica atividade.
O aspecto crtico da <organizao holding> ou <organizao H> que as unidades
operativas no so relacionadas quanto espcie de negcio. Isto , a empresa de
aluguel de automveis e a de cosmticos no tm fbricas, fora de vendas,
laboratrios ou qualquer outra coisa em comum. (OUCHI, W. G., 1985, p. 38.)




401


Nota O emprstimo holding j se encontra lexicalizado tanto de forma como de sentido, e
sua traduo corporativo.
A gerncia pequena e mantm controle financeiro somente sobre as unidades
operativas.

organizao multidivisionria sf
Var. organizao M
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir do equilbrio entre o esforo individual e o trabalho em equipe.
A <organizao multidivisionria> ou <organizao M> ter sucesso somente se
mantiver seu equilbrio. Os esforos individuais dos chefes de diviso no devero ser
contidos, porm eles devem ser um clima mais colaborativo do que antagnico para
as operaes. Mas a colaborao jamais deve tornar-se dominante, porque, do
contrrio, as vantagens da autonomia e do individualismo se perdero e a
organizao degenerar em uma pesada burocracia. (OUCHI, W. G., 1985, p. 38.)
Nota Seu desenvolvimento ocorreu nos ltimos cinqenta anos na Europa Ocidental e nos
Estados Unidos, tendo sido descrita em detalhes pelo historiador da Universidade de
Harvard, Alfred Chandler Jr.
Cf. atender s necessidades do cliente

organizao por funes sf
Var. organizao funcional
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir de insumos recebidos de fornecedores e beneficiados com recursos
humanos e tecnolgicos onde os diversos cargos so determinados de acordo com as
atividades desempenhadas pelos colaboradores.
A <organizao por funes>, apesar de ser a mais usada devido ao tamanho das
empresas brasileiras, tem certas limitaes quanto sua aplicao. Organizaes que
crescem e se sofisticam, ampliando os servios oferecidos ao mercado, tendem a
relegar certos itens a um segundo plano. Muitas vezes, esses servios, do ponto de
vista mercadolgico, apresentam potencial de crescimento futuro. // A forma mais
familiar de organizao a U, mais comumente conhecida como <organizao




402


funcional>. Uma estrutura U simples pode ser retratada da seguinte maneira: (LAS
CASAS, A. L., 2000, p. 177. // OUCHI, W. G., 1985, p. 36.)
Nota A gerncia limitada e comanda todas as operaes da organizao com incentivo ao
aprimoramento dos colaboradores.
Sin. organizao unificada
Cf. atender s necessidades do cliente

organizao por mercado sf
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir de insumos recebidos de fornecedores e beneficiados com recursos
humanos e tecnolgicos onde os diversos cargos so determinados de acordo com o
mercado em reas geogrficas ou organizados por clientes.
A <organizao por mercado>, voltada para o tipo de cliente, uma sofisticao
ainda maior e, geralmente, nestes casos, os executivos responsveis recebem o ttulo
de gerente de contas. Por esse mtodo, os clientes da organizao so atendidos pelos
diversos administradores da empresa, que se responsabilizam pelas atividades e
desenvolvimento de cada um. (LAS CASAS, A. L., 2000, p. 177.)
Nota A gerncia responsvel tanto por uma diviso geogrfica quanto por uma viso por
clientes, a fim de monitorar as situaes atuais e as tendncias do mercado com vistas
a uma maior eficincia das operaes mercadolgicas. So constitudos diversos
gerentes em cada agncia sem, no entanto, aumentar os degraus hierrquicos, j que
todos continuam respondendo a um nico gerente, com caractersticas mais
administradoras e bem menos operacionais que seus antigos predecessores.
Cf. atender s necessidades do cliente

organizao por produto sf
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir de insumos recebidos de fornecedores e beneficiados com recursos
humanos e tecnolgicos onde os diversos cargos so determinados de acordo com os
produtos oferecidos ao mercado uma vez que os mesmos so diversificados.
As <organizaes por produto> esto sendo usadas em muitos setores de servios. Os
bancos, por exemplo, organizam-se freqentemente por tipos de produtos, devido a




403


diversidade de operaes que atuam. Quando os servios oferecidos so
diversificados, esta forma organizacional mostra-se mais eficiente, uma vez que os
vrios produtos comercializados recebem a ateno devida, conforme o interesse da
administrao. (LAS CASAS, A. L., 2000, p. 177.)
Nota A gerncia limitada por produto e responsabiliza-se pelos resultados comerciais de
um ou vrios tipos de servios prestados.
Cf. atender s necessidades do cliente

organizao prestadora de servios sf
Parte interessada em prestar o atendimento s necessidades dos clientes a partir de
insumos recebidos de fornecedores e beneficiados/manufaturados com recursos
humanos e tecnolgicos.
Grupos distintos de pessoas podem estar interessados, em graus variveis, e
desempenhar certo papel no xito da empresa ou da <organizao prestadora de
servios>. A sensibilidade influncia desses grupos e a forma como suas
necessidades so satisfeitas e servidas configuram os dois pontos cruciais que
determinaro o sucesso ou o fracasso da empresa. (TOLEDO, G. L., 1978, p. 37.)
Sin. empresa prestadora de servios
Cf. necessidade do cliente

organizao unificada sf
Var. organizao U
Parte interessada em atender s necessidades do cliente, por meio da prestao de
servios, a partir de insumos recebidos de fornecedores e beneficiados com recursos
humanos e tecnolgicos onde os diversos cargos so determinados de acordo com as
atividades desempenhadas pelos colaboradores.
Assim, o executivo principal da <organizao unificada> ou <organizao U>
precisa estar perto das operaes de cada departamento, para que possa saber
quando seu pessoal deve fazer mais e quando deve fazer menos. Precisa estar
intimamente informado sobre os detalhes de cada departamento. (OUCHI, W. G.,
1985, p. 37.)
Nota A gerncia limitada e comanda todas as operaes da organizao.




404


Sin. organizao por funes
Cf. atender s necessidades do cliente

output sm
Resultado de um processo em termos de produto, servios ou informaes.
Se um processo capaz e se o processo est sob controle, ento pelo menos 99,7%
dos <outputs> estaro dentro da especificao. Isso garante boa qualidade sem
inspeo. (YOSHINAGA, C., 1988, p. 166.)
Nota Sua traduo do ingls sada do processo, mas os especialistas no o utilizam
traduzido.
Em uma organizao, muitos processos esto inter-relacionados, e ele passa a denotar
a somatria de imputs mais um valor agregado.
Cf. input; processo

Ps do posicionamento do servio sm
Nmero total de idias que consubstancia a noo de convergncia gerencial entre
marketing, operaes e recursos humanos, no desenvolvimento e implantao do
posicionamento em uma organizao de servios.
Isto requereu iniciativas "radicais", o projeto de servios que altere o comportamento
dos clientes e o desenvolvimento de uma viso estratgica de servios sobre uma
premissa dramtica, o crdito imobilirio instantneo. O palco estava montado para
o desenvolvimento e o posicionamento de um servio revolucionrio. Os assessores de
Horner na Citicorp Mortgage Corporation comearam a trabalhar nos <"P's do
posicionamento do servio">. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W.
L., 1994, p. 67.)
Nota Expanso de posicionamento para incluso nos servios do produto (servio), polticas
e procedimentos pelo qual ele oferecido (estratgia de operaes), praa e planta
(fbrica) nas quais ele fornecido (sistema de prestao de servios), prestador e quem
o procura (cliente). Estes Ps podem ser utilizados para descrever o perfil da posio
competitiva de uma organizao em relao a outras.
Cf. estratgia de operaes; organizao de servios; posicionamento





405


pacote de servios sm
Fras. projeto do pacote de servios
Composto de funo de marketing e funo de operaes oferecidas ao cliente como
elemento caracterstico da oferta dos servios.
Sendo a base da integrao entre as funes de marketing e de operaes, o conceito
ou misso do servio consiste no elo comum, com base no qual a funo de marketing
procurar gerar expectativas nos consumidores e a funo de operaes procurar
gerar a percepo, garantindo a coerncia entre os componentes do <pacote de
servios>. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 112.)
Cf. funo de marketing; funo de operaes

paradigma sm
Fras. paradigmas em qualidade
Modelo que estabelece uma estrutura de informaes e um conjunto de regras com os
quais seus praticantes visualizam o mundo.
Deixamos de lado os sinais negativos precursores e desligamos o sistema de alarme.
Somente um acmulo considervel de indcios nos levar a mudar o modelo ou
<paradigma> em vigor. // A Produo em Massa tornou-se um <paradigma> no
apenas da "produo" como tambm da "gesto", aceito e seguido tanto pelos
prestadores de servios quanto pelos fabricantes. Mas (conforme ser visto) esses
preceitos envolvem a empresa como um todo e todas as suas funes atravs de uma
cadeia de valor. (TEBOUL, J., 1991, p. 229. // PINE II, B. J., 1994, p. 25.)
Nota Sua origem creditada ao historiador cientfico Thomas Kuhn que o viu como a chave
do sucesso a partir do sistema de produo em massa, que era um modelo aceito ou
padro. No entanto, alguns especialistas entendem que ele limitador da criatividade,
uma vez que as aes so pensadas apenas para atingi-lo ou, mais ainda, para manter
os padres.









406


paradigma da produo em massa sm
Modelo que tem por meta comum o desenvolvimento, a produo, a comercializao e
a entrega de mercadorias e servios a preos suficientemente baixos ao alcance de
todos.
Nessa interao entre produtores e consumidores, o <paradigma da Produo em
Massa> tornou-se um crculo de realimentao que cria e refora os produtos
padronizados, as tcnicas de produo em srie e os mercados grandes e
homogneos. O ciclo de realimentao prov a estrutura de informaes em torno da
qual os praticantes da Produo em Massa visualizam o mundo e tomam as decises
que acreditam ser a chave do sucesso. (PINE II, B. J., 1994, p. 27.)

percepo sf
Fras. percepo da qualidade; percepo de clientes
Processo pelo qual os clientes selecionam, organizam e interpretam informaes para
formarem uma imagem sobre a qualidade do servio ou da organizao.
Os clientes percebem servios de forma diferenciada conforme foi visto, uma vez que
a qualidade do servio varivel de acordo com o tipo de pessoa. H uma fonte de
estmulos fsicos para a <percepo>, alm de fatores tais como necessidades, estado
de nimo, etc. Os principais aspectos fsicos da <percepo> podem ser:
similaridade, proximidade e continuidade. (LAS CASAS, A. L., 1999, p. 17.)
Nota Seu aspecto fsico subdivide-se em princpios da similaridade, proximidade e
continuidade.
Cf. princpio da continuidade; princpio da proximidade; princpio da similaridade

persistncia do servio sf
Freqncia de ocorrncia de uma situao que cria demanda para servio.
Registros: sistemas de manuteno de registros podem ser idealizados para fazer o
resumo e resumir a anlise das informaes sobre a <persistncia do servio>
prontamente disponvel. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 357.)
Nota Sua origem creditada a Troxell, em seu livro publicado em 1981. Ela pode ser
avaliada comparando-se o nmero de retornos dos clientes com um padro pr-
estabelecido de uso repetido.




407


Cf. demanda de servio

pesquisa de marketing sf
Fras. servio de pesquisa de marketing
Levantamento realizado na organizao voltado para os assuntos que possam afetar a
si prpria ou comunidade financeira.
Por uma variedade de razes, algumas prticas, outras subjetivas, a comunidade
financeira no tem recorrido <pesquisa de marketing> com a mesma intensidade
com que o setor industrial o faz. Essa situao tender a mudar, medida que haja
uma conscientizao quanto influncia crescente dos investidores profissionais e
institucionais e ao expressivo nmero de analistas de investimento, e, principalmente,
quando esses elementos forem considerados sob o ngulo da estratgia competitiva.
(TOLEDO, G. L., 1978, p. 82.)
Nota uma atividade indispensvel a toda ao de marketing, que colocada disposio
do executivo para auxili-lo quer nos problemas internos da organizao, quer nos que
se desenrolam no ambiente externo, subsidiando decises operacionais ou estratgicas.

planejamento a longo prazo sm
Conjunto de procedimentos que extrapolam o planejamento ttico por um perodo
mais longo, sem levar em considerao variaes ambientais e de direo da
organizao.
Sim, respondeu Dr. Carlos, neste caso voc est certo, e acredito at que as empresas
que comeam fazendo o <planejamento a longo prazo> acabam, sem querer,
discutindo variaes ambientais e mudanas de rumo da empresa. Dessa forma, o
planejamento estratgico acaba tornando-se muito mais fcil de se introduzir na
empresa que j tem <planejamento a longo prazo>. (FISCHMANN, A. A.;
ALMEIDA, M. I. R. de, 1991, p. 20.)
Cf. planejamento ttico








408


planejamento da qualidade sm
Fras. planejamento funcional da qualidade; planejamento multifuncional da qualidade
Conjunto de atividades que estabelece os objetivos e os requisitos da qualidade com
aplicao dos elementos do sistema da qualidade, abrangendo desde o planejamento
do servio/produto at provises para melhoria da qualidade.
O <planejamento da qualidade> um dos trs processos bsicos utilizados na
administrao para a qualidade. (...) Nesta seo a primeira diviso do assunto teve
base na seqncia universal de etapas adotadas durante o <planejamento da
qualidade>. (JURAN, J. M.; GRYNA, F. M., 1991, p. 176 (v. I).)
Nota Primeiro membro da trilogia da qualidade, J. M. Juran, em sua obra Planejando para a
qualidade, indica que os itens de identificao dos clientes e suas necessidades,
desenvolvimento de um servio/produto que responda a elas e desenvolvimento de um
processo capaz de fazer tal produto/prestar tal servio constituem um roteiro para o
mesmo.
Cf. requisitos da qualidade; sistema da qualidade (SQ); trilogia da qualidade

planejamento da qualidade dos servios sm
Conjunto de atividades que estabelece os objetivos e requisitos da qualidade e as
aplicaes dos elementos do sistema da qualidade para a prestao do servio.
Quando o indivduo recebe funes de qualidade como tarefas secundrias em vez de
esta ser sua nica responsabilidade, fica difcil a aplicao de todos os conceitos da
qualidade. Por exemplo, o envolvimento pode ficar dificultado em reas fora do
alcance da responsabilidade do indivduo, como a coleta de dados dos clientes ou o
projeto e <planejamento da qualidade dos servios>. (ZIMMERMAN, C. D. III;
ENELL, J. W., 1991, p. 342.)
Nota Primeiro membro da trilogia da qualidade, J. M. Juran, em sua obra Planejando para a
qualidade, indica que os itens de identificao dos clientes e suas necessidades,
desenvolvimento do servio que responda a elas e desenvolvimento de um processo
capaz de prestar tal servio constituem um roteiro para o mesmo.
Cf. prestao de servios; sistema da qualidade (SQ); trilogia da qualidade






409


planejamento de marketing do banco sm
Fras. atividade de planejamento de marketing do banco; planejamento de marketing
do banco a longo prazo; planejamento de marketing do banco de mdio prazo
Processo contnuo de pensamento sobre o futuro, mediante a determinao de estados
futuros desejados e a avaliao dos cursos de ao a serem seguidos para que tais
estados sejam alcanados, dentro de um quadro onde um conjunto de decises sobre
aspectos interdependentes devem ser tomadas.
As informaes indispensveis ao <planejamento de marketing do banco>,
especialmente no que se refere anlise da situao, podem ser geradas
internamente, mediante, por exemplo, o exame de documentos que contenham dados
sobre o cliente, ou, externamente, atravs da pesquisa e do estudo de dados
econmicos e de mercado, ou ainda com o recurso do pessoal de contato (vendedores)
do banco. (TOLEDO, G. L., 1978, p. 155.)

planejamento do processo sm
Atividade que fornece s unidades operativas os meios de produzir os produtos/prestar
os servios que possam atender s necessidades do cliente.
Uma vez estabelecidos os objetivos do produto, a prxima etapa dentro do
planejamento o <planejamento do processo>. (...) O resultado final do
<planejamento do processo> inclui: i. O projeto do processo (...); ii. infra-estrutura
para produo. (JURAN, J. M.; GRYNA, F. M., 1991, p. 195, (v. I).)
Nota Inclui mtodos documentados, especificaes, limites superior e inferior de controle,
necessidades de insumos e facilidades para acompanhar o desempenho e a capacidade
do processo.
Cf. atender s necessidades do cliente; capacidade do processo

planejamento e desenvolvimento do produto bancrio sm
Processo que envolve a identificao, classificao e medio das caractersticas da
qualidade de um produto/servio bancrio, estabelecimento de objetivos, requisitos e
restries que afetam a mesma, de forma a equilibrar os interesses e as necessidades
dos clientes com os da organizao.
O <planejamento e desenvolvimento do produto bancrio> traduzem-se por uma




410


atividade preocupada antes de tudo em estabelecer um equilbrio ou balanceamento
entre as ilimitadas possibilidades de aparecimento de novas idias e as restries
semifixas impostas pelos sistemas, mtodos de operao e equipamentos j existentes,
bem como pelos hbitos da clientela. (TOLEDO, G. L., 1978, p. 72.)
Nota Envolve desde alteraes nos produtos bancrios existentes e servios j em atividade
at a inovao e a criao de produtos e servios bancrios inditos.
Cf. caractersticas da qualidade; servio bancrio

planejamento estratgico sm
Sigla P.E.
Fras. tcnicas de planejamento estratgico; unidade de planejamento estratgico
Conjunto de procedimentos que, por meio da anlise do ambiente da organizao, cria
uma conscincia de oportunidades e ameaas em relao ao mercado e auxilia no
estabelecimento dos propsitos da alta administrao em evitar riscos e aproveitar as
oportunidades.
Isto porque o Dr. Carlos, pela sua experincia de consultor, sabia que dificilmente se
consegue introduzir o <planejamento estratgico> em um empresa, quando as
pessoas de deciso desta empresa no tm claros os conceitos de <planejamento
estratgico>, existindo, como natural, uma resistncia por aquilo que
desconhecido. (FISCHMANN, A. A.; ALMEIDA, M. I. R. de, 1991, p. 18.)
Nota Baseia-se no desenvolvimento e implementao de uma misso da organizao,
objetivos de apoio e estratgias funcionais coordenadas.
Cf. alta administrao

planejamento estratgico da qualidade sm
Conjunto de procedimentos em que a gerncia posiciona os meios disponveis da
organizao tendo em vista manter ou melhorar posies relativas de potenciais
favorveis a futuras aes tticas para se manter no mercado.
Uma das maiores aplicaes do conceito de planejamento da qualidade o
<planejamento estratgico da qualidade>, algumas vezes chamado de administrao
da qualidade total (TQM). (JURAN, J, M.; GRYNA, F. M., 1991, p. 210, (v. I).)
Nota exercido genericamente pelo corpo gerencial e alta administrao, mas cabe




411


gerncia da qualidade a atuao especfica.
Sin. administrao da qualidade total (TQM); total quality management (TQM)
Cf. alta administrao; gerenciamento da qualidade

planejamento ttico sm
Conjunto de procedimentos de curto prazo, predominantemente quantitativo, que
abrange decises administrativas e operacionais, tendo em vista a eficincia da
organizao.
Bem se v que voc j andou estudando o assunto, comentou Dr. Carlos, pois estas
tcnicas, embora sejam distintas, tm muita ligao com o planejamento estratgico.
A grosso modo podemos dizer que o <planejamento ttico> o oramento que vocs
j fazem. (FISCHMANN, A. A.; ALMEIDA, M. I. R. de, 1991, p. 20.)

planilha de planejamento da qualidade sf
Arranjo ordenado de informaes sobre planejamento em que as linhas horizontais
listam as necessidades e as colunas verticais os meios de se atend-las.
Para lidar com essa multiplicao de modo organizado e ordenado, os planejadores
da qualidade usam as <planilhas de planejamento da qualidade>. (JURAN, J.
M.;GRYNA, F. M., 1991, p. 183, (v. I).)
Nota Apesar de bastante genricos, os recursos informatizados apresentam diversas
ferramentas que auxiliam no planejamento e seu controle. Assim, os planejadores hoje
se preocupam com o contedo deixando a exposio a cargo de especialistas em
softwares.

plano sm
Fras. plano estratgico
Documento que estabelece o conjunto de mtodos, atividades, tarefas, aes e medidas
por meio das quais as metas e os objetivos da qualidade podem ser atingidos.
Para explicar o significado de <plano> e planejamento ser mais fcil colocar as
suas diferenas. Assim, o <plano> algo esttico, que normalmente formalizado em
um documento. Podemos referir-nos ao <plano> estratgico do ano passado. J o
planejamento um processo contnuo, no impedindo que dentro do processo de




412


planejamento existam prazos e datas para realizar <planos>. (FISCHMANN, A. A.;
ALMEIDA, M. I. R. de, 1991, p. 21.)
Cf. meta; objetivo da qualidade

plano da qualidade sm
Fras. plano de adequao da qualidade; plano diretor da qualidade
Documento que estabelece as prticas especficas, os recursos e as atividades da
qualidade que sejam relevantes para um servio/produto em particular.
Tendo sido efetuado o lanamento, importante, alis como aps qualquer projeto,
aprender com os atrasos cometidos, a ultrapassagem de prazo e modificaes no
previstas e propor aperfeioamentos do processo de desenvolvimento, assim como do
<plano da qualidade>. (TEBOUL, J., 1991, p. 129.)
Nota decorrente do planejamento da qualidade e inclui os requisistos para a aplicao dos
elementos do sistema da qualidade.
Cf. planejamento da qualidade; sistema da qualidade (SQ)

plano de marketing do banco sm
Fras. plano de marketing do banco de curto prazo; plano de marketing do banco de
longo prazo
Documento que estabelece o resultado do processo de planejamento de marketing,
contendo o repositrio de informaes e de decises de marketing da organizao por
meio das quais as metas e os objetivos da qualidade podem ser atingidos.
Neste captulo, ser atribuda nfase especial anlise da atividade de planejamento
de marketing do banco e ao exame dos principais elementos que devero compor o
contedo do <plano de marketing do banco> a ser colocado em execuo. (TOLEDO,
G. L., 1978, p. 154.)
Cf. meta; objetivo da qualidade









413


poltica da qualidade sf
Fras. poltica corporativa da qualidade
Conjunto de intenes e orientaes gerais de uma organizao que contempla a
qualidade como formalmente expressa pela alta administrao.
As organizaes que assumiram a preparao de uma <poltica da qualidade> por
escrito geralmente declaram que os esforos foram compensados pelos benefcios.
(JURAN, J. M.; GRYNA, F. M., 1991, p. 138, (v. I).)
Nota um guia de ao gerencial, de responsabilidade da alta administrao, que dever
defini-la, document-la e assegurar que a mesma compreendida, est implementada e
ser mantida em todos os nveis da organizao.
Cf. alta administrao

poltica de preo sf
Fras. poltica de preo nico; poltica de preo varivel
Conjunto de intenes e orientaes de uma organizao que contempla a relao de
troca como formalmente expressa pela alta administrao.
As empresas prestadoras de servios podem adotar diversas <polticas de preos>.
Tarifas de nibus, taxas de juros de certas modalidades de emprstimos constituem
um exemplo de <poltica de preo> nico. Algumas empresas, entretanto, praticam a
<poltica de preo> nico sob certas condies, como o caso da Telesp e de certos
servios de instituies financeiras. Por outro lado, particularmente difcil conciliar
as caractersticas de uma <poltica de preos> variveis com o setor de servios,
embora possam ser encontrados exemplos em certas modalidades de servios
profissionais. (TOLEDO, G. L., 1978, p. 44.)
Cf. alta administrao

portflio sm
Fras. abordagem de portflio
Tipo de abordagem analtica do mercado onde se avalia o crescimento e a participao
do servio no mesmo, a fim de selecionar os itens que proporcionaro maior fundo de
caixa ou que esto mais enquadrados nas expectativas do cliente.
A anlise desse <portflio> til, pois desse modo a empresa pode determinar quais




414


os produtos e em que mercados ela ter maior interesse em atuar. A empresa, por
meio de uma anlise destas, ter condies de determinar em que servio dever
investir e qual dever retirar do mercado. Tudo isso certamente visando ao objetivo
do programa de marketing. (LAS CASAS, A. L., 2000, p. 59.)
Nota um emprstimo do ingls, embora no lexicalizado, apesar da forma aportuguesada,
cuja traduo pasta (para papis) no lxico geral.
Foi desenvolvido pelo Boston Consulting Group (BCG), organizao de consultoria
em administrao sediada nos Estados Unidos, que dividiu os servios em Estrelas,
Vacas Leiteiras, Crianas-prodgio e Abacaxis.
Cf. expectativa do cliente

posicionamento sm
Fras. estratgia de posicionamento; funo do posicionamento; posicionamento
coordenado de um servio; posicionamento de servio revolucionrio;
posicionamento efetivo de um servio; posicionamento estratgico;
posicionamento oposto
Processo por meio do qual todos os aspectos da viso estratgica so projetados e
gerenciados em relao s necessidades do consumidor e s possibilidades dos
concorrentes.
Dirigindo-nos para os elementos integrativos, o <posicionamento> um conceito que
se tornou familiar para os gerentes de marketing e propaganda. Mas na
revolucionria viso estratgica de servios, todos os recursos so projetados e
empregados em funo da posio competitiva que a empresa procura ter, na mente
do cliente. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 28.)
Nota Sua origem creditada a dois executivos de publicidade dos anos 70 do sculo XX, Al
Ries e Jack Trout. Como um dos elementos integrativos da viso estratgica de
servios, utilizado como artifcio de marketing para estabelecer diferenciao do
servio em relao a outros na mente do consumidor.
Cf. elementos integrativos da viso estratgica de servios







415


preo sm
Fras. preo auto-regulamentado; preo dos servios; preo livre; preo regulamentado
Compensao monetria por unidade de servio prestado que influencia a demanda
pelo servio.
O <preo> de meia-entrada na matin do cinema pode estimular a demanda entre
cidados mais idosos com poucos compromissos fixos, porm tem pouco efeito sobre o
segmento de freqentadores de cinema com empregos diurnos regulares, para os
quais nenhum valor de incentivo no <preo> seria suficiente. (HESKETT, J. L.;
SASSER JR., W. E.; HART, C. W. L., 1994, p. 161.)
Nota um dos principais instrumentos de marketing que est sob o controle da organizao
e que pode afetar a implantao e a aceitao do servio pelo mercado. As estratgias
empregadas na determinao do preo de produto so influenciadas primordialmente
pela estrutura de custos enquanto o preo de servio sofre presso tambm de aspectos
subjetivos.
Sin. pricing
Cf. demanda de servio; instrumentos de marketing; unidade de servio

previso de demanda sf
Identificao dos processos ou procedimentos adequados a serem seguidos que no
levam em conta as limitaes de capacidade de ofertar o servio, mas apenas o
potencial de compra do mercado.
As <previses de demanda> tm especial importncia para as operaes de servios,
principalmente porque impossvel usar estoques de servios como colcho contra
incertezas e erros de previso. Em servios, portanto, necessrio que se tenha uma
noo bem aproximada de como a demanda vai comportar-se no futuro para que se
possa garantir que a quantidade adequada de capacidade produtiva possa ser
providenciada quando necessria. (GIANESI, I. G. N.; CORRA, H. L., 1996, p.
176.)








416


previso de vendas sf
Estimativa de quanto uma determinada organizao vai vender ao longo de um
determinado horizonte futuro.
As <previses de vendas> so restritas ou limitadas, por exemplo, pela capacidade de
produo da empresa. Mesmo que o mercado potencialmente esteja disposto a
comprar uma determinada quantidade de servios, se um sistema produtivo est
limitado na sua capacidade de prestar este servio, num nvel de volume inferior, a
<previso de vendas> deveria levar isso em conta. (GIANESI, I. G. N.; CORRA, H.
L., 1996, p. 176.)

pricing sm
Fras. estratgia de pricing; mtodo de pricing de servios; pricing de produto; pricing
de servio
Compensao monetria por unidade de servio prestado que influencia a demanda
pelo servio.
Apesar de as caractersticas diferenciadoras que foram apresentadas serem as mais
facilmente identificveis, h outras diferenas que podem igualmente influir em certas
atividades de venda, de comunicao, de escolha de canal e de <pricing> da empresa
que os comercializa. (TOLEDO, G. L., 1978, p. 22.)
Nota Emprstimo do ingls cuja traduo preo.
um dos principais instrumentos de marketing que est sob o controle da organizao
e que pode afetar a implantao e a aceitao do servio pelo mercado. As estratgias
empregadas na determinao do pricing de produto so influenciadas primordialmente
pela estrutura de custos enquanto o pricing de servio sofre presso tambm de
aspectos subjetivos.
Sin. preo
Cf. demanda de servio; instrumentos de marketing; unidade de servio









417


princpio da continuidade sm
Preceito segundo o qual a marca ou o nome de uma organizao tende a ser percebido
pelo indivduo como parte de um todo significativo, associando-se aos conceitos
formados pela mesma.
Este o <princpio da continuidade>, muito usado em comerciais. Quando o
comercial na TV diz "Tomou Doril..." o leitor automaticamente continua com o
complemento "... A dor sumiu." Depois de um certo tempo, no h necessidade de
apresentar a frase completa. O prprio cliente o faz. (LAS CASAS, A. L., 1999, p.
20.)
Nota um dos principais componentes do aspecto fsico da percepo.
Cf. percepo; princpio da proximidade; princpio da similaridade

princpio da proximidade sm
Preceito segundo o qual a contigidade tende a ser percebida pelo indivduo como
parte de um conjunto.
Este <princpio da proximidade> pode ser aplicado na prtica para a formao da
imagem de uma empresa. Conforme Bennet, em Nova Iorque, um homem morreu de
botulismo por ter comido uma lata de vichhyssoise da Bon Vivant. Os consumidores
acharam que todos os produtos da mesma marca eram "culpados" por associao e a
firma foi falncia. (LAS CASAS, A. L., 1999, p. 18.)
Nota um dos principais componentes do aspecto fsico da percepo.
Cf. percepo; princpio da continuidade; princpio da similaridade

princpio da similaridade sm
Preceito segundo o qual os iguais tendem a ser percebidos pelo indivduo como parte
de um todo.
Se voc viu dois conjuntos de quadrados e um conjunto de quatro crculos pretos,
voc viu o que a maioria v. No entanto, poderia perceber a figura como formada de
linhas horizontais, cada uma delas composta de quadrados e crculos. Este o
<princpio da similaridade>, em que as coisas similares tendem a ser percebidas pelo
indivduo como parte de um conjunto. (LAS CASAS, A. L., 1999, p. 17.)
Nota um dos principais componentes do aspecto fsico da percepo.




418


Cf. percepo; princpio da continuidade; princpio da proximidade

processo sm
Fras. processo de gesto da qualidade; processo de inovao; processo interfuncional
Conjunto de atividades predeterminadas, efetuadas para gerar servios/produtos que
atendam s necessidades dos clientes, utilizando insumos de fornecedores e agrupando
em seqncia todas as tarefas dirigidas obteno de um determinado resultado.
Um <processo> uma srie de atividades ou operaes que levam a um resultado
determinado. Trata-se por exemplo da montagem de um aparelho ou de um
subconjunto, em linha de montagem, ou em oficina, ou do conserto de um carro numa
concessionria ou ainda a preparao de um pedido ou de uma fatura. (TEBOUL, J.,
1991, p. 65.)
Nota Para que ele se componha, as atividades devem ser independentes, receber produtos
parciais mensurveis, modificar esse produto recebido, agregando valor, gerar
produtos tambm mensurveis, com uma repetio dessas mesmas atividades.
Cf. atender s necessidades do cliente

programa brasileiro da qualidade e produtividade sm
Sigla PBQP
Conjunto de planos que tem por objetivo apoiar o esforo brasileiro de modernizao
por meio da promoo da qualidade e produtividade, com vistas a aumentar a
competitividade de bens e servios produzidos no pas.
Mas foi em novembro de 1990, com a implantao do <Programa Brasileiro de
Qualidade e Produtividade (PBQP)> - parte da poltica industrial definida pelo
governo Collor, por meio do Ministrio da Cincia e Tecnologia - que as empresas
brasileiras comprometeram-se definitivamente com a Qualidade. (ALMEIDA, R. C.
de, 1998, p. 23.)
Nota Foi criado em junho de 1990 e composto por cinco subprogramas gerais e
subprogramas setoriais da qualidade e produtividade, com orientao a cargo do
Comit Nacional da Qualidade e Produtividade, vinculado diretamente Presidncia
da Repblica, por meio de sua Secretaria Geral.





419


programa da qualidade sm
Fras. programa da qualidade formalizado; programa interno da qualidade da
organizao
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
da qualidade em uma organizao.
Um <programa da qualidade> pode ser usado para avaliar os servios internos,
externos e regulados. Quando aplicado a servios externos, o <programa da
qualidade> pode avaliar e controlar a incidncia de servios no-conforme junto aos
consumidores medida que eles ocorrem. Aplicado internamente, o <programa da
qualidade> avalia e controla a conformidade dos processos internos e as funes
administrativas que so vitais para o oferecimento de bom servio externo. Tambm
pode-se usar um <programa da qualidade> formalizado para fornecer dados sobre a
conformidade da organizao de servios perante as exigncias reguladoras.
(ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 322.)
Sin. programa da qualidade total (PQT); programa de controle da qualidade (PCQ);
programa de melhora da qualidade (PMQ)
Cf. organizao; sistema da qualidade (SQ)

programa da qualidade de servio sm
Var. programa da qualidade em servio
Fras. programa da qualidade de uma empresa de servio
Sistema progressivo e planejado que tem como objetivo a adequao ao uso dos
servios da organizao.
Um <programa da qualidade de servio> efetivo recebe o apoio visvel da
administrao superior, um lugar permanente nos planos empresariais das
organizaes prestadoras de servios, uma posio de destaque na hierarquia dos
objetivos e metas da corporao, bem como uma orientao e plano de treinamento
que assegure a propagao dos princpios e tcnicas da qualidade por toda a
empresa. (...) Um <programa da qualidade em servio> parte integrante de uma
organizao. Devido ao estabelecimento de ciclos de feedback e de inspees
contnuas e auditoria, o ambiente da organizao pode ser estudado e as melhorias




420


nos procedimentos da qualidade existentes podem ser planejadas. (ZIMMERMAN, C.
D. III; ENELL, J. W., 1991, p. 322 e 383.)
Nota planejado com vistas a realar os objetivos filosficos da organizao e assegurar
que todos os esforos de todas as unidades que influenciem a qualidade sejam
coordenados, alm de apresentar uma progressividade para desenvolver uma srie de
dados sobre os melhores nveis obtidos na qualidade do desempenho do servio.
Cf. adequao ao uso; organizao; servios

programa da qualidade do fornecedor sm
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
da qualidade em uma organizao fornecedora.
Os componentes, projeto e desenvolvimento de um <programa da qualidade do
fornecedor> so parecidos com os da prpria organizao de servios. Os padres de
qualidade so estabelecidos por um consenso entre fornecedor e comprador; um
sistema de medio projetado e estipulado; os defeitos so analisados
continuamente para se determinar as causas; a ao corretiva planejada e
implementada a fim de eliminar ou minimizar as causas dos defeitos; monitoramento
contnuo conduzido para que as metas sejam alcanadas. (ZIMMERMAN, C. D. III;
ENELL, J. W., 1991, p. 384.)
Cf. organizao fornecedora; sistema da qualidade (SQ)

programa da qualidade seis sigma sm
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
da qualidade em uma organizao, com vistas a obter 0,002 ppm de defeitos dentro da
tolerncia do processo.
A questo que gerava mais confuso era o significado do Seis Sigma, especialmente
porque a Gerncia Corporativa levou duas semanas aps a apresentao em vdeo do
CEO para publicar uma descrio do que era o <Programa da Qualidade Seis
Sigma>. O documento era denominado "O desafio do Seis Sigma" e era dividido em
duas explicaes: O que Seis Sigma? E Por que o Seis Sigma? Tinha apenas uma




421


pgina. (PEREZ-WILSON, M., 1999, p. 111.)
Nota Foi implementado inicialmente na Motorola Inc. em 15 de janeiro de 1987 com o
propsito de aumentar a satisfao do cliente, reduzindo ou eliminando defeitos nos
produtos/servios.
Cf. parte por milho (PPM); seis sigma; sistema da qualidade (SQ)

programa da qualidade total sm
Sigla PQT
Var. programa de qualidade total
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
da qualidade em uma organizao.
As observaes podem ser conduzidas pelo pessoal da administrao informalmente,
ou ainda por observadores especialmente treinados como parte de um <programa da
qualidade total>. A subjetividade inerente ao observador e a dificuldade em ler ou
interpretar o comportamento do cliente como indicativo de satisfao ou insatisfao
so as principais desvantagens da observao. // A Fundao, por intermdio de
Barbosa et al. (1994:4), divulga que, em 1993, as empresas com ela conveniadas,
para implementao de <programas de qualidade total> que se chamam TQC ou
CQT e seu gerenciamento, eram "responsveis por cerca de 35% do PIB nacional -
apenas as representantes do setor industrial [grifou-se]". (ZIMMERMAN, C. D. III;
ENELL, J. W., 1991, p. 351. // ALMEIDA, R. C. de, 1998, p. 23.)
Sin. programa da qualidade; programa de controle da qualidade (PCQ); programa de
melhora da qualidade (PMQ)
Cf. organizao; sistema da qualidade (SQ)











422


programa de controle da qualidade sm
Sigla PCQ
Fras. programa de controle da qualidade total
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
da qualidade em uma organizao.
J que a satisfao do cliente - a percepo que tem o pblico da qualidade do
servio prestado - to essencial para o estabelecimento de padres adequados e
especficos de desempenho, importante que uma organizao de servios devote o
mximo de criatividade e energia a esse ponto tanto a qualquer outro segmento do
<programa de controle da qualidade>. (ZIMMERMAN, C. D. III; ENELL, J. W.,
1991, p. 353.)
Sin. programa da qualidade; programa da qualidade total (PQT); programa de
melhora da qualidade (PMQ)
Cf. organizao; sistema da qualidade (SQ)

programa de marketing sm
Fras. programa de marketing para servios
Conjunto de planos documentados, controlados e implementados, que possui
objetivos, estratgias, meios, mtodos e metas pertinentes manuteno de um sistema
de trocas em uma organizao.
O desenvolvimento de um <programa de marketing> deve basear-se essencialmente
na criao de atitudes favorveis em quatro grupos de pblicos: os clientes, os
diretores e acionistas, as pessoas que tm algum interesse na organizao ou na
empresa e o pblico em geral. (TOLEDO, G. L., 1978, p. 37.)
Nota Ele deve basear-se na criao de atitudes favorveis aos clientes, diretores e acionistas,
pessoas interessadas e pblico em geral.









423


projetar para a produtibilidade v
Sigla DFM
Tcnica que apresenta um conjunto aprimorado de mtodos de projetos para linhas de
produo/prestao de servios.
Agora, o <DFM> encontra-se numa nova fase: a dos filhotes ou aplicaes especiais.
Um exemplo o projeto para a qualidade do acabamento, que se relaciona com a
escolha de materiais e formas que podem ser pintados de maneira eficaz.
(SCHONBERGER, R. J., 1992, p. 219.)
Nota uma traduo do emprstimo do ingls design for manufacturability, de onde
provm a sigla no original.
Sua origem creditada a Geoffrey Boothroyd, professor da Universidade de Rhode
Island, a partir da publicao de seu relatrio Design for Assembly (Projeto para a
Montagem) de 1980.

projetar para as operaes v
Sigla DFO
Fras. diretriz DFO
Tcnica que apresenta um conjunto aprimorado de mtodos de projetos.
O <DFO> est bem consolidado para os produtos, mas no para os servios. Assim,
as diretrizes <DFO> para os servios ainda so preliminares. No h dvida de que
podem ser melhoradas e refinadas. Isso no significa que o setor dos servios est
atrasado em seus mtodos de planejamento. (SCHONBERGER, R. J., 1992, p. 225.)
Nota uma traduo do emprstimo do ingls design for operations, de onde provm a
sigla no original.
O objetivo um projeto de produto/servio que seja fcil de fazer/prestar.

projeto de qualidade sm
Fras. projeto de qualidade em servio
Conjunto de atividades programadas que transforma uma srie de inputs em
produto/servio, de forma a satisfazer um conjunto de necessidades do cliente.
As indstrias de prestao de servios esto repletas de servios "grtis", os quais so
oferecidos aos clientes como parte do <projeto de qualidade>. (ZIMMERMAN, C.




424


D. III; ENELL, J. W., 1991, p. 313.)
Nota Deve se prender s consideraes de identificao do que constitui adequao ao uso,
escolha de um conceito de projeto que corresponda s necessidades identificadas no
usurio e a transformaao desses conceitos em especificaes.
Cf. adequao ao uso; input; necessidade do cliente

projeto de servio sm
Var. projeto do servio
Fras. projeto de servio revolucionrio
Conjunto de atividades programadas a fim de definir e prover as caractersticas do
servio exigidas para atender as necessidades e as expectativas do cliente.
Ao oferecer um <projeto de servio> a milhares ou milhes de clientes, a
simplicidade fundamental. Muitos clientes so incapazes de compreender regras
complexas, variaes, etc. Outros tantos no desejam perder tempo em aprender. (...)
A utilizao bsica da pesquisa do consumidor levar as reaes do cliente de volta
ao <projeto do servio>. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 313 e
352.)
Nota Deve se prender s consideraes de identificao do que constitui adequao ao uso,
escolha de um conceito de projeto que corresponda s necessidades identificadas no
usurio e a transformaao desses conceitos em especificaes.
Cf. adequao ao uso; caractersticas do servio; expectativa do cliente

promessa de servio sf
Compromisso estabelecido pela organizao de servios que corresponde s condies
normais de explorao.
A <promessa de servio> corresponde s condies normais de explorao. No caso
em que a demanda superior capacidade, pode haver degradao do servio e filas
de espera. Por isso, importante poder, eventualmente, deslocar ou modificar a
demanda. (TEBOUL, J., 1991, p. 215.)
Cf. organizao de servios






425


qualidade sf
Sigla Q
Fras. alta qualidade; baixa qualidade; percepo de qualidade
Totalidade do desempenho das caractersticas de um servio/produto, avaliadas de
acordo com sua possibilidade efetiva, para atender s necessidades especificadas ou
implcitas.
Bem, h um bocado de coisas que no entendo na abordabem da <qualidade> de
Taguchi. Apesar disso, quero salientar os aspectos de seu enfoque que podem ser
usados como parte integrante das filosofias do Dr. Deming. (SCHERKENBACH, W.
W., 1990, p.119.)

qualidade de projeto sf
Totalidade do desempenho das caractersticas do servio especificado, avaliadas de
acordo com sua possibilidade efetiva em atender s necessidades dos clientes
explcitas ou implcitas.
No setor bancrio, como numa fbrica, foi dada ateno tanto para a <qualidade de
projeto> como para a qualidade de produo. (ZIMMERMAN, C. D. III; ENELL, J.
W., 1991, p. 412.)
Nota Especificaes para melhorar a rapidez dos servios nos guichs dos caixas e ausncia
de erros nos demonstrativos mensais so alguns exemplos.
Cf. atender s necessidades do cliente; caractersticas do servio

qualidade do fornecedor sf
Totalidade do desempenho das caractersticas de um servio/produto de uma
organizao fornecedora, avaliadas de acordo com sua possibilidade efetiva para
atender s necessidades especificadas.
As empresas de servios com compras significativas geralmente atribuem
responsabilidades quanto s questes pertinentes <qualidade do fornecedor> a
profissionais especficos da qualidade dentro da organizao. (ZIMMERMAN, C. D.
III; ENELL, J. W., 1991, p. 384.)
Cf. organizao fornecedora





426


qualidade do servio sf
Var. qualidade de servio; qualidade em servio
Fras. qualidade da experincia do servio; qualidade do servio prestado
Atendimento eficaz, por parte da organizao, daquilo que o cliente percebe e sente
como satisfao de suas necessidades e expectativas.
Uma boa pergunta : o que voc entende por <qualidade do servio> (lavanderia e
tinturaria, bancos, correio, os consertos de seu automvel)? Veremos, no prximo
captulo, que algumas caractersticas da <qualidade do servio> so to fceis de
quantificar e de medir quanto as caractersticas da qualidade de um produto
manufaturado. // Como no caso da qualidade do produto, o conceito de <qualidade de
servio> comea com "adequao ao uso". Empresas de servios - bancos,
companhias de seguro, empresas de transportes, hospitais e outras organizaes -
dedicam-se inteiramente a servir aos seres humanos. // <Qualidade em servios>,
segundo Karl Albrecht, a capacidade que uma experincia ou qualquer outro fator
tenha para satisfazer uma necessidade, resolver um problema ou fornecer benefcios a
algum. Em outras palavras, servio com qualidade aquele que tem a capacidade de
proporcionar satisfao. (DEMING, W. E., 1990, p. 132. // ZIMMERMAN, C. D. III;
ENELL, J. W., 1991, p. 311. // LAS CASAS, A L., 1999, p. 16.)
Nota medida pela relao entre o que fornecido e o que era esperado.

qualidade do servio bancrio sf
Atendimento eficaz, por parte da organizao bancria, daquilo que o cliente
institucional ou particular percebe e sente como satisfao de suas necessidades e
expectativas.
Quando se fala em <qualidade dos servios bancrios> imediatamente vem mente o
problema do nvel de qualificao profissional dos funcionrios. Sob a perspectiva de
marketing, o problema duplamente crucial, em decorrncia da necessidade de o
banco contar com bons profissionais de marketing e com funcionrios que
desenvolvam uma atitude favorvel com relao ao banco, e que ajam de forma a no
comprometer a imagem global da organizao junto clientela. (TOLEDO, G. L.,
1978, p. 77.)
Nota medida pela relao entre o que fornecido pela organizao bancria e o que era




427


esperado pelo cliente.

qualidade estratgica sf
Aspecto da totalidade do desempenho das caractersticas de um servio bancrio e que
estabelece a diferena entre os bancos.
Ouvir os clientes, cuidar das suas reclamaes e/ou sugestes, torna-se um aspecto de
fundamental importncia no desenvolvimento da <Qualidade Estratgica>, onde o
foco, alm de captar clientes e aumentar a sua rea de atuao, deve ser o de manter
os clientes, ouvindo-os e mantendo-os plenamente satisfeitos com os servios
prestados. (REIS, L. F. S. D., 1998, p. 10.)
Nota Ela influencia decisivamente a qualidade operacional.
Cf. qualidade operacional; servio bancrio

qualidade institucional da organizao sf
Totalidade do desempenho das caractersticas do servio bancrio que engloba
honestidade, confiabilidade e segurana da instituio.
Cabe aqui voltarmos ao assunto do "Banco reconhecido pela sua Qualidade", ou seja,
a <Qualidade Institucional da Organizao>. A <Qualidade Institucional da
Organizao> passar a englobar, alm da Qualidade propriamente dita, os aspectos
de Honestidade/tica, Confiabilidade (integridade e confiana) e Segurana da
Instituio. (REIS, L. F. S. D., 1998, p. 65.)
Nota a imagem que os clientes e o mercado tm do banco.
Cf. servio bancrio

qualidade na gesto bancria sf
Atendimento eficaz, por parte da organizao bancria, para oferecer o melhor
emprego aos colaboradores, a melhor aplicao financeira aos acionistas e o melhor
banco aos clientes.
A <Qualidade na Gesto Bancria> algo extremamente importante para os Bancos,
no s do ponto de vista da Organizao em si, como do ponto de vista dos acionistas
e clientes. Afinal, os clientes e os acionistas so o maior patrimnio do Banco e,
juntamente com os funcionrios, constituem o real valor do Banco. (REIS, L. F. S. D.,




428


1998, p. 13.)

qualidade naturalista sf
Totalidade do desempenho na prtica de processar um item e imediatamente vistori-
lo ou experiment-lo no prximo elo da cadeia de clientes.
A <qualidade naturalista> tem exemplos abundantes na indstria eletrnica. Um
exemplo o da fbrica de impressoras da National Cash Register (NCR) em Ithaca,
Nova York. Seu esforo de JIT (que reduziu o tempo de processamento de pedidos
antecipados, de sessenta para seis dias), alm de um intenso programa de
desenvolvimento da qualidade dos fornecedores, resultaram no corte da equipe de
garantia da qualidade de oitenta para quatro pessoas. (SCHONBERGER, R. J., 1992,
p. 68.)
Nota Quando houver algo de errado no processo, a linha de fluxo deve ser paralizada,
localizada a causa e efetuado o conserto para s ento o processo poder recomear.
Cf. cadeia de cliente; linha de fluxo; processo

qualidade percebida sf
Fras. qualidade percebida pelos clientes
Totalidade do desempenho das caractersticas da qualidade estabelecida na diferena
entre o valor percebido pelo cliente e o valor pago pelo servio/produto para atender s
suas necessidades especificadas ou implcitas.
A Satisfao do Cliente , portanto, funo das suas Expectativas, da <Qualidade
Percebida> e do Valor Real Agregado pelo servio ou produto bancrio.
Normalmente, o Valor Percebido pelo cliente, isto , a <Qualidade Percebida>,
produto do modelo da Gesto da Qualidade utilizado no Banco e da prpria
Liderana pela Qualidade. Se considerarmos que a Gesto da Qualidade se deve
basear no modelo P G P, compreenderemos, melhor, que a <Qualidade Percebida>
pelo cliente est diretamente relacionada com a prpria Qualidade do Banco e com o
modelo de Gesto utilizado. (REIS, L. F. S. D., 1998, p. 56.)
Nota William E. Deming e J. M. Juran estabeleceram como componentes bsicos da mesma
o nvel ou grau em que os servios/produtos cumprem os requisitos do cliente e a
confiana com que esses requisitos so atendidos.




429


quatorze pontos de Deming sm
Var. quatorze pontos
Nmero total de idias que consubstancia a essncia da filosofia de Deming e aplica-
se a qualquer tipo de organizao, tanto na indstria de manufaturados quanto na de
servios, com aceitao universal.
Formado por banqueiros, advogados, congressistas, diretores executivos e lderes
trabalhistas, o grupo esteve presente naquela manh de vero ensolarado para
assinar um documento cuja natureza parecia muitssimo com os <Quatorze pontos de
Deming>. // Com que freqncia voc discute os <Quatorze Pontos> com seus
subordinados? Colegas? Superiores? A quem voc pede conselhos sobre estatstica?
As suas prioridades so transmitidas atravs de suas perguntas e no pelas intenes.
(WALTON, M., 1989, p. 212. // SCHERKENBACH, W. W., 1990, p. 144.)
Nota Iniciaram-se por dez princpios em 1930 e o autor continuou aperfeioando-os at
alcanar o nmero atual de quatorze.
Sin. 14 princpios; filosofia Deming; nova filosofia
Cf. adotar a nova filosofia; aperfeioar o sistema; cessar a aprovao de oramento
com base no preo; criar constncia de propsito; eliminar a necessidade de
inspeo em massa; eliminar as barreiras entre os departamentos; eliminar
lemas, exortaes e metas; eliminar o medo; eliminar padres de trabalho;
engajar todos na realizao da transformao; instituir liderana; instituir
programa de educao e retreinamento; instituir treinamento; remover as
barreiras ao orgulho da execuo

reao em cadeia sf
Seqncia de aes desencadeadas em busca da melhoria da qualidade na organizao.
Esta <reao em cadeia> foi aprendida pela direo das empresas japonesas em
1950. Podemos falar em qualidade, mas se no soubermos agir neste sentido, se no
soubermos como a conseguir, ela no passar de uma palavra vazia. No os deixei
com palavras vazias. (WALTON, M., 1989, p. 29.)
Nota Desencadeia-se nos colaboradores da organizao, alm dos fornecedores e
concorrentes, alcanando um resultado que o avano qualitativo do mercado,
tornando o cliente mais exigente e forando a se manter o ciclo de forma contnua.




430


remover as barreiras ao orgulho da execuo v
Atuar no sentido da mudana dos nmeros absolutos para a qualidade, assim como
abolir a avaliao de desempenho e mrito e a administrao por objetivos.
<Remover as barreiras ao orgulho da execuo> que privam o operrio horista e as
pessoas da administrao e engenharia de seu direito de orgulharem-se de seu
desempenho. (DEMING, W. E., 1990, p. 19.)
Nota Constitui o 12 dos 14 princpios e subdivide-se em relao aos colaboradores e
administrao.
Cf. 14 princpios

representante de servios sm
Profissional responsvel pela atividade de contato com os clientes e que proporcionam
uma oportunidade para servios bons ou ruins.
A empresa telefnica tem contato com todos os seus clientes atravs dos
<representantes de servios>. Pessoal da instalao, telefonistas, funcionrios que
trabalham no auxlio lista, servios de cobrana, servios de reparo e os tcnicos
responsveis pelos consertos. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p.308.)

requisitos da qualidade sm
Conjunto de propriedades que pode ser avaliado em funo do grau de satisfao dos
clientes ou dos requisitos determinados.
Entre as vrias funes componentes de um negcio a funo mercadolgica tem o
papel indelegvel, para qualquer outra, de tomar a iniciativa de estabelecer
<requisitos da qualidade> para produtos e/ou servios que a organizao pretende
apresentar a seus clientes. Para isso ela, a funo mercadolgica, determina a
necessidade de um produto ou servio. (CERQUEIRA NETO, E. P. de, 1993, p. 65.)
Sin. caractersticas da qualidade
Cf. satisfao do cliente








431


retribuio indevida sf
Recompensa monetria dada a algum que tenha realizado alguma ao pelo prazer
pessoal de faz-lo e que resulta no cancelamento da repetio da mesma.
Existe o que se chama de motivao intrnseca, motivao extrnseca e <retribuio
indevida>. As pessoas nascem precisando se relacionar com outras, necessitando ser
amadas e estimadas por outras. Existe uma necessidade inata de auto-estima e
respeito. (DEMING, W. E., 1990, p. XXIII.)

reviso do projeto sf
Exame sistemtico, formal, abrangente e documentado de um projeto para avaliar os
requisitos da qualidade e as condies de atend-los, alm de identificar problemas e
propor medidas corretivas.
As <revises do projeto>, tambm chamadas grupos de sntese ou conferncias de
desenvolvimento, tm como objetivo submeter o projeto chegado a um certo estgio de
elaborao a uma anlise crtica de todas as suas funes para simplific-lo ou
destacar o mais cedo possvel os problemas em potencial, antes que os planos e
especificaes no se tornem definitivos. (TEBOUL, J., 1991, p. 127.)
Nota A auto-reviso do projeto no suficiente para garantir projeto apropriado, por isso a
reviso dever ser feita por profissionais de reas distintas.
Sin. conferncia de desenvolvimento; grupo de sntese
Cf. requisitos da qualidade

saber profundo sm
Fras. sistema saber profundo
Sistema administrativo subdividido em viso do que seja sistema, elementos de teoria
da variabiidade, teoria do conhecimento e elementos de psicologia.
Os vrios elementos do sistema que denominamos <Saber Profundo> no podem ser
separados. Eles interagem entre si. (DEMING, W. E., 1990, p. XVII.)
Nota Elemento bsico para a adoo dos 14 princpios, tendo sido includo pelo autor
apenas em 1990.
Cf. 14 princpios





432


segmentao de mercado sf
Conjunto especfico de pessoas ou organizaes caracterizado por necessidades
comuns, levando-se em conta as restries internas da mesma e as que derivam do
ambiente externo.
Por conseguinte, qualquer definio de marketing bancrio, consubstanciada na
filosofia subjacente ao conceito de marketing, deve incluir o conceito de
<segmentao de mercado>, uma vez que as atividades de marketing se
desenvolvero visando satisfazer s necessidades de grupos escolhidos de
consumidores e com lucro. (TOLEDO, G. L., 1978, p. 57.)
Nota Em relao aos bancos, sob a tica da demanda, o mesmo se subdivide em mercado de
bens de consumo, com seus clientes particulares, e mercado institucional, referindo-se
aos clientes institucionais.

segmento-alvo de mercado sm
Var. segmento alvo de mercado
Poro delimitada, destacada do conjunto, interessante para a atuao de uma
organizao que presta um tipo especfico de servio.
Adam Aronson se conduz pelo livro, pelo menos nosso livro, na sntese dos elementos
bsicos de uma viso estratgica de servios, essencial para uma estratgia
empresarial vencedora. Ele visou claramente dois dos vrios possveis <segmentos
alvo de mercado> para servios bancrios: empresas de porte mdio e indivduos de
alto patrimnio, assegurando-se de que entendeu as necessidades dos membros desses
segmentos. (...) Os clientes sempre sabem quando esto num banco Mark Twain. O
estilo e as cores contemporneas, assim como a presena de excelentes obras de arte
em toda parte podem confundir ou repelir outros banqueiros. Mas a maneira com que
atraem os clientes do <segmento-alvo de mercado> do Mark Twain e repelem os
demais sinaliza para um sistema de prestao de servio bastante integrado com a
estratgia operacional do banco. (HESKETT, J. L.; SASSER JR., W. E.; HART, C.
W. L., 1994, p. 24 e 25.)
Nota um dos elementos bsicos da viso estratgica de servios e a nfase deve ser dada
em fatores comportamentais, como o que o cliente pensa e age.
Cf. elementos bsicos da viso estratgica de servios; viso estratgica de servios




433


servio sm
Resultado gerado pela atividade humana na interface fornecedor/cliente que, sem
assumir a forma de um bem material, satisfaz uma necessidade do mesmo.
A interface com freqncia sustentada por um setor de "suporte", que vai elaborar
os processamentos fsicos e acompanhar a prestao: a confeco de documentos,
transaes, tratamentos de dossis, anlise de laboratrio, preparao de refeies...
Fazendo um paralelo com a produo industrial, alguns autores denominam este
conjunto um <servio>, estranho cruzamento entre servio e produo que evoca ao
mesmo tempo seduo e servido. (TEBOUL, J., 1991, p. 198.)
Nota Composio por justaposio simples entre servio e produo.
Sua origem creditada a Pierre Eiglier e Eric Langeard, autores de livro homnimo
publicado em 1987 pela McGraw-Hill de Paris, Frana.
Cf. interface

servio ampliado sm
Fras. prestao de servios ampliados
Produto da atividade humana que se agrega ao servio ncleo para aumentar os
benefcios proporcionados aos clientes.
Quando se adiciona a este servio essencial "algo mais", ento se diz que estamos
ampliando o servio. O servio ampliado quando se tem este algo mais. Hoje em dia
h uma tendncia em se enfatizar o <servio ampliado>. (LAS CASAS, A. L., 1999,
p. 186.)
Cf. servio ncleo

servio bancrio sm
Var. servio do banco
Fras. cliente de servio bancrio
Atividade caracterizada pela execuo de tarefas consideradas independentemente dos
itens aos quais se refiram.
Num pas altamente desenvolvido como os Estados Unidos, mais e mais servios so
tratados pelo consumidor como necessidades de "sobrevivncia". Por exemplo, o
<servio bancrio> deixou de ser encarado como luxo. O mximo retorno do




434


investimento torna-se um requisito para o bem-estar do consumidor. // Clientes que
esperam em bancos recebendo informaes sobre os <servios do banco>, por
exemplo, atravs de aparelhos de vdeo, talvez tomem mais conhecimento da
passagem do tempo do que outros. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p.
349. // HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 157.)
Sin. servio financeiro
Cf. tarefa

servio de massa sm
Fras. processo de servio de massa
Produto da atividade humana que, sem assumir a forma de um bem material, exige
baixa personalizao e altos nveis de contato com os clientes.
Os extremos, o servio profissional e a fbrica de servios so claros, explicando
(sem necessariamente coment-las) as diferenas no "mix" de recursos humanos para
cada uma delas. quando nos voltamos para o servio tecnolgico ou o <servio de
massa> que a prtica gerencial se torna menos clara. (HESKETT, J. L.; SASSER
JR., W. E.; HART, C. W. L., 1994, p. 239.)
Nota Dentro da classificao dos servios, nessa diviso o recrutamento exige um esforo
amplo, com base em habilidades humanas e atitude, o treinamento realizado no
trabalho, com pouco ou nenhum exemplo, as atribuies visam a tarefas especficas
no cobertas, a remunerao modesta, com base no tempo no cargo e o objetivo
minimizar a complexidade do trabalho e tempo de treinamento necessrio para
substituies freqentes.
Cf. classificao dos servios

servio essencial sm
Fras. qualidade do servio essencial
Produto da atividade humana que a organizao deve fazer bem feito como base de
sua comercializao para obter a qualidade na essncia.
H uma orientao estratgica bsica que em poca de crise, quando h escassez, os
recursos devem ser concentrados e no dispersados. A concentrao naquilo que a
empresa faz melhor. Fazer melhor, bem feito, significa que a nfase deve ser dada no




435


produto ou <servio essencial> ou servio ncleo, comercializado pela empresa.
(LAS CASAS, A. L., 1999, p. 187.)
Nota vlido para que se determine o nvel de atributos que esto sendo esperados ou
desejados pelos consumidores de determinado mercado-alvo.
Sin. servio ncleo

servio financeiro sm
Atividade caracterizada pela execuo de tarefas consideradas independentemente dos
itens aos quais se refiram.
Quando fala sobre o Banc One, o Diretor Executivo John B. McCoy no se lembra
precisamente quantos bens ou mesmo quantas subsidirias a sua promissora
"holding" bancria regional tem. Ao invs disso, ele est interessado em idias para
ampliar a esfera de ao dos <servios financeiros> e de informaes de sua
empresa. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 21.)
Sin. servio bancrio
Cf. tarefa

servio individual sm
Conjunto de cada um dos passos necessrios para a concluso de um servio.
Transaes de servios (o nmero de <servios individuais> necessrios para a
concluso, a natureza dos <servios individuais> necessrios para a concluso,
quantidade de pessoas necessrias para a concluso, durao padro e persistncia
das operaes. (ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 366.)

servio interno sm
Fras. gesto dos servios internos
Produto da atividade humana que, sem assumir a forma de um bem material,
executado internamente nas organizaes com base nos enfoques contbil,
organizacional, operacional e direcionado ao mercado.
O enfoque contbil concentra sua ateno na minimizao dos custos gerados pelos
<servios internos>. Este enfoque teria nascido da supervalorizao dos mtodos de
contabilidade de custos. O foco gerencial seria o de estimar os custos indiretos




436


gerados por <servios internos> e aloc-los aos usurios, segundo critrios de rateio
baseados em utilizao. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 26.)
Nota A incapacidade ou inconvenincia de gerenci-lo tem levado muitas organizaes a
contrat-lo, em uma tendncia denominada terceirizao.
Cf. terceirizao

servio ncleo sm
Var. servio-ncleo
Produto da atividade humana que a organizao deve fazer bem feito como base de
sua comercializao para obter a qualidade na essncia.
Por isso, fao alguns comentrios no Captulo 10, onde aponto certos problemas na
aplicao de qualidade total no Brasil. Um desses principais problemas que no
podemos descuidar do <servio ncleo>, ou seja, devemos concentrar nossas
atenes nas atividades bsicas de uma empresa. A est o primeiro ponto a ser
melhorado e em muitos setores dos servios brasileiros j se constitui em importante
diferencial. (...) A qualidade total gerada a partir das expectativas dos clientes.
Clientes do primeiro mundo em muitos setores recebem <servios-ncleos> de boa
qualidade. (LAS CASAS, A. L., 1999, p. 9 e 187.)
Nota vlido para que se determine o nvel de atributos que esto sendo esperados ou
desejados pelos consumidores de determinado mercado-alvo.
Sin. servio essencial

servio perceptvel sm
Produto da atividade humana onde os especialistas devem identificar os atributos que
so considerados pelos consumidores como aqueles que satisfaam de certa forma os
benefcios-ncleos que esto procurando.
As organizaes nesses casos aumentam o nvel de <servio perceptvel> para
atender aos desejos adicionais dos clientes ou diferenciam seus servios da
concorrncia. Albrecht chamou de primrios os servios-ncleo e de secundrios os
servios aumentados, conforme mencionados no Captulo 9, Servios Profissionais.
(LAS CASAS, A. L., 2000, p. 69.)
Nota vlido para que se determine o nvel de atributos que esto sendo esperados ou




437


desejados pelos consumidores de determinado mercado-alvo.

servio profissional sm
Fras. marketing de servio profissional
Produto da atividade humana que, sem assumir a forma de um bem material, exige
alto grau de personalizao e contato com os clientes.
Os extremos, o <servio profissional> e a fbrica de servios so claros, explicando
(sem necessariamente coment-las) as diferenas no "mix" de recursos humanos para
cada uma delas. quando nos voltamos para o servio tecnolgico ou o servio de
massa que a prtica gerencial se torna menos clara. (HESKETT, J. L.; SASSER JR.,
W. E.; HART, C. W. L., 1994, p. 239.)
Nota Dentro da classificao dos servios, nessa diviso o recrutamento altamente
seletivo, com base em habilidades tcnicas e humanas, o treinamento realizado em
escolas profissionais e no trabalho, com atualizaes peridicas, as atribuies visam a
equilibrar a necessidade de servir os clientes, a remunerao alta, com base no valor
dos produtos para os mesmos e o objetivo conseguir especializao por meio de
rotatividade mnima.
Cf. classificao dos servios

servio revolucionrio sm
Fras. empresa de servio revolucionrio
Produto da atividade humana que, sem assumir a forma de um bem material,
revolucionou as regras do jogo competitivo em seus setores por meio de novos
padres para, com consistncia, exceder as necessidades e expectativas de seus
clientes.
Um <servio revolucionrio> significativamente diferente de seus concorrentes,
tanto em relao aos critrios importantes para os clientes, como pela maneira que
atinge seus resultados, seja pelo seu conceito de servio bem definido, focalizado e
bem posicionado; uma organizao altamente comprometida; uma completa base de
dados; uma rede ou tecnologia difcil de copiar, bom suporte financeiro, ou outras
caractersticas. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p.
IX.)




438


Nota percebido pelos clientes como sendo de qualidade excepcional, seja em termos de
velocidade, preciso ou outras caractersticas, gerando um valor extremamente alto.

servio substituto sm
Produto da atividade humana que procura atender parte fundamental do conjunto de
necessidades dos clientes, constituindo, entretanto, servios diferentes daqueles
oferecidos pela concorrncia.
Dessa forma, uma reao adequada ameaa de <servios substitutos> buscar a
excelncia naqueles fatores que o segmento de consumidores pretendido prioriza e
que o <servio substituto> no prov. Esta excelncia s pode ser obtida atravs da
completa satisfao do consumidor em relao a suas expectativas, tarefa em que a
importncia da funo de operaes fundamental. (GIANESI, I. G. N.; CORRA,
H. L., 1996, p. 58.)
Nota Sua identificao inicia-se na determinao da parte fundamental do conjunto de
necessidades, o que pode ser realizado por meio da desagregao do servio nos
componentes do pacote que o forma.

servio tecnolgico sm
Produto da atividade humana que, sem assumir a forma de um bem material, exige
baixo contato com os clientes, com a prestao sendo realizada eletronicamente,
centrada em tecnologia.
Os extremos, o servio profissional e a fbrica de servios so claros, explicando
(sem necessariamente coment-las) as diferenas no "mix" de recursos humanos para
cada uma delas. quando nos voltamos para o <servio tecnolgico> ou o servio de
massa que a prtica gerencial se torna menos clara. (HESKETT, J. L.; SASSER JR.,
W. E.; HART, C. W. L., 1994, p. 239.)
Nota Dentro da classificao dos servios, nessa diviso o recrutamento altamente
seletivo, com base em qualificao tecnolgica, o treinamento realizado antes da
seleo, com seminrios atualizados orientados tecnologicamente, as atribuies
visam a tarefas especficas no cobertas, a remunerao varivel, com base em
habilidades tecnolgicas, e o objetivo minimizar a rotatividade para conseguir
especializao tecnolgica e continuidade.




439


Cf. classificao dos servios

servio total sm
Produto da atividade humana que, sem assumir a forma de um bem material,
executado por todos os colaboradores da organizao de servios.
Segundo a dimenso do grau de participao do cliente, os servios podem ser vistos
como uma seqncia de transaes, as quais podem classificar-se em algum ponto
entre os extremos: <servio total>, em que todas as atividades so executadas pelo
servidor, seja em front office ou back room, e auto-servio (self-service), em que
quase todas as atividades so executadas pelo cliente, cabendo ao servidor apenas a
preparao. (GIANESI, I. G. N.; CORRA, H. L., 1996, p. 43.)

servios sm
Fras. rea de servios; servios complementares
Resultado gerado da atividade humana na interface fornecedor/cliente que, sem
assumir a forma de um bem material, satisfaz uma necessidade do mesmo.
Os nmeros acima mostram claramente que, porque existem tantas pessoas
envolvidas em <servios> nos Estados Unidos, a melhora de nosso padro de vida
depende muito da melhor qualidade e produtividade do setor de <servios>. // Ao
contrrio dos produtos fsicos que podem, por exemplo, ser manufaturados no vero
para serem vendidos no inverno, os <servios> devem ser normalmente gerados no
momento em que clientes desejam receb-los. Alm disso, os <servios> devem ser
geralmente criados ou oferecidos na localidade do cliente. (DEMING, W. E., 1990, p.
137. // ZIMMERMAN, C. D. III; ENELL, J. W., 1991, p. 310.)
Nota o trabalho desempenhado por algum, que pode ser dirigido a um consumidor, a
uma instituio ou a ambos. Alm disso, alguns existem para oferecer alternativas que
so superiores em termos de custo, tempo e convenincia. Pode-se ainda mencionar
que outros existem para satisfazer uma enorme variedade de necessidades humanas,
psicolgicas e fisiolgicas.
Cf. interface






440


servios customizados sm
Fras. servios customizados maciamente
Resultado gerado da atividade humana na interface fornecedor/cliente, dentro do
sistema de customizao macia, onde h uma personalizao da prestao do servio
em massa.
<Servios customizados> que podem ser executados sobre informao padro
incluem personalizar, categorizar, generalizar, analisar, integrar, reembalar,
facilitar, monitorar, filtrar, localizar e combinar, para no mencionar tornar a
informao conveniente e imediatamente acessvel quando quer que e onde quer que
um cliente a queira. (PINE II, B. J., 1994, p. 190.)
Cf. customizao macia; servios personalizados

servios de comparao sm
Atividades caracterizadas pela execuo de tarefas que exigem capacidade profissional
do vendedor e que so compradas aps verificao de preos, pois o ganho provvel
de se fazerem comparaes suficientemente grande para justificar uma investigao
mais cuidadosa.
Os <servios de comparao> so, muitas vezes, comprados aps alguma pesquisa
com a finalidade de comparar preo, qualidade e adequao com o custo da pesquisa.
So, por exemplo, os consertos de automveis, o seguro e certos servios bancrios
em que o ganho provvel de se fazer comparaes suficientemente grande para
justificar uma investigao mais cuidadosa. (TOLEDO, G. L., 1978, p. 32.)
Nota uma traduo do emprstimo em ingls shopping services.
uma das trs formas de caracterizao dos servios ao consumidor.
Cf. servios de convenincia; servios especiais

servios de convenincia sm
Atividades caracterizadas pela execuo de tarefas que exigem o mnimo de
capacidade profissional do vendedor e que so oferecidas a preos baixos.
Os <servios de convenincia> so, em geral, aqueles servios corriqueiros, do tipo
tinturaria, sapataria, pequenos consertos, os quais so comumente comprados com
base na convenincia e comodidade do consumidor, para o qual o ganho resultante de




441


comparaes baseadas no preo e na qualidade baixo relativamente ao custo de sua
pesquisa particular. (TOLEDO, G. L., 1978, p. 32.)
Nota uma traduo do emprstimo em ingls convenience services.
uma das trs formas de caracterizao dos servios ao consumidor onde a demanda
busca a oferta sem a necessidade de investimentos em marketing.
Cf. servios de comparao; servios especiais

servios especiais sm
Atividades caracterizadas pela execuo de tarefas que exigem alta capacidade
profissional do vendedor e que so compradas aps verificao de aspectos subjetivos.
Os <servios especiais> incluem um nmero de servios maior que o anterior.
Referem-se a servios altamente tcnicos e especializados, como os servios
profissionais de assistncia mdica, de assistncia legal e de assistncia financeira.
(TOLEDO, G. L., 1978, p. 32.)
Nota uma traduo do emprstimo em ingls specialty services.
uma das trs formas de caracterizao dos servios ao consumidor.
Cf. servios de comparao; servios de convenincia

servios facilitadores sm
Atividades criadas para auxiliar o processo de comercializao de bens que passaram a
ser oferecidas como geradoras de lucro para as organizaes.
Uma tendncia verificada nos ltimos anos tem sido a de que muitos servios que
originalmente foram criados para auxiliar o processo de comercializao de bens,
denominados <servios facilitadores>, passaram a ser oferecidos como atividades
geradoras de lucro para as empresas, inclusive gerando a criao de unidades de
negcio separadas das organizaes que lhe deram origem. (GIANESI, I. G. N.;
CORRA, H. L., 1996, p. 28.)
Nota Podem ser atividades de consultoria, crdito, transporte e distribuio, instalao,
treinamento e manuteno.







442


servios humanos sm
Resultados gerados a partir da atividade humana e endereados ao ser humano na
interface fornecedor/cliente que, sem assumir a forma de um bem material, satisfazem
uma necessidade do cliente.
Um arranjo fsico de m qualidade aquele que coloca as pessoas distantes do local
para onde seu trabalho vai em seguida. Nos <servios humanos>, o cliente o
"trabalho". Ser que a maioria dos clientes vai de sala em sala (e de fila de espera em
fila de espera) para receber um tratamento, obter uma licena ou registrar uma
queixa? Se a resposta for sim, ento trata-se de um mau arranjo fsico.
(SCHONBERGER, R. J., 1992, p. 41.)
Cf. interface

servios industriais sm
Atividades caracterizadas pela execuo de tarefas destinadas venda a organizaes
industriais, comerciais ou institucionais, que as adquirem para o desempenho de suas
prprias atividades.
Alguns <servios industriais> destinam-se a aumentar ou a facilitar o desempenho
das entidades que deles se utilizam, como transporte, comunicao e energia eltrica;
outros proporcionam sua contribuio ao nvel do processo de tomada de deciso,
como, por exemplo, consultorias, servios legais, propaganda e servios bancrios em
geral. (TOLEDO, G. L., 1978, p. 33.)

servios personalizados sm
Fras. servios personalizados em massa
Resultado gerado da atividade humana na interface fornecedor/cliente dentro do
sistema de customizao macia.
Na indstria de aluguis de carros, a Hertz Corporation tambm agregou <servios
personalizados> em torno de seus servios de utilidade padro. Por muito tempo ela
teve um servio "expresso" para diminuir o tempo de processamento de um aluguel
aos seus melhores clientes. Em 1990, agregou o servios Hertz #1 Club Gold para
individualizar completamente a experincia de aluguis de carros. (PINE II, B. J.,
1994, p. 189.)




443


Nota Os cinco mtodos bsicos para alcanar essa meta so personalizar servios em torno
de produtos e servios padronizados, criar produtos e servios customizveis, prover
pontos de entrega de customizao, fornecer respostas rpidas por toda a cadeia de
valor e modularizar componentes para customizar produtos finais e servios.
Cf. customizao macia; interface

setor bancrio sm
Parte da economia cuja atividade consiste na guarda e emprstimo de dinheiro,
transaes com ttulos de crdito e venda de servios.
Eles tm um impacto abrangente e impressionante sobre o futuro do <setor
bancrio>. Com a concentrao das inspees em itens crticos, tais como os de
grande valor monetrio, e verificao por amostragem dos demais itens, pode-se
obter maior exatido com reduo da quantidade de inspeo. (DEMING, W. E.,
1990, p. 167.)
Sin. bancos

setor de servios sm
Fras. setor de prestao de servios; setor industrial de servios
Parte da economia responsvel pela execuo de tarefas que objetivam atender a
terceiros dentro ou fora da organizao.
Com o tempo, a melhora da qualidade atingir no apenas a produo de bens e
alimentos, como tambm o <setor de servios> (hotis, restaurantes, transporte de
cargas e passageiros, estabelecimentos bancrios, etc.) (DEMING, W. E., 1990,
p.10.)
Sin. campo de servios

sistema sm
Fras. sistema-fim; sistema-meio
Srie de funes ou atividades em um organismo, que trabalha em conjunto em prol de
seu objetivo.
Um fluxograma til para compreender um <sistema>. Comprendendo-o, pode-se
traar as diferentes conseqncias de uma mudana proposta. (DEMING, W. E.,




444


1990, p. XIX.)

sistema americano de produo sm
Var. sistema americano
Srie de funes com foco no final da produo/prestao de servios, imitao e no
inveno, com base nos colaboradores, maquinrio e fluxo de materias.
O <Sistema Americano>, um mtodo de produo extremamente bem-sucedido de
meados para o fim do sculo XIX, foi objeto de cobia por parte dos rivais europeus.
Apesar de nenhuma companhia isolada ter sido um modelo perfeito na aplicao
dessas oito caractersticas - peas permutveis, mquinas especializadas, confiana
nos fornecedores, foco no processo de produo, diviso do trabalho, habilitao dos
trabalhadores, flexibilidade e aperfeioamento tecnolgico contnuo -, elas definem
precisamente o <Sistema Americano de Produo> e foram responsveis pelo seu
sucesso. (PINE II, B. J., 1994, p. 16.)
Nota Ele surge nos Estados Unidos da Amrica em meados do sculo XIX como oposio
ao modo de produo da Inglaterra, que era fabril desde a Revoluo Industrial.

sistema da qualidade sm
Sigla SQ
Var. sistema de qualidade
Fras. sistema de gesto estratgica da qualidade; sistema de qualidade total
Conjunto formado pela estrutura organizacional, procedimentos, processos e recursos
para a implantao da gesto pela qualidade total, com garantia de que os
servios/produtos vo satisfazer as necessidades explcitas e implcitas dos clientes de
acordo com a misso da empresa.
A qualidade total parte do pressuposto de um trabalho obstinado de controle e
aperfeioamento do <sistema da qualidade>. A experincia acumulada conta mais
que o resultado, em alguns momentos. A administrao deve ajudar a todos a
conhecer e a compreender melhor o seu processo, a perceber e a controlar os
parmetros essenciais que explicam os resultados. // Os principais responsveis por
um <sistema de qualidade> so os administradores. O sucesso da iniciativa depende
muito do seu compromisso com o desenvolvimento e operao efetiva do <sistema de




445


qualidade>. (TEBOUL, J., 1991, p. 192. // LAS CASAS, A. L., 1999, p. 149.)
Nota documentado por meio de um manual da qualidade que o define em sua totalidade e
deve abranger apenas os tpicos necessrios para atingir os objetivos da qualidade.
Sin. sistema de garantia da qualidade (SGQ)
Cf. gesto pela qualidade total (GQT); manual da qualidade (MQ); misso da
empresa

sistema de distribuio de servios sm
Elemento do marketing mix que proporciona satisfao de tempo e de lugar,
auxiliando o usurio a adquirir o servio no tempo e lugar adequados, sem
necessidades de estocagem e outros elementos de logstica.
Essas so apenas algumas das vantagens dos intermedirios no <sistema de
distribuio de servios>. Percebe-se que elas so benficas tanto para os clientes
como para os intermedirios e fornecedores. Em princpio o intermedirio, no
obstante crticas existentes, serve apenas para beneficiar o setor, contribuindo mais
com o marketing na rea de servios. (LAS CASAS, A. L., 2000, p. 92.)
Nota Ele proporciona vantagens como a de ser um elemento central para coordenar o
processo e equilibrar ofertas e demandas heterogneas entre a diversidade de ofertas
do lado do fornecedor e os desejos e necessidades do lado do cliente.
Cf. marketing mix

sistema de garantia da qualidade sm
Sigla SGQ
Conjunto formado pela estrutura organizacional, procedimentos, processos e recursos
para a implantao da gesto pela qualidade total, com garantia de que os
servios/produtos vo satisfazer as necessidades explcitas e implcitas dos clientes de
acordo com a misso da empresa.
A partir de 1994, os bancos em operao no Brasil iniciaram movimentao rumo
adoo dos <Sistemas de Garantia da Qualidade (SGQ)>, sua certificao de
conformidade com as Normas ISO 9000 e divulgao da conquista. (ALMEIDA, R.
C. de, 1998, p. 13.)
Nota documentado por meio de um manual da qualidade que o define em sua totalidade e




446


deve abranger apenas os tpicos necessrios para atingir os objetivos da qualidade.
Sin. sistema da qualidade (SQ)
Cf. gesto pela qualidade total (GQT); manual da qualidade (MQ); misso da
empresa

sistema de informao da qualidade sm
Sigla SIQ
Var. sistema de informao para a qualidade
Conjunto sistemtico que tem por objetivos coletar, processar, analisar, informar e
armazenar informaes sobre a qualidade, de forma a subsidiar tomada de decises em
todos os nveis.
A necessidade foi aqui conceituada como fator gerador de todas as coisas. Qual,
ento, a necessidade de um <sistema de informaes da qualidade> para o executivo
ou para o administrador de uma empresa? Na realidade, a necessidade est em que
eles devem ser competentes para gerar um conjunto de normas e procedimentos que,
objetivando reduzir incertezas, aproxime as pessoas e os grupos do caminho da
produtividade mxima da empresa. (...) Assim que neste texto, onde se pretende
estabelecer princpios e mtodos para gesto da qualidade, a preocupao ser pelo
reservatrio de conhecimento acumulado pela empresa, ou seja, pelo <sistema de
informao para a qualidade>. (CERQUEIRA NETO, E. P. de, 1993, p. 88 e 91.)
Nota Deve ser projetado para atender s necessidades especficas de cada organizao e
includo no programa de auditoria da qualidade com sua preciso aplicando-se aos
dados numricos e referindo-se ao nmero de dgitos includos nos dados-fonte.

sistema de informao de marketing sm
Sigla SIM
Conjunto sistemtico dos recursos humanos e tecnolgicos da organizao envolvido
de forma sistemtica na coleta, qualificao, anlise, disseminao e arquivo de dados
relevantes s decises de marketing.
A idia do <sistema de informaes de marketing> proveniente do sistema militar.
As decises militares do maior escalo passaram a ser tomadas muito longe dos
campos de batalhas e estes militares estavam totalmente dependentes de informao




447


de outros para o comando. A velocidade com que estas informaes se modificam
outro fator que justifica o crescimento do <SIM>. (LAS CASAS, A. L., 2000, p. 182.)
Cf. marketing

sistema de marketing sm
Fras. sistema de marketing da organizao; sistema global de marketing
Conjunto sistemtico que tem por objetivo certas tarefas logsticas, como
armazenagem, transporte e controle de estoques de forma a subsidiar tomada de
decises em todos os nveis hierrquicos da organizao.
Uma das caractersticas da comercializao e da escolha de canais de distribuio
para produtos refere-se disponibilidade, por parte do executivo, de um <sistema de
marketing> que evoluiu atravs dos anos em relao a seu produto em particular.
Qualquer diferena porventura existente apenas de grau. Na comercializao de
servios no ocorre o mesmo, em razo da no-existncia de canais tradicionais bem
como da reduo ou, eventualmente, da eliminao de certas atividades
administrativas de marketing. (TOLEDO, G. L., 1978, p. 46.)
Nota Deve ser concebido como uma abstrao de elementos, selecionados a partir de um
conjunto de instituies significantes e dos fluxos que ligam uma organizao com o
seu mercado, preocupadas que esto com o desenvolvimento, promoo e distribuio
dos bens e servios da comunidade.

sistema de medio sm
Conjunto sistemtico de elementos fsicos necessrios efetivao do processo de
teste em determinadas condies.
Para acompanhar a execuo do servio, aconselhvel o desenvolvimento de um
<sistema de medio> que possibilitar dados histricos, documentados. Aps estes
dados terem sido apurados, possvel ento analis-los em conjunto com os dados da
pesquisa e chegar a nveis altos razoveis sobre os servios desempenhados pelos
empregados e pela organizao de servio como um todo. (ZIMMERMAN, C. D. III;
ENELL, J. W., 1991, p. 355.)
Nota Sua meta principal medir o nvel de desempenho, mas quando se tratar de um
programa da qualidade em andamento, no necessrio analisar e registrar a qualidade




448


de cada servio prestado, bastando para isso estabelecer um programa de amostragem
aleatria.
Cf. amostragem aleatria; programa da qualidade

sistema de operaes sm
Fras. sistema de operaes de servio
Conjunto de atividades humanas responsvel por produzir os produtos/prestar os
servios de uma organizao.
Estabelecer diferenas, portanto, entre empresas, ou procurar classificar empresas
nesta ou naquela categoria, parece sem sentido. Contudo, estabelecer diferenas entre
<sistemas de operaes>, que apresentando determinadas caractersticas, iro
requerer determinado tipo de direcionamento gerencial especfico, til e oportuno,
principalmente se reconhecermos que uma empresa pode conter mais de uma
configurao de <sistema de operaes>. (GIANESI, I. G. N.; CORRA, H. L.,
1996, p. 32.)
Nota Ele necessita de objetivos definidos, pois deve conter um processo de transformao e
um sistema de controle.
Sin. funo de operaes

sistema de prestao de servios sm
Conjunto sistemtico de instalaes no qual o resultado de atividades de interface
entre fornecedor e clientes, a fim de satisfazer suas necessidades, vai ser oferecido e
prestado.
As agncias so impressionantemente silenciosas, sem o grande nmero de
depositantes que se aglomeram nas instalaes de seus concorrentes. Caras obras de
arte comparadas por Adam Aronson decoram as paredes. E onze dos bancos tm suas
prprias cozinhas com seus "gourmets". Como um todo, no se assemelha aos
<sistemas de prestao de servios> de outros bancos. (HESKETT, J. L.; SASSER
JR., W. E.; HART, C. W. L., 1994, p. 23.)
Nota um dos elementos bsicos da viso estratgica de servios e funciona como um
mtodo de aprimoramento e controle da qualidade dos resultados obtidos pelos
consumidores.




449


Cf. controle da qualidade (CQ); elementos bsicos da viso estratgica de servios;
viso estratgica de servios

sistema de prestao de servios opo fixa sm
Conjunto sistemtico de instalaes no qual o resultado de atividades de interface
entre fornecedor e clientes, a fim de satisfazer suas necessidades, vai ser oferecido e
prestado em redes poderosas que restringem a oportunidade do uso efetivo da
capacidade humana de julgamento na operao do sistema.
Outras tecnologias de <sistemas de prestao de servios opo fixa> possibilitam
que operadores inexperientes produzam excelentes batatas fritas no McDonald's,
controlem a disponibilidade de espao e direcionem o fluxo de trfego em
estacionamentos de aeroportos, e calculem o troco cmbio exato em balces de
varejo. (HESKETT, J. L.; SASSER JR., W. E.; HART, C. W. L., 1994, p. 205.)
Cf. interface

sistema de produo em massa sm
Var. produo em massa
Conjunto sistemtico de funes com foco no fluxo estvel de produo/prestao de
servios e eficincia operacional da linha de montagem, maquinrio especializado,
trabalho dos colaboradores e grandes economias de escala por meio dos
produtos/servios padronizados.
Embora a padronizao de produto tenha atingido o apogeu com Ford, um preceito
permanente do <Sistema de Produo em Massa> fabricar produtos padronizados
para mercados homogneos. Uma das razes primrias da <Produo em Massa>
(bem como do Sistema Americano), desenvolvida to extensivamente nos Estados
Unidos, foi o mercado americano sempre ser mais homogneo que os mercados de
pases industrializados da Europa. (PINE II, B. J., 1994, p. 19.)
Nota Sua origem creditada a Henry Ford e outros colaboradores em substituio ao
sistema americano de produo e que teve incio no sculo XX, por volta de 1920.
Cf. sistema americano de produo






450


sistema de produo interface/suporte sm
Conjunto sistemtico de procedimentos, documentos e dados inter-relacionados em
uma organizao de servios com o objetivo de atender s necessidades do cliente.
Segundo o segmento da clientela visada e a frmula escolhida, o <sistema de
produo interface/suporte> tomar feies diferentes. Examinemos como exemplo
trs modelos: o restaurante clssico, o restaurante Benihana e o restaurante do tipo
Mc Donald. (TEBOUL, J., 1991, p. 199.)
Cf. atender s necessidades do cliente

sistema de servios sm
Conjunto sistemtico de funes ou atividades em um organismo que pressupe a
entrega dos servios depois de definida a estratgia e o pacote a ser oferecido.
A questo da criao de um mtodo ou <sistema de servios> foi levantada por Karl
Albrecht. Segundo o autor, o que compe um <sistema de servios> so as
facilidades fsicas que o cercam, como os cenrios, atraes, servios
complementares, etc., alm das partes menos visveis, como a compra dos produtos,
os estoques, as subcontrataes e os transportes. (LAS CASAS, A. L., 2000, p. 160.)

sistema estvel sm
Conjunto sistemtico de arranjo pr-ordenado de componentes inter-relacionados que
atuam sem instabilidade para realizar uma funo em um ambiente particular dentro
de um perodo determinado.
Quando se tem um <sistema estvel>, no adiantar nada especificar um objetivo. S
se obtm o que o sistema capaz de proporcionar. Um objetivo fora do alcance do
sistema jamais ser alcanado. (DEMING, W. E., 1990, p. 57.)

sistema flexvel sm
Conjunto sistemtico de funes ou atividades em um organismo, que forma a base
para uma excelente execuo por meio da customizao do servio e da capacidade
que pode ser ajustada, permitindo que as organizaes ofeream um servio sob
medida para as solicitaes dos clientes.
Empresas de prestao de servio excelente compreendem a necessidade de




451


<sistemas flexveis>. Compreendem a natureza humana e os negcios como um
interao dinmica e no como um sistema rgido. Intuitivamente, se utilizam de
recursos "escondidos" e evidenciam pouca ansiedade durante o caos. (BERRY, L. L.,
2001, p.104.)
Nota Operacionalmente, devem ser definidos os elementos do servio a sofrerem
padronizao por questes de segurana e legais e, em torno destas definies,
estabelecido lugar para solues, o que permite que os prestadores de servios pensem
e adaptem seus desempenhos.

sistema Ringi sm
Conjunto sistemtico de tomada de deciso em que a circulao de documentos ocorre
por toda a organizao, a partir dos colaboradores de nvel hierrquico inferior.
Tomada de deciso: muito conhecido no ocidente que os japoneses so lentos nas
decises e rpidos na execuo enquanto que geralmente ocorre o contrrio no
ocidente. O fato pode ser melhor compreendido, pois eles usam o <sistema "Ringi">,
(...) Todos esses sistemas participativos (<"Ringi">, CCQ, grupos de trabalho, etc.)
contribuem para o aumento do moral e da produtividade dos trabalhadores.
(YOCHINAGA, C., 1988, p. 9.)
Nota Sua utilizao possibilita uma introduo mais rpida das decises tomadas, pois cada
qual j efetuou anlises prvias detalhadas.

sistema self-service sm
Conjunto sistemtico de funes ou atividades de uma organizao em que o cliente
presta o servio a si mesmo.
Isso tem levado ao projeto de servios que incorporam cada vez mais <sistemas "sef-
service">, porm a preos maiores do que os concorrentes que prestam servio
completo. No caso da venda de mveis, ns estamos comeando a aprender que, para
muitos clientes, o acesso imediato aos mveis tem valor. Alm disso, com freqncia
eles ignoram ou subestimam os custos de aquisio, resultando em uma percepo
positiva dos custos do <sistema "self-service">. (HESKETT, J. L.; SASSER JR., W.
E.; HART, C. W. L., 1994, p. 9.)





452


software sm
Conjunto de diretrizes, normas, procedimentos, instrues e mtodos de trabalho
utilizados por uma organizao para cumprir sua funo.
Nas empresas japonesas, os altos gerentes esto comprometidos com o TQC,
tornando-o interesse da empresa inteira, em vez de um servio solitrio do gerente de
CQ. TQC significa que os esforos de CQ devem envolver as pessoas, a organizao,
o hardware e o <software>. (IMAI, M., 1992, p. 40.)
Nota Emprstimo do ingls cuja traduo procedimento.
Sua utilizao concentra-se na