Você está na página 1de 329

Protocolos e mtodos de

anlise em laboratrios de
biotecnologia agroalimentar
e de sade humana
Raul Antonio Sperotto
(Organizador)

Raul Antonio Sperotto


(Organizador)

Protocolos e mtodos de
anlise em laboratrios de
biotecnologia agroalimentar e
de sade humana

1 edio

Lajeado, 2014

Biotecnologia

SUMRIO

Centro Universitrio UNIVATES


Reitor: Prof. Me. Ney Jos Lazzari
Pr-Reitor de Pesquisa, Extenso e Ps-Graduao: Prof. Me. Carlos Cndido da Silva Cyrne
Pr-Reitora de Ensino: Prof Ma. Luciana Carvalho Fernandes
Pr-Reitora de Ensino Adjunta: Prof Ma. Daiani Clesnei da Rosa
Pr-Reitora de Desenvolvimento Institucional: Prof Dr Jlia Elisabete Barden
Pr-Reitor Administrativo: Prof. Me. Oto Roberto Moerschbaecher

Editora Univates
Coordenao e Reviso Final: Ivete Maria Hammes
Editorao: Glauber Rhrig e Marlon Alceu Cristfoli
Capa: Marlon Alceu Cristfoli
Conselho Editorial da Univates Editora
Titulares Suplentes
Adriane Pozzobon
Simone Morelo Dal Bosco
Augusto Alves
Ieda Maria Giongo
Beatris Francisca Chemin
Rogrio Schuck
Fernanda Cristina Wiebusch Sindelar Ari Knzel
Avelino Tallini, 171 - Bairro Universitrio - Lajeado - RS, Brasil
Fone: (51) 3714-7024 / Fone/Fax: (51) 3714-7000
editora@univates.br / http://www.univates.br/editora

P967 Protocolos e mtodos de anlise em laboratrios de biotecnologia


Protocolos e mtodos de anlise em laboratrios de biotecnologia
agroalimentar e de sade humana / Raul Antonio Sperotto (Org.) Lajeado : Editora da Univates, 2014.
329 p.:
ISBN 978-85-8167-077-5
1. Biotecnologia 2. Prticas de laboratrio I. Ttulo
CDU: 57.08
Catalogao na publicao Biblioteca da Univates

As opinies e os conceitos emitidos, bem como a exatido,


adequao e procedncia das citaes e referncias, so de
exclusiva responsabilidade dos autores.

Biotecnologia

SUMRIO

CURRCULO DOS AUTORES


Adriana Ambrosini da Silveira
Biloga, doutora em Gentica e Biologia Molecular (UFRGS), ps-doutoranda do Departamento
de Gentica (UFRGS) (http://lattes.cnpq.br/4636000029112033).
Adriane Pozzobon
Biloga, doutora em Cincias Biolgicas (Fisiologia - UFRGS), professora do Centro de Cincias
Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do
Centro Universitrio UNIVATES (http://lattes.cnpq.br/5326585242755050).
Aline Marjana Pavan
Acadmica do curso de Cincias Biolgicas do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/0811332135994458).
Andressa Dametto
Biloga, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/1249822214187049).
ngela Gerhardt
Acadmica do curso de Farmcia do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/0841500995401008).
ngela Maria Schorr-Lenz
Biloga, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/3812332236676109).
Anglica Vincenzi
Acadmica do curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/5380183879387576).
Brbara Parraga da Silva
Acadmica do curso de Farmcia do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/3582106380302090).
Bruna Caye
Acadmica do curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/9481761048475826).
Camile Wnsch
Acadmica do Curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/6131793092812460).
Camille Eichelberger Granada
Engenheira de Bioprocessos e Biotecnologia, doutora em Gentica e Biologia Molecular (UFRGS),
professora do Centro de Gesto Organizacional (CGO) do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/1836592557536308).

Biotecnologia

SUMRIO

Ctia Viviane Gonalves


Biloga, Mestre em Ecologia (UFRGS), professora do Curso Tcnico em Qumica e coordenadora
do Programa Interno de Separao de Resduos (PISR) do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/0531032456221369).
Cludia Stein
Acadmica do curso de Cincias Biolgicas do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/7439949615267705).
Claucia Fernanda Volken de Souza
Qumica Industrial, doutora em Biologia Celular e Molecular (UFRGS), professora do Centro
de Cincias Exatas e Tecnolgicas (CETEC) e do Programa de Ps-Graduao em Biotecnologia
(PPGBiotec) do Centro Universitrio UNIVATES (http://lattes.cnpq.br/4215540900949347).
Claudimar Sidnei Fior
Engenheiro Agrnomo, doutor em Fitotecnia (UFRGS), professor do Departamento de Horticultura
e Silvicultura e do Programa de Ps-Graduao em Fitotecnia (PPGFito) da Universidade Federal
do Rio Grande do Sul (UFRGS) (http://lattes.cnpq.br/7123252970342522).
Christina Venzke Simes de Lima
Biloga, doutora em Cincia do Solo (UFRGS), ps-doutoranda do Programa de Ps-Graduao
em Biotecnologia (PPGBiotec) do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/5107170428996876).
Dalana Faleiro
Acadmica do curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/2923943354106911).
Dbora Mara Kich
Biomdica, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/7806847826466246).
dina Aparecida dos Reis Blasi
Acadmica do curso de Cincias Biolgicas do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/2796217997488696).
Eduardo Cremonese Filippi-Chiela
Biomdico, doutorando do Programa de Ps-Graduao em Biologia Celular e Molecular
(PPGBCM) da Universidade Federal do Rio Grande do Sul (UFRGS)
(http://lattes.cnpq.br/0726009160227341).
Eduardo Miranda Ethur
Qumico Industrial, doutor em Qumica (UFSM), professor do Centro de Cincias Exatas e
Tecnolgicas (CETEC) e dos Programas de Ps-Graduao em Biotecnologia (PPGBiotec) e
Ambiente e Desenvolvimento (PPGAD) do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/0536800052883688).
Elisete Maria de Freitas
Biloga, doutora em Botnica (UFRGS), professora do Centro de Cincias Biolgicas e da Sade
(CCBS) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro Universitrio
UNIVATES (http://lattes.cnpq.br/7345668866571738).

Biotecnologia

SUMRIO

Felipe Klein Ricachenevsky


Bilogo, doutor em Biologia Celular e Molecular (UFRGS), ps-doutorando do Departamento de
Botnica (UFRGS) (http://lattes.cnpq.br/8426211793966484).
Fernanda Oliveira Diefenthaler
Acadmica do Curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/6782494373104028).
Giseli Buffon
Biloga, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES
(http://lattes.cnpq.br/5834242560363551).
Greici Raquel Wildner
Farmacutica, mestre em Biotecnologia (Centro Universitrio UNIVATES)
(http://lattes.cnpq.br/8813491136706454).
Guilherme Liberato da Silva
Bilogo, mestre em Fitossanidade (UFPel) e doutorando do Programa de Ps-Graduao em
Microbiologia Agrcola e do Ambiente (UFRGS) (http://lattes.cnpq.br/9587693374011290).
Guilherme Pinto Bertuzzi
Bilogo, mestre em Gentica e Biologia Molecular (UFRGS), professor de Biologia para Educao
Bsica (http://lattes.cnpq.br/3003425308133539).
Isabel Cristina Gouva de Borba
Biloga, mestre em Fisiologia Vegetal (UFPel), doutoranda do Programa de Ps-Graduao em
Botnica (UFRGS) (http://lattes.cnpq.br/0233191758488472).
Ivan Cunha Bustamante Filho
Mdico Veterinrio, doutor em Zootecnia - Produo Animal (UFRGS), professor do Centro
de Cincias Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia
(PPGBiotec) do Centro Universitrio UNIVATES (http://lattes.cnpq.br/5447836974424243).
Jorge Almeida Guimares
Mdico veterinrio, doutor em Cincias Biolgicas (Biologia Molecular) pela Escola Paulista
de Medicina (UNIFESP), professor da Universidade Federal do Rio Grande do Sul (UFRGS)
e do Programa de Ps-Graduao em Biologia Celular e Molecular (UFRGS). Presidente da
Coordenao de Aperfeioamento de Pessoal de Nvel Superior (CAPES)
(http://lattes.cnpq.br/7063936568198850).
Jlia Pasqualini Genro
Biloga, doutora em Gentica e Biologia Molecular (UFRGS), professora da Universidade Federal
de Cincias da Sade de Porto Alegre (UFCSPA) e do Programa de Ps-Graduao em Biotecnologia
(PPGBiotec) do Centro Universitrio UNIVATES (http://lattes.cnpq.br/3177897348100996).
Luana Maria Wollinger
Nutricionista, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do
Centro Universitrio UNIVATES (http://lattes.cnpq.br/9547985850246718).

Biotecnologia

SUMRIO

Luclia Hoehne
Qumica Industrial, doutora em Qumica (UFSM), professora do Centro de Cincias Exatas e
Tecnolgicas (CETEC) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/1088266827926373).
Luclia Santi
Biloga, doutora em Biologia Celular e Molecular (UFRGS), ps-doutoranda no Proteomic Mass
Spectrometry Lab, Department of Chemical Physiology, The Scripps Research Institute, La Jolla CA, EUA (http://lattes.cnpq.br/7154170979832540).
Luciana Knabben Oliveira Becker Delving
Mdica, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/1880043506615687).
Marcia Ines Goettert
Farmacutica, doutora em Cincias Farmacuticas (Universidade de Tuebingen), professora do
Centro de Cincias Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia
(PPGBiotec) do Centro Universitrio UNIVATES (http://lattes.cnpq.br/5742493416858879).
Mardja Manssur Bueno e Silva
Acadmica do curso de Cincias Biolgicas da Universidade Federal do Rio Grande do Sul
(UFRGS) (http://lattes.cnpq.br/6836121028944714).
Marelise Teixeira
Acadmica do curso de Cincias Biolgicas do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/4505465308986872).
Markus Berger Oliveira
Farmacutico, doutor em Biologia Celular e Molecular (UFRGS), ps-doutorando no Laboratrio
de Bioqumica Farmacolgica do Centro de Biotecnologia (UFRGS)
(http://lattes.cnpq.br/8841487917492985).
Mariano Rodrigues
Qumico, mestre em Biotecnologia (Centro Universitrio UNIVATES), professor dos cursos
Tcnicos em Qumica e Nutrio do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/8641590738904901).
Matheus dos Santos Rocha
Bilogo, mestrando do Programa de Ps-Graduao em Diversidade Animal e Vegetal
(UNISINOS) (http://lattes.cnpq.br/2563225109320691).
Mnica Jachetti Maciel
Biloga, mestre em Cincia e Tecnologia de Alimentos (UFGRS), professora do Centro de Cincias
Biolgicas e da Sade (CCBS) do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/2575088289818885).
Noeli Juarez Ferla
Bilogo, doutor em Cincias (USP), professor do Centro de Cincias Biolgicas e da Sade (CCBS)
e dos Programas de Ps-Graduao em Biotecnologia (PPGBiotec) e Ambiente e Desenvolvimento
(PPGAD) do Centro Universitrio UNIVATES (http://lattes.cnpq.br/6071378790176893).

Biotecnologia

SUMRIO

Pmela Maria Seibel


Acadmica do curso de Farmcia da Fundao Universidade Federal de Cincias da Sade de
Porto Alegre (UFCSPA) (http://lattes.cnpq.br/6364366001687822).
Pricila Girardi
Biomdica, mestranda do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do Centro
Universitrio UNIVATES (http://lattes.cnpq.br/5365985945824906).
Raquel Piccinini Castoldi
Acadmica do Curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/8418988355549553).
Raul Antonio Sperotto
Bilogo, doutor em Biologia Celular e Molecular (UFRGS), professor do Centro de Cincias
Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do
Centro Universitrio UNIVATES (http://lattes.cnpq.br/0884712531887046).
Ronize Zeni da Silva
Acadmica do curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/4880476350854468).
Thais Fernanda Dornelles
Acadmica do Curso de Biomedicina do Centro Universitrio UNIVATES
(http://lattes.cnpq.br/2666961265541421).
Vernica Contini
Biloga, doutora em Gentica e Biologia Molecular (UFRGS), professora do Centro de Cincias
Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do
Centro Universitrio UNIVATES (http://lattes.cnpq.br/3166654315161244).
Vinicius de Abreu Waldow
Bilogo, mestre em Biologia Celular e Molecular (UFRGS), pesquisador na rea de Biotecnologia
do Centro de Pesquisas e Desenvolvimento Leopoldo Amrico Miguez de Mello (Cenpes), da
Petrobras (http://lattes.cnpq.br/3283240828625036).
Walter Orlando Beys da Silva
Bilogo, doutor em Biologia Celular e Molecular (UFRGS), professor do Centro de Cincias
Biolgicas e da Sade (CCBS) e do Programa de Ps-Graduao em Biotecnologia (PPGBiotec) do
Centro Universitrio UNIVATES (http://lattes.cnpq.br/1353100437268465).

Biotecnologia

SUMRIO

PREFCIO
O nmero de artigos cientficos publicados vem aumentando significativamente nos ltimos
anos nas mais diversas reas e nos principais pases do mundo, entre eles o Brasil. No somente a
publicao de artigos originais cresce, mas tambm as revises completas e, com isso, aumenta o
nmero de peridicos, edies, novas subreas, meios alternativos de divulgao etc. Em funo
disso, tanto pesquisadores, profissionais das reas da Sade, da Biologia, da Qumica, das Cincias
Agrrias, de Alimentos e de Engenharias como estudantes de Ensino Mdio, de nvel tcnico, de
graduao e ps-graduao vm sendo diariamente imersos em um volume cada vez maior de
informao.
At recentemente, ns, pesquisadores, tnhamos o desafio de encontrar informao em uma
esfera muito mais limitada e algumas vezes de difcil acesso. Hoje, o nosso maior desafio filtrar
e, por muitas vezes, decifrar a informao resumida contida em artigos cientficos mediante busca
limitada por certo nmero de palavras-chave e outras normas que dificultam a reprodutibilidade
de experimentos e de protocolos. Alm disso, com o aumento do nmero de referncias e citaes,
muitas vezes no fidedignas, e pequenas modificaes e outras omisses no incorporadas em
protocolos insuficientemente descritos em artigos, frequentemente torna-se difcil ou mesmo
impossvel a reproduo de experimentos bsicos em muitos laboratrios e grupos de pesquisa.
A publicao on-line como livro eletrnico de Protocolos e mtodos de anlise em
laboratrios de biotecnologia agroalimentar e de sade humana tem como objetivo central
disponibilizar informaes sobre o uso de metodologia cientfica j testada em vrios laboratrios,
tornando mais acessvel e simplificada a aplicao de protocolos com enfoque multidisciplinar nas
reas biomdicas e de sade, biolgicas em geral, agrrias e de biotecnologia. Os autores deste
livro so profissionais com formao e background cientfico bastante diversificado e apresentam
os protocolos de modo no s a facilitar a busca das referncias e citaes, mas tambm para que
pesquisadores e estudantes possam aplic-los e reproduzi-los de maneira simples. A insero de
notas ou dicas durante a descrio completa dos protocolos gera alternativas de aplicao e
revela a informao que muitas vezes no est descrita nos artigos e que fundamental para a
reprodutibilidade dos experimentos e ensaios.
Simplificar o acesso a protocolos importantes com aplicabilidade em diversas e diferentes
reas cientficas o primeiro passo para o sucesso dos experimentos no desenvolvimento dos
projetos de pesquisa, base para o avano cientfico e tecnolgico e, principalmente, para a formao
qualificada de recursos humanos em nvel escolar, tcnico, de graduao e de ps-graduao.

Prof. Dr. Jorge Almeida Guimares


Presidente da CAPES

Biotecnologia

SUMRIO

SUMRIO
CAPTULO 1
PREPARO DE SOLUES, TCNICAS BSICAS E UTILIZAO DE EQUIPAMENTOS
DE ROTINA.................................................................................................................................................15
1.1 SEGURANA NO LABORATRIO..................................................................................................................................16
1.2 PRINCIPAIS VIDRARIAS....................................................................................................................................................18
1.3 PRINCIPAIS TIPOS DE GUA EMPREGADOS NO LABORATRIO.......................................................................22
1.4 LIMPEZA E DESCONTAMINAO DE VIDRARIAS..................................................................................................24
1.5 SOLUES DE LIMPEZA E SECAGEM DE MATERIAL..............................................................................................26
1.6 MEDIDAS DE VOLUMES DE LQUIDOS........................................................................................................................28
1.7 AQUECIMENTO EM BANHO MARIA............................................................................................................................31
1.8 AQUECIMENTO EM ALTAS TEMPERATURAS...........................................................................................................32
1.9 AQUECIMENTO EM BICO DE BUNSEN........................................................................................................................34
1.10 RESFRIAMENTO EMPREGANDO BANHO DE GELO...............................................................................................36
1.11 UTILIZAO DE EVAPORADOR ROTATRIO (ROTAEVAPORADOR).............................................................37
1.12 TRANSFERNCIA DE LQUIDOS..................................................................................................................................38
1.13 TRANSFERNCIA DE SLIDOS.....................................................................................................................................39
1.14 TCNICAS DE PESAGEM................................................................................................................................................40
1.15 MTODOS DE PESAGEM.................................................................................................................................................43
1.16 MEDIDAS DE VOLUME....................................................................................................................................................45
1.17 PROCESSO DE SEPARAO POR FILTRAO.........................................................................................................50
1.18 PROCESSO DE SEPARAO POR CENTRIFUGAO.............................................................................................52
1.19 PROCESSO DE SEPARAO POR PRECIPITAO..................................................................................................53
1.20 PROCESSO DE SEPARAO POR DECANTAO...................................................................................................54
1.21 TCNICAS DE PREPARO DE SOLUES....................................................................................................................55

CAPTULO 2
EXTRAO E QUANTIFICAO DE CIDOS NUCLEICOS E PROTENAS..............................58
2.1 EXTRAO DE DNA HUMANO A PARTIR DE SANGUE PERIFRICO MTODO DE SALTING-OUT........59
2.2 EXTRAO DE DNA DE AMOSTRAS VEGETAIS.......................................................................................................62
2.3 EXTRAO DE DNA DE BACTRIAS ENDOFTICAS DE RAIZ...............................................................................65
2.4 EXTRAO DE DNA BACTERIANO DE SOLO............................................................................................................67
2.5 EXTRAO DE DNA DE UM ISOLADO BACTERIANO.............................................................................................69
2.6 EXTRAO DE DNA BACTERIANO DIRETAMENTE DE AMOSTRAS DE LEITE...............................................71
2.7 EXTRAO DE PLASMDEO (MINIPREP).....................................................................................................................73
2.8 EXTRAO DE RNA UTILIZANDO TRIZOL..............................................................................................................75
2.9 EXTRAO DE RNA DE AMOSTRAS VEGETAIS UTILIZANDO CONCERT PLANT RNA REAGENT.......76
2.10 EXTRAO DE PROTENAS TOTAIS DE AMOSTRAS DE TECIDO DE MAMFEROS......................................77
2.11 EXTRAO DE PROTENAS TOTAIS DE AMOSTRAS VEGETAIS........................................................................78
2.12 QUANTIFICAO DE DNA UTILIZANDO O QUBIT.............................................................................................80
2.13 QUANTIFICAO DE RNA UTILIZANDO O QUBIT..............................................................................................81
2.14 QUANTIFICAO DE DNA E RNA UTILIZANDO ESPECTROFOTOMETRIA DE DENSIDADE
PTICA - L-QUANT.............................................................................................................................................................82
2.15 QUANTIFICAO DE PROTENAS UTILIZANDO O QUBIT................................................................................84
2.16 QUANTIFICAO DE PROTENAS PELO MTODO DE BRADFORD..................................................................85

Biotecnologia

SUMRIO

10

2.17 QUANTIFICAO DE PROTENAS PELO MTODO DE LOWRY ........................................................................87


2.18 QUANTIFICAO DE PROTENAS PELO MTODO BCA......................................................................................89

CAPTULO 3
GENOTIPAGEM DE POLIMORFISMOS EM AMOSTRAS HUMANAS..........................................90
3.1 REAO EM CADEIA DA POLIMERASE (PCR)...........................................................................................................91
3.2 DIGESTO ENZIMTICA..................................................................................................................................................93
3.3 ELETROFORESE EM GEL...................................................................................................................................................94
3.4 METODOLOGIAS DE GENOTIPAGEM BASEADAS NA PCR....................................................................................96

CAPTULO 4
ANLISES FISIOLGICAS EM AMOSTRAS VEGETAIS E ANIMAIS....................................... 100
4.1 EXTRAO E QUANTIFICAO DE CLOROFILAS.................................................................................................101
4.2 QUANTIFICAO DE ACARES SOLVEIS TOTAIS...........................................................................................102
4.3 QUANTIFICAO DE CARBONILAO OU OXIDAO DE PROTENAS......................................................103
4.4 QUANTIFICAO DO NVEL DE PEROXIDAO LIPDICA UTILIZANDO TBARS.......................................105
4.5 QUANTIFICAO DE VAZAMENTO DE ELETRLITOS (ELECTROLYTE LEAKAGE ASSAY)......................106
4.6 LOCALIZAO HISTOQUMICA DA PEROXIDAO LIPDICA UTILIZANDO O REAGENTE DE
SCHIFF....................................................................................................................................................................................107
4.7 LOCALIZAO HISTOQUMICA DA PERDA DE ESTABILIDADE DE MEMBRANA UTILIZANDO O
REAGENTE EVANS BLUE..................................................................................................................................................108
4.8 LOCALIZAO HISTOQUMICA IN SITU DO ACMULO DE RADICAL SUPERXIDO (O2-).....................109
4.9 LOCALIZAO HISTOQUMICA IN SITU DO ACMULO DE PERXIDO DE HIDROGNIO (H2O2)........110
4.10 PREPARAO DO TAMPO FOSFATO DE POTSSIO
(K2HPO4) - 10 mM (0,01 M) - PH 7,8...................................................................................................................................111
4.11 DETERMINAO DO CONTEDO DE PERXIDO DE HIDROGNIO (H2O2).................................................112
4.12 ANLISE DAS ENZIMAS ANTIOXIDANTES SUPERXIDO DISMUTASE (SOD), CATALASE (CAT), E
ASCORBATO PEROXIDASE (APX)...................................................................................................................................113
4.13 TESTE DE COMETA E MICRONCLEO.....................................................................................................................116
4.14 ANLISE DE CITOTOXICIDADE POR ALAMAR BLUE.........................................................................................130
4.15 AVALIAO DA PROLIFERAO CELULAR PELO MTT....................................................................................132
4.16 OXIDAO DE H2DCF-DA PARA AVALIAO DE ESPCIES REATIVAS DE OXIGNIO
INTRACELULARES..............................................................................................................................................................133
4.17 MARCAO COM IODETO DE PROPDEO PARA DETERMINAO DA DISTRIBUIO DO CICLO
CELULAR...............................................................................................................................................................................135
4.18 COMARCAO COM ANEXINA V-FITC / IODETO DE PROPDEO PARA ANLISE DE MORTE
CELULAR...............................................................................................................................................................................137
4.19 MARCAO COM LARANJA DE ACRIDINA PARA AVALIAO DA ETAPA FINAL DO
MECANISMO DE AUTOFAGIA........................................................................................................................................139
4.20 ENSAIO DE AGREGAO DE GFP-LC3 PARA MENSURAO DA ETAPA INICIAL DA AUTOFAGIA..141
4.21 AVALIAO DO NDICE MITTICO PARA INFERNCIA DE PROLIFERAO CELULAR.......................142
4.22 ATIVIDADE DE BETA-GALACTOSIDASE CIDA ASSOCIADA SENESCNCIA (SA--GAL)..................143
4.23 ENSAIO CLONOGNICO PARA MENSURAO DA CAPACIDADE PROLIFERATIVA DE CLULAS
NICAS ...................................................................................................................................................145
4.24 MARCAO DE BROMODEOXIURIDINA (BrdU) PARA AVALIAO DA PROLIFERAO
CELULAR ..............................................................................................................................................................................146
4.25 ANLISE MORFOMTRICA NUCLEAR (NMA) PARA INFERNCIA DE APOPTOSE, SENESCNCIA
E IRREGULARIDADES NUCLEARES...............................................................................................................................148

Biotecnologia

SUMRIO

11

CAPTULO 5
ANLISE DE EXPRESSO GNICA EM
NVEL DE RNA....................................................................................................................................... 150
5.1 TRATAMENTO DAS AMOSTRAS DE RNA COM DNASE I E DNASE TURBO................................................151
5.2 SNTESE DE PRIMEIRA FITA DE CDNA UTILIZANDO A TRANSCRIPTASE REVERSA M-MLV.................152
5.3 SNTESE DE PRIMEIRA FITA DE cDNA UTILIZANDO A TRANSCRIPTASE REVERSA SUPERSCRIPT II..... 153
5.4 ANLISE DA EXPRESSO GNICA POR RT-PCR SEMI-QUANTITATIVO.........................................................154
5.5 PREPARAO DE UMA PLACA DE RT-qPCR (PCR EM TEMPO REAL) DE 48 POOS...................................157
5.6 CONFIGURAO DO EQUIPAMENTO STEPONE (APPLIED BIOSYSTEMS) PARA ANLISES DE
EXPRESSO GNICA..........................................................................................................................................................160

CAPTULO 6
ANLISE DE EXPRESSO GNICA EM NVEL DE PROTENA................................................ 161
6.1 ELETROFORESE DE PROTENAS EM CONDIO DESNATURANTE EM GEL DE
POLIACRILAMIDA SDS PAGE.......................................................................................................................................162
6.2 MTODOS DE COLORAO DE GIS SDS-PAGE.....................................................................................................166
6.3 IMUNOIDENTIFICAO DE PROTENAS POR WESTERN BLOTTING...............................................................168

CAPTULO 7
PRODUO E ANLISE DE BIOPRODUTOS................................................................................. 171
7.1 MANUTENO DAS CULTURAS.................................................................................................................................172
7.2 PREPARAO DO INCULO........................................................................................................................................172
7.3 DETERMINAO DE BIOMASSA.................................................................................................................................172
7.4 DETERMINAO DA ACIDEZ TITULVEL...............................................................................................................173
7.5 DETERMINAO DO pH................................................................................................................................................175
7.6 DETERMINAO DA MATRIA MINERAL (CINZAS)............................................................................................176
7.7 DETERMINAO DA UMIDADE, VOLTEIS E SLIDOS TOTAIS.......................................................................178
7.8 DETERMINAO DE LIPDIOS.....................................................................................................................................180
7.9 DETERMINAO DO NITROGNIO TOTAL.............................................................................................................181
7.10 DETERMINAO DE PROTENA SOLVEL............................................................................................................184
7.11 ANLISE DAS PROPRIEDADES FUNCIONAIS E NUTRICIONAIS DE PROTENAS.......................................186
7.12 DETERMINAO DA ATIVIDADE ANTIOXIDANTE............................................................................................191
7.13 DETERMINAO DA DEMANDA QUMICA DE OXIGNIO (DQO).................................................................194
7.14 DETERMINAO DE POLIFENIS TOTAIS.............................................................................................................197
7.15 AVALIAO QUALITATIVA DE METABLITOS SECUNDRIOS DE PLANTAS..........................................200

CAPTULO 8
CULTURA DE CLULAS ANIMAIS.................................................................................................... 205
8.1 CULTURA E MANIPULAO DE LINHAGENS CELULARES...............................................................................206
8.2 CULTURA PRIMRIA DE CLULAS FOLICULARES DE TIREOIDE HUMANA................................................210

CAPTULO 9
CULTURA DE TECIDOS VEGETAIS................................................................................................. 213
9.1 PREPARAO DE SOLUES ESTOQUE PARA O MEIO MS................................................................................214
9.2 PREPARO DO MEIO DE CULTURA MS (MURASHIGE E SKOOG)........................................................................216
9.3 OBTENO E DESINFESTAO DOS EXPLANTES.................................................................................................219
9.4 ESTABELECIMENTO DOS EXPLANTES E CONDIES DE INCUBAO.........................................................222

Biotecnologia

SUMRIO

12

9.5 MANUTENO DAS PLANTAS MATRIZES..............................................................................................................225

CAPTULO 10
ISOLAMENTO E CARACTERIZAO DE BACTRIAS PROMOTORAS DE
CRESCIMENTO VEGETAL.................................................................................................................. 227
10.1 ISOLAMENTO DE DIAZOTRFICOS ENDOFTICOS DE RAIZ............................................................................228
10.2 ISOLAMENTO DE DIAZOTRFICOS DE SOLO RIZOSFRICO............................................................................231
10.3 ISOLAMENTO DE DIAZOTRFICOS FORMADORES DE ENDSPOROS DE SOLO RIZOSFRICO...........232
10.4 ISOLAMENTO DE RIZBIOS........................................................................................................................................234
10.5 IDENTIFICAO DO GNERO E ESPCIE BACTERIANA....................................................................................235
10.6 PRODUO DE COMPOSTOS INDLICOS..............................................................................................................237
10.7 SOLUBILIZAO DE FOSFATO DE CLCIO...........................................................................................................238
10.8 PRODUO DE SIDERFOROS BACTERIANOS.....................................................................................................239
10.9 ATIVIDADE DA ENZIMA ACC DEAMINASE...........................................................................................................241

CAPTULO 11
ANLISES BSICAS DE BIOINFORMTICA.................................................................................. 242
11.1 DESENHO DE INICIADORES (PRIMERS) PARA PCR UTILIZANDO SOFTWARES ONLINE.......................243
11.2 VERIFICAO DA QUALIDADE DOS PRIMERS PROJETADOS.........................................................................244
11.3 PREPARAO DE ARQUIVO CONTENDO SEQUNCIA NO FORMATO FASTA..........................................246
11.4 OBTENO DE SEQUNCIAS REVERSO-COMPLEMENTAR..............................................................................247
11.5 BUSCA DE SIMILARIDADE DE SEQUNCIAS UTILIZANDO UM BANCO DE DADOS DE
SEQUNCIAS E AS FERRAMENTAS BLAST (BASIC LOCAL ALIGNMENT SEARCH TOOL) ...........................248
11.6 ALINHAMENTO DE SEQUNCIAS DE NUCLEOTDEOS E PROTENAS (ALINHAMENTO GLOBAL) ....254
11.7 LOCALIZAO DE DOMNIOS CONSERVADOS EM SEQUNCIAS DE PROTENAS..................................256
11.8 PREDIO DE DOMNIOS TRANSMEMBRANA A PARTIR DE SEQUNCIAS DE PROTENAS.................257
11.9 PREDIO DE LOCALIZAO SUBCELULAR, PRESENA DE PEPTDEO DE DIRECIONAMENTO
N-TERMINAL E DE SINAL DE LOCALIZAO NUCLEAR, A PARTIR DE SEQUNCIAS DE PROTENAS.... 258
11.10 IDENTIFICAO E ANLISE DA REGIO PROMOTORA DE GENES ORIUNDOS DE GENOMAS
DE PLANTAS.........................................................................................................................................................................261
11.11 PREDIO DE SECREO E LOCALIZAO DE PROTENAS........................................................................263

CAPTULO 12
CRIAO E APLICAO DE CAROS PARA CONTROLE BIOLGICO................................. 265
12.1 CRIAO E APLICAO DE CAROS PARA CONTROLE BIOLGICO..........................................................266

CAPTULO 13
CLULAS FNGICAS: PRODUO, CONTAGEM E VIABILIDADE APLICADAS AO
CONTROLE BIOLGICO..................................................................................................................... 268
13.1 PRODUO DE CONDIOS DE FUNGOS FILAMENTOSOS.................................................................................269
13.2 PREPARAO DA SUSPENSO DE CONDIOS (ESPOROS) DE FUNGOS FILAMENTOSOS.......................271
13.3 CONTAGEM DA SUSPENSO DE CONDIOS OU LEVEDURAS.........................................................................272
13.4 TESTE DE VIABILIDADE DA SUSPENSO DE CONDIOS....................................................................................273
13.5 EXTRAO DE PROTENAS DE SUPERFCIE DE CONDIOS FNGICOS........................................................274

Biotecnologia

SUMRIO

13

CAPTULO 14
MODELOS BIOLGICOS PR-CLNICOS PARA AVALIAO DA ATIVIDADE DE
SUBSTNCIAS FARMACOLOGICAMENTE ATIVAS..................................................................... 275
14.1 MODELO DE TROMBOSE VENOSA LOCAL.............................................................................................................276
14.2 MODELO DE TROMBOSE VENOSA PROFUNDA....................................................................................................279
14.3 MODELO DE HEMORRAGIA........................................................................................................................................282
14.4 MODELO DE ASMA ALRGICA..................................................................................................................................284
14.5 MODELO DE PERMEABILIDADE VASCULAR.........................................................................................................286
14.6 MODELO DE GASTRITE.................................................................................................................................................288
14.7 MODELO DE COLITE......................................................................................................................................................290

CAPTULO 15
QUANTIFICAO E ANLISE DE ATIVIDADE ENZIMTICA.................................................. 292
15.1 ATIVIDADE PROTEOLTICA: AZOCASENA...........................................................................................................293
15.2 ATIVIDADE PROTEOLTICA: TRIPSINA...................................................................................................................295
15.3 ATIVIDADE PROTEOLTICA: TROMBINA + SUBSTRATO SINTTICO.............................................................298
15.4 ATIVIDADE PROTEOLTICA: TROMBINA + FIBRINOGNIO..............................................................................300
15.5 ATIVIDADE LIPOLTICA, LIPASE: TITULAO DE CIDOS GRAXOS ...........................................................302
15.6 ATIVIDADE LIPOLTICA, LIPASE: P-NITROFENIL-PALMITATO ......................................................................304
15.7 ATIVIDADE AMILOLTICA .........................................................................................................................................307
15.8 ATIVIDADE CELULSICA ...........................................................................................................................................309

CAPTULO 16
DETECO DE ATIVIDADE ENZIMTICA ATRAVS DE GIS DE ATIVIDADE/
ZIMOGRAMAS......................................................................................................................................... 311
16.1 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE QUITINASES (ST LEGER ET AL. 1993).........312
16.2 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE PROTEASES (MODIFICADO DE ST
LEGER ET AL. 1993)..............................................................................................................................................................315
16.3 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE LIPASES E ESTERASES (TEO ET AL. 2003)..... 317
16.4 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE CATALASES (ZIMMERMANN ET AL.
2006).........................................................................................................................................................................................319
16.5 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE SUPERXIDO DISMUTASES.........................321

CAPTULO 17
GERENCIAMENTO DE RESDUOS EM LABORATRIOS DE BIOTECNOLOGIA................ 324
17.1 BROMETO DE ETDIO....................................................................................................................................................325
17.2 ACRILAMIDA...................................................................................................................................................................327
17.3 FENOL................................................................................................................................................................................328

Biotecnologia

SUMRIO

14

CAPTULO 1
PREPARO DE SOLUES, TCNICAS BSICAS E
UTILIZAO DE EQUIPAMENTOS DE ROTINA
Claucia Fernanda Volken de Souza, Christina Venzke Simes de Lima,
Eduardo Miranda Ethur, Luclia Hoehne, Mariano Rodrigues

Laboratrio pode ser definido como o local construdo com a finalidade de se realizar
diferentes experimentos. A importncia do laboratrio na pesquisa, em escala industrial ou
acadmica, em qualquer de suas especialidades, seja qumica, dimensional, eltrica e biolgica,
baseia-se no exerccio de suas atividades sob condies ambientais controladas e normatizadas.
Esta a forma de assegurar que no ocorram influncias estranhas que alterem o resultado do
experimento ou medio e, ainda, de modo que garanta a repetio do estudo em outro laboratrio
e com a mesma exatido nos resultados (Oliveira et al., 2007). No entanto, o laboratrio um local
de trabalho com potenciais riscos de acidentes, tendo em vista que se manipulam substncias com
uma periculosidade considervel e, que se indevidamente utilizadas, podem causar danos graves
ao usurio do laboratrio (Chambel, 2014), seja ele aluno, laboratorista ou professor.
Neste captulo inicial, tem-se o objetivo de evidenciar as tcnicas e procedimentos bsicos
que so usados em laboratrios de qumica e reas afins para auxiliar profissionais desta rea a ter
uma uniformidade na execuo dos mtodos e diminuir ao mximo qualquer interferente, para que
sejam obtidos resultados confiveis.
Referncias:
CHAMBEL, Silvia. Segurana no laboratrio. 2005. Disponvel em: <http://www.ideiasambientais.com.pt/
seguranca_laboratorio.html>. Acesso em: 21 jan. 2014.
OLIVEIRA, C. M. A. et al. Guia de laboratrio para o ensino de qumica: instalao montagem e operao. CRQ-IV:
So Paulo, 2007. 53 p.

Biotecnologia

SUMRIO

15

1.1 SEGURANA NO LABORATRIO


Em qualquer atividade de laboratrio necessrio conhecer os procedimentos bsicos de
segurana, tais como:
- Verificar a existncia de Equipamento de Proteo Coletiva (EPC) no laboratrio. Ex.: capela de
exausto, chuveiro de emergncia, lavador de olhos, cobertor de segurana, extintor de incndio
no prazo de validade.
- O laboratrio deve ter uma caixa de primeiros socorros (gua oxigenada, mercrio, algodo,
esparadrapo, material para curativo, vaselina, luva cirrgica). Qualquer acidente dever ser
comunicado ao responsvel do laboratrio.
- No deve ser permitida a entrada de pessoas estranhas na rea de trabalho do laboratrio.
- No retirar os ralos protetores dos orifcios de evacuao das pias.
- Verificar (ler) o rtulo dos frascos antes de us-los.
- Manter as amostras e frascos de reagentes arrolhadas ou tampadas quando estes no estiverem
sendo utilizados.
- Lubrificar as bordas da boca do tubo de vidro ao tamp-los com rolha. No caso de rolhas de borracha,
usar glicerina como lubrificante.
- No manter contato de solues alcalinas com bordas esmerilhadas tampadas por longos perodos
(algumas horas), pois o vidro pode soldar, inutilizando a pea.
- Use sempre culos de segurana: essencial proteger os olhos quando estiver no laboratrio, mesmo
que no esteja diretamente envolvido em um experimento. Os culos devem ser usados mesmo
quando estiver lavando materiais, pois podem respingar fragmentos do material. Caso qualquer
produto qumico atinja seus olhos, v ao lava-olhos e lave seu olhos e face com grande quantidade
de gua. Caso no haja um lava-olhos adequado faa esse procedimento em uma torneira.
- No acender o bico de Bunsen sem antes verificar: vazamento nas sadas da mangueira e na prpria,
obstrues na mangueira, existncia de inflamveis na proximidade, regulagem ideal da abertura
da chama.
- Cuide com chamas no laboratrio: deve-se ter cuidado ao usar fsforo ou chamas. Antes de utilizar
o fogo verifique sempre que tipos de reagentes seus colegas prximos esto trabalhando, pois
substncias inflamveis so uma fonte em potencial de incndio.
- Evite contato com reagentes e substncias: use sempre luvas apropriadas ao manusear substncias
qumicas. Reduza sempre a sua exposio ao produto ao mnimo, pois a exposio excessiva e
repetida pode provocar problemas de sade. O laboratrio deve ser bem arejado e a manipulao
com os reagentes deve ser realizada em capelas. Evite verificar os odores das substncias.
- Jamais despeje resduos na pia, utilize sempre recipientes adequados e identificados com as
substncias presentes.
- No coma ou beba no laboratrio; h sempre risco de contaminao de comida ou bebida com
material potencialmente perigoso.
- Use vestimentas adequadas no laboratrio: deve-se sempre usar jaleco de mangas longas de material
no sinttico, sapatos fechados e calas compridas. Caso tenha cabelo longo, mantenha-o sempre
preso. Em caso de operaes com maior grau de risco deve-se utilizar toucas.
- Utilize luvas adequadas (de amianto) para a proteo contra calor e frio. Jamais se deve pipetar
qualquer produto com a boca.
- No leve as mos na boca ou olhos quando estiver manuseando produtos qumicos.
- Mantenha as bancadas sempre limpas e livres de materiais estranhos ao trabalho.
- Deve-se sempre rotular, imediatamente, qualquer reagente, soluo preparada ou amostra coletada.
- No utilize materiais de vidros trincados.

Biotecnologia

SUMRIO

16

- Ao utilizar uma capela sempre verifique se a mesma est limpa e o sistema de exausto est operando
corretamente. Mantenha as janelas da capela com o mnimo de abertura possvel, evitando sempre
colocar o rosto para dentro da mesma.
- Se a toxidade do produto for elevada, utilize mscara contra gases. No caso de diluies, sempre
derramar o cido sobre a gua, nunca o contrrio.
- Antes de usar qualquer aparelho, certifique-se que sabe manuse-lo. Leia as instrues ou pea uma
demonstrao ao instrutor.
- Ao ligar qualquer aparelho corrente eltrica, certifique-se do estado da fiao, tomadas e plugues,
compatibilidade da voltagem do aparelho com a da rede eltrica, aterramento, condies
da superfcie de contato com o aparelho (no deve estar mida) e da existncia de produtos
inflamveis na proximidade.
- Colocar os lixos (seco, orgnico, contaminado, txico, vidros etc) em recipientes adequados. No
jogar na pia ou local indevido.
- Deve-se lavar as mo antes de sair do laboratrio.
- Ao sair do laboratrio, verificar se as torneiras de gua e gs (neste caso, inclusive o registro) esto
fechadas, aparelhos desligados e janelas trancadas.

Referncias:
CHRISPINO, lvaro. Manual De Qumica Experimental. So Paulo: Editora tica. 2 Edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana No Laboratrio. Rio De Janeiro: Intercincia, 2001.269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio De Janeiro: Freitas Bastos, 2009. 390 p.
PAVIA, Donald L. et al. Qumica Orgnica Experimental: Tcnicas De Escala Pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica No Laboratrio. Barueri, SP: Manole, 5
Edio, 2009.546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas De Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.
UNIFEB. Apostila de Qumica Geral e Experimental. 2009. Disponvel em: <http://xa.yimg.com/kq/
groups/24693296/1821154571/name/UNKNOWN_PARAMETER_VALUE>. Acesso em: 30 mar. 2014

Biotecnologia

SUMRIO

17

1.2 PRINCIPAIS VIDRARIAS


Nos laboratrios de pesquisa, encontram-se diversos tipos de vidrarias, materiais cermicos
e demais utenslios especficos para a execuo de determinadas anlises e preparo de amostra, os
principais so:
1.2.1 Materiais de vidro:
- Tubo de ensaio utilizado para efetuar reaes qumicas em pequena escala, principalmente testes
de reaes (Figura 1.1).
- Bequer recipiente com ou sem graduao, utilizado para o preparo de solues, aquecimento de
lquidos, recristalizao, etc. (Figura 1.2).
- Erlenmeyer frasco utilizado para aquecer lquido ou fazer titulaes (Figura 1.3).
- Kitassato - frasco de paredes espessas, munido de sada lateral e usado em filtraes a vcuo (Figura
1.4).
- Balo volumtrico recipiente calibrado, de preciso, destinado a conter um determinado volume
de lquido, a uma dada temperatura; utilizado no preparo de solues de concentrao definidas
(Figura 1.5).
- Proveta frasco com graduaes, destinado a medidas aproximadas de lquidos (Figura 1.6).
- Bureta equipamento calibrado para medida precisa de volume de lquidos. Permite o escoamento
do lquido e muito utilizado em titulaes (Figura 1.7).
- Pipeta volumtrica equipamento calibrado para medida precisa de volume de lquidos. Existem
dois tipos: pipeta graduada e pipeta volumtrica (Figura 1.8 e 1.9).
- Funil - utilizado na transferncia de lquidos de um frasco para o outro ou para efetuar filtraes
simples (Figura 1.10).
- Balo de fundo chato ou de Florence utilizado para armazenar lquido e em destilaes (Figura
1.11).
- Balo de Fundo Redondo - usado para aquecimento de lquidos e para realizar reaes que envolvam
desprendimento de gases (Figura 1.12).
- Funil de separao equipamento utilizado na separao de lquidos imiscveis (Figura 1.13).
- Vidro de relgio usado geralmente para cobrir bquer contendo soluo ou par evaporao em
anlise de lquidos (Figura 1.14).
- Placa de Petri - usada para cobrir cristalizadores, para o desenvolvimento de culturas (Figura 1.15).
- Basto de vidro utilizado na agitao e transferncia de lquidos (Figura 1.16).
- Pesa filtro recipiente destinado pesagem de slidos (Figura 1.17)
- Condensador equipamento utilizado para condensao de vapores em destilaes ou aquecimento
sob refluxo (Figura 1.18).
- Picnmetro - utilizado na determinao da densidade de lquidos (Figura 1.19).
- Dessecador utilizado no armazenamento de substncias quando se necessita de uma
atmosfera com baixo teor de umidade (Figura 1.20).
- Termmetro utilizado para medir a temperatura de substncias ou do ambiente (Figura 1.21)

A Figura 1 ilustra os materiais de vidro mais comuns utilizados em um laboratrio.

Biotecnologia

SUMRIO

18

Figura 1. Materiais de vidro de uso em laboratrios de qumica e reas afins.

Fonte: Blog de vidraria de laboratrio (2014).

1.2.2 Materiais de porcelana


- Cadinho usado para calcinao de substncias (Figura 2.1)
- Tringulo de porcelana utilizado para sustentar cadinhos de porcelana em aquecimento no bico de
Bunsen (Figura 2.2)
- Almofariz e pistilo empregado para triturar e pulverizar slidos (Figura 2.3).
- Cpsula de porcelana usada para efetuar evaporaes de lquidos (Figura 2. 4).
- Funil de Buchner utilizado em filtraes por suco, devendo ser acoplado a um Kitassato (Figura
2.5).
- Esptula usada para transferir substncias slidas (Figura 2.6).

A Figura 2 ilustra os materiais de porcelana mais comuns utilizados em um laboratrio.


Figura 2. Materiais de porcelana de uso em laboratrios de qumica e reas afins

Fonte: Blog de vidraria de laboratrio (2014).

Biotecnologia

SUMRIO

19

1.2.3 Material Metlico


- Suporte (ou haste), mufa e garra peas metlicas usadas para montar aparelhagens em geral
(Figura 3.1).
- Garra metlica usada para prender condensador, buretas, bales haste do suporte universal.
(Figura 3.2)
- Tenaz usado para segurar objetos aquecidos (Figura 3.3)
- Argola sustenta o funil na filtrao (Figura 3.4)
- Trip usado como suporte, principalmente de telas ou tringulos (Figura 3.5)
- Esptula - similar a de porcelana de uso mais comum devido ao preo e a grande variedade de
formatos, contudo tem limitaes quanto ao ataque por substncias corrosivas (Figura 3.6).
Figura 3. Utenslios metlicos de uso em laboratrio de qumica e reas afins.

Fonte: Blog de vidraria de laboratrio (2014).

1.2.4 Materiais Diversos


- Suporte (ou estante) tubo para ensaios (Figura 4.1).
- Pisseta frasco plstico, geralmente contendo gua destilada (ou outro solvente), usado para efetuar
a lavagem dos recipientes com jatos de liquido nela contido (Figura 4.2).
- Tela de amianto Tela metlica, contendo amianto, utilizada para distribuir uniformemente o calor
durando o aquecimento de recipientes de vidro chama de um
bico de gs (Figura 4.3).
- Pina de madeira ou prendedor utilizado para segurar tubos de ensaio.
- Trompa dgua dispositivo para aspirar o ar e reduzir a presso no interior de um frasco (Figura
4.4).
- Estufa utilizada para a secagem de materiais (por aquecimento), em geral at 200 C (Figura 4.5).
- Mufla ou forno utilizado para calcinao de substncias (por aquecimento), em geral at 1000 ou
1500 C (Figura 4.6).
- Pipetador tipo pra usado em conjunto com uma pipeta ajuda a puxar e expelir pequenos
volumes de lquido (Figura 4.7)
- Manta aquecedora equipamento usado juntamente com um balo de fundo redondo: uma fonte
de calor que pode ser regulada quanto temperatura (Figura 4.8)
- Agitador magntico utilizado no preparo de solues em reaes qumicas quando se faz necessrio
uma agitao constante (Figura 4.9)

Biotecnologia

SUMRIO

20

- Balana analtica usada para se obter massa com alta exatido. Balanas semi-analticas so
tambm usadas para medidas nas quais a necessidade de resultados confiveis no to necessria
(Figura 4.10)
Figura 4. Diversos materiais de uso comum em laboratrios qumicos e reas afins.

Fonte: Blog de vidraria de laboratrio (2014).

Referncias:
BLOG DE VIDRARIA DE LABORATRIO. Relao de produtos mais utilizados em laboratrios. Disponvel em:
<http://www.vidrariadelaboratorio.com.br>. Acesso em: 09 jun. 2014
UNIFEB. Apostila de Qumica Geral e Experimental. 2009. <http://xa.yimg.com/kq/groups/24693296/1821154571/
name/UNKNOWN_PARAMETER_VALUE>. Acesso em 30 mar 2014
SILVA, R. R. Da; Bocchi, N.; Filho, R. C. R. Introduo Qumica Experimental. So Paulo: McGraw-Hill, 1990.
Tcnicas Laboratoriais Bsicas. Disponvel em: <file:///C:/Users/user/Documents/UNIVATES/Ebooks%20finais/
3c063ab671ad9b66895ffa8f310ab5c4.pdf>. Acesso em: 31 mar 2014.
TRINDADE, D. F et al. Qumica - bsica experimental. So Paulo: Cone, 1998.

Biotecnologia

SUMRIO

21

1.3 PRINCIPAIS TIPOS DE GUA EMPREGADOS NO LABORATRIO


A gua um dos principais solventes da natureza, sendo o principal constituinte do corpo
dos seres vivos. Desta maneira, os ensaios laboratoriais que envolvem o uso da gua devem ser
feitos com gua de qualidade comprovada.
A primeira maneira de purificar a gua para uso laboratorial a destilao, que imita o
processo natural da evaporao.
A gua destilada empregada em praticamente todos os trabalhos de laboratrio. A
destilao da gua composta por duas etapas. Na primeira etapa, alguns elementos volatilizam
antes da ebulio da gua. Na segunda, ocorre a destilao da gua propriamente dita. medida
que a gua em ebulio evapora, ocorre a condensao da mesma em uma coluna de destilao,
onde o vapor dgua resfriado. A gua que se condensa pela coluna de destilao (destilado)
recolhida em recipiente adequado, no fim da coluna de destilao.
1.3.1 gua destilada
A gua destilada empregada em praticamente todos os trabalhos de laboratrio. A
destilao da gua composta por duas etapas. Na primeira etapa, alguns elementos volatilizam
antes da ebulio da gua. Na segunda, ocorre a destilao da gua propriamente dita. medida
que a gua em ebulio evapora, ocorre a condensao da mesma em uma coluna de destilao,
onde o vapor dgua resfriado. A gua que se condensa pela coluna de destilao (destilado)
recolhida em recipiente adequado, no fim da coluna de destilao.
1.3.2 gua bidestilada
Em certos casos, a gua destilada comum no suficientemente pura, tornando-se necessrio
preparar gua destilada por processos especiais.
A gua destilada obtida por meio da ebulio da gua da torneira e condensao do
vapor livre dos constituintes no volteis, como os ons sdio, potssio, clcio, magnsio, ferro,
cloreto, sulfato, carbonato, silicato etc. Uma parte, porm, destes constituintes pode ser arrastada
mecanicamente durante a destilao.
Os constituintes volteis originariamente presentes na gua, como o dixido de carbono
e a amnia, ou que se formaram durante a destilao em consequncia da decomposio de
matria orgnica, acompanham a gua no processo de destilao. Outra fonte de contaminao a
constituda pelos materiais de que so fabricados os aparelhos. Se o condensador for, por exemplo,
de vidro, a gua destilada ser contaminada em virtude da ao dissolvente que o vapor exerce
sobre este material. Quando se faz uso de condensadores de cobre, a gua conter traos deste
material, que pode ser altamente prejudicial em certos casos, principalmente se a presena do cobre
capaz de exercer uma ao cataltica.
Os melhores materiais para a construo dos condensadores so o estanho e o quartzo. A
gua destilada armazenada em frascos de vidro, mesmo tratando-se de vidro resistente, sofre
contaminao aprecivel. Em muitos casos, utiliza-se mais de uma destilao da gua destilada,
seguida de processos de deionizao.
1.3.3 gua Deionizada
Este processo consiste na passagem da gua em colunas contendo resinas trocadoras de ons
troca catinica e aninica. A troca catinica captura os ctions dissolvidos na gua, liberando ons
H+. J na troca aninica, a resina absorve os nions dissolvidos na gua, liberando ons OH-. Estas

Biotecnologia

SUMRIO

22

resinas, com o passar do tempo, tornam-se saturadas de ons das impurezas da gua. Este momento
detectado por um pequeno condutivmetro embutido no deionizador. Aps um processo de
renovao ou reciclagem, estas colunas podem ser reaproveitadas no deionizador.
1.3.4 gua ultrapura
gua ultrapura uma gua de extrema pureza, isenta de partculas, ons e substncias
orgnicas ou micro-organismos. obtida pela passagem da gua por sistemas de abrandamento
como resinas trocadoras, que substituem o clcio e o magnsio dissolvido na gua por ons de Sdio,
seguido de sistema de osmose reversa, que faz a remoo desses ons, seguido de um refinamento
por uma srie de filtros constitudos de resinas catinicas e aninicas, um leito de carvo ativo para
remoo de contaminantes orgnicos e, finalmente, um filtro fsico para remoo de particulados.
usado em laboratrios analticos onde se requer uma gua de altssima pureza como, por exemplo,
nas anlises por HPLC.
Referncias:
MABIC, S. Maintaining water quality in clinical chemistry. Advance for Medical Laboratory Professionals, v. 15, n. 8,
2007.
MABIC, S. Water for clinical chemistry. Application note, 2006.

Biotecnologia

SUMRIO

23

1.4 LIMPEZA E DESCONTAMINAO DE VIDRARIAS


A limpeza e ordem do material a ser utilizado so essenciais no laboratrio, pois muitas
substncias podem atacar o vidro ou causar interferncias nos procedimentos realizados. O sucesso
do trabalho depende, em grande parte, da lavagem adequada dos materiais utilizados em todos os
procedimentos laboratoriais.
Visualmente, um utenslio de laboratrio pode estar:
a) Sujo;
b) limpo.

O material do item a no pode ser usado nunca. O material do item b, embora visualmente
possa parecer limpo, ainda pode estar realmente:
a) contaminado com vrias impurezas qumicas e biolgicas;
b) contaminado com reduzida quantidade de impurezas qumicas;
c) realmente limpo para determinaes muito sensveis.

O material do item c pode ser usado em alguns casos em que a contaminao no seja sria;
comumente anlises rpidas e grosseiras. O material do item b pode ser utilizado para uso geral
(muitas anlises biolgicas de rotina e anlises qumicas de baixa preciso). O material do item e
utilizado em anlises qumicas e biolgicas finas, que exigem alto grau de pureza ou preciso,
exigindo procedimentos especiais para limpeza.
As anlises so comprometidas com a presena de impurezas, seja por contaminao da
amostra a ser preparada, seja pela alterao no volume ou peso final das mesmas. Assim, a matria
gordurosa impede o perfeito escoamento nos aparelhos volumtricos, causando inexatido do
trabalho.
indicado encher o aparelho volumtrico com gua da torneira. Retira-se a mesma e observase se houve escoamento completo ou se permanecem gotculas que indicam a presena de pontos
gordurosos. Lava-se com detergente e escova, enxaguando bem com gua da torneira e, por ltimo,
procede-se o enxgue com gua destilada.
1.4.1 Uso de Detergente
Existem diversas marcas de detergentes prprios para limpeza de vidraria. O Extran um
dos mais conhecidos, produzido pela Merck. Existem tambm outros tipos como o DECON 90, que
produzido pela Decon Laboratories, ou o DETERTEC, produzido pela Vetec. Estes podem ser
diludos em vrias concentraes (definidas no rtulo), dependendo do grau de sujeira do aparelho
a ser limpo. Podem ter caractersticas bem definidas como ao bacteriolgica ou iseno de alguma
substncia qumica como, por exemplo, o fsforo.
Coloca-se o detergente no aparelho com gotculas, deixando-se em contato por trs a cinco
minutos. A seguir, recolhe-se a mistura para o frasco de origem. Esta mistura tem um efeito
corrosivo sobre a pele. Portanto, deve-se manuse-la com cuidado. Aps, o aparelho lavado vrias
vezes com gua da torneira, e em seguida, duas ou trs vezes com gua destilada, secando-se as
paredes externas.

Biotecnologia

SUMRIO

24

1.4.2 Cuidados a serem observados durante a limpeza das vidrarias


- No se deve agitar as pipetas, buretas, alcometros, densmetros termmetros durante a lavagem;
- Deve-se ter todo o cuidado ao colocar os vidros sobre o balco, pois no choque com cermicas
podem se quebrar facilmente;
- Os bales volumtricos devem ser guardados abertos com a tampa amarrada por um cordo;
- As solues de limpeza devem ser utilizadas somente quando necessrio.

Referncias:
CHRISPINO, lvaro. Manual De Qumica Experimental. So Paulo: Editora tica. 2 Edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana No Laboratrio. Rio De Janeiro: Intercincia, 2001. 269 p.
DECON 90. http://www.decon.co.uk/english/decon90.asp. Acesso em: 31 mar 2014
LENZI, Ervim et al. Qumica Geral Experimental. Rio De Janeiro: Freitas Bastos, 2009. 390 p.
MERCK. Reactivos, diagnstica, productos qumicos 1992/93. Darmstadt, 1993. 1584 p.
PAVIA, Donald L. et al. Qumica Orgnica Experimental: Tcnicas de escala pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
Edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.
UNIFEB. Apostila de Qumica Geral e Experimental. 2009. Disponvel em: <http://xa.yimg.com/kq/
groups/24693296/1821154571/name/UNKNOWN_PARAMETER_VALUE>. Acesso em 30 mar 14

Biotecnologia

SUMRIO

25

1.5 SOLUES DE LIMPEZA E SECAGEM DE MATERIAL


As solues de limpeza devem ser utilizadas de acordo com o fim desejado. Podem ser cidas
ou alcalinas. As mais utilizadas so as de HCl 1,0 mol.L-1 e soluo alcolica de KOH. Em alguns
casos, podem-se utilizar os alvejantes como soluo de limpeza. Detergentes lquidos trazem no
rtulo as diluies correspondentes ao tipo de material que ser lavado, ou o tipo de contaminao
encontrada no material, assim como as precaues que devem ser tomadas.
Para trabalhar com estas solues de limpeza, deve-se ter o mximo de cuidado, pois todas
so txicas e corrosivas, prejudicando a pele, os olhos e outros rgos.
1.5.1 Soluo de HCl 1,0 mol.L-1
Pode ser utilizada em qualquer vidraria qumica. Prepara-se diluindo 8,5 mL de HCl
concentrado em aproximadamente 50 mL de gua, e completa-se o volume a 100 mL. A soluo
dever ser preparada em proveta com tampa.
8,5 mL HCl p.a. ..................100 mL H2O q.s.p.
OBSERVAO: As unidades p.a. significam para anlise, ou seja, o produto possui alto grau
de pureza e q.s.p. significa quantidade suficiente para, isto , a soluo a ser preparada segue uma
medida analtica.
1.5.2 Soluo alcolica de KOH
Muito utilizada na limpeza de materiais gordurosos. No recomendada para utilizao
em vidrarias volumtricas, como pipetas e buretas. Prepara-se esta soluo dissolvendo-se 35 g de
hidrxido de potssio em 20 mL de gua e dilui-se em lcool isento de aldedos, completando-se a
1000 mL.
35 g KOH em 20 mL H2O...........1000 mL lcool q.s.p.
1.5.3 Secagem do material
Aps a ltima lavagem, o material levado a secar espontaneamente sobre estantes, bancadas
ou secadores de vidrarias. Estufas a temperaturas de 100 105 oC aceleram a secagem, mas deve-se
observar os seguintes passos, para obter uma secagem correta e com segurana:
Material volumtrico jamais levado estufa, pois sua calibrao alterada;
Verificar se os materiais (vidraria, recipientes, etc) resistem a temperatura utilizada;
No secar utenslios de polietileno (plstico) a uma temperatura superior a 60 oC;
Algumas tintas usadas na identificao podem desaparecer a 100 oC;
Todo material lavado e seco dever ser guardado em gavetas ou armrios bem fechados. Os
bqueres e cpsulas devem ser emborcados.
A boca de frascos, como Erlenmeyer, pode ser protegida com pequeno papel.
Material utilizado para medidas de volume (provetas, pipetas, bales volumtricos etc.),
bem como outros objetos de vidro com paredes grossas, no podem ser aquecidos em estufas de
secagem. A distoro trmica do material implicaria na completa alterao da graduao e aferio.
Este tipo de material somente pode ser seco espontaneamente. Tambm pode ser usado o seguinte
processo: lavar o objeto uma ou duas vezes com lcool etlico, depois com acetona. Finalmente,
pode-se injetar ar comprimido dentro dos recipientes para acelerar a evaporao da acetona.

Biotecnologia

SUMRIO

26

Caso desejar uma secagem mais rpida, pode-se enxaguar a aparelhagem com acetona e, a
seguir, deixando-a secar ao ar ou na estufa.
Referncias:
MOURA, J. A. S.; YOGUI, G. T. Limpeza e preparao de vidrarias para anlise de compostos orgnicos.
Procedimento Operacional Padro Organo MAR-2012-05, Reviso n 1. Laboratrio de Compostos Orgnicos em
Ecossistemas Costeiros e Marinhos, Departamento de Oceanografia, Universidade Federal de Pernambuco, 2012. 6p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013.128 p.
UNIFEB. Apostila de Qumica Geral e Experimental. 2009. Disponvel em: <http://xa.yimg.com/kq/
groups/24693296/1821154571/name/UNKNOWN_PARAMETER_VALUE>. Acesso em 30 mar 14

Biotecnologia

SUMRIO

27

1.6 MEDIDAS DE VOLUMES DE LQUIDOS


Para se efetuar medida de volume de lquido, so empregados vrios tipos de aparelhos que
podem ser classificados de duas maneiras:
1.6.1 Aparelhos calibrados para conter um certo volume de lquido.
Exemplo: balo volumtrico (Figura 4).
Figura 4: Balo volumtrico

Fonte: Dos autores

1.6.2 Aparelhos calibrados para dar escoamento a certo volume de lquido.


Exemplo: pipetas volumtricas e buretas que possuem formato adequado para o escoamento
dos lquidos.
Figura 5: pipetas volumtricas e buretas

A) pipeta volumtrica

B) bureta

Fonte: Pr-anlise, 2014.

Biotecnologia

SUMRIO

28

A medida de lquidos com qualquer aparelho est sujeita a uma srie de erros devido s
seguintes causas:
Ao da tenso superficial sobre a superfcie lquida;
Dilatao e contrao provocadas pela variao de temperatura;
Imperfeita calibrao dos aparelhos volumtricos.
Estes erros afetam a exatido do aparelho. A bureta mais exata que as pipetas graduadas,
que por sua vez so mais exatas que as provetas. O bquer e o erlenmeyer no apresentam valor em
termos de exatido.
A leitura do volume contido no aparelho feita comparando-se o nvel do lquido com as
linhas calibradas existentes nas paredes do aparelho. O nvel do lquido usualmente considerado
como a parte inferior do menisco (superfcie curva do lquido), que mais facilmente localizada
quando se coloca um retngulo preto a 1 mm abaixo do menisco. Este ficar com uma colorao
escura, facilitando a leitura. A leitura deve ser feita quando a curvatura inferior do menisco coincidir
com a altura dos olhos. Evita-se, assim, o erro de paralaxe.
Forma correta de medir um volume: LEITURA PELA PARTE INFERIOR DO MENISCO
COM O OLHO AO NVEL APROPRIADO, conforme Figura 6:
Figura 6: Leitura de volume em proveta

Fonte: Busato, 2014.

Biotecnologia

SUMRIO

29

Quando feita a aquisio de aparelhos volumtricos estes j vm com a graduao


(calibrao) feita pelo prprio fabricante. recomendvel, entretanto, verificar a correo desta
graduao (aferio) no laboratrio onde sero utilizados.
Atualmente existem empresas especializadas e credenciadas para a execuo desta tarefa,
de acordo com normas exigidas para credenciamento de laboratrios e com critrios de qualidade
(Normas ISO). Neste sentido, deve-se tambm considerar as garantias de qualidade apresentadas
pelo prprio fabricante que fator relevante na hora da escolha de um fornecedor.
A medida de lquidos com qualquer aparelho est sujeita a uma srie de erros devido s
seguintes causas:
- dilatao e contrao provocados pelas variaes de temperatura;
- imperfeita calibrao dos aparelhos volumtricos.

Referncias:
BUSATO, Germano Luis Ferrari. Disponvel em: <http://followscience.com/content/368927/medidas-e-volumes>.
Acesso em 30 mar 2014.
CHRISPINO, lvaro. Manual De Qumica Experimental. So Paulo: Editora tica.2 Edio, 1994.230 p.
CIENFUEGOS, Freddy. Segurana No Laboratrio. Rio De Janeiro: Intercincia, 2001.269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio De Janeiro: Freitas Bastos, 2009. 390 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
Edio, 2009.546 p.
Pr-anlise. Disponvel em: <http://www.pro-analise.com.br>. Acesso em: 30 mar 2014.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.
UNIFEB. Apostila de Qumica Geral e Experimental. 2009. Disponvel em: <http://xa.yimg.com/kq/
groups/24693296/1821154571/name/UNKNOWN_PARAMETER_VALUE>. Acesso em: 30-03-14

Biotecnologia

SUMRIO

30

1.7 AQUECIMENTO EM BANHO MARIA


Utilizado para aquecer substncias inflamveis e com ponto de ebulio abaixo de 100 C.
Aparelhos mais sofisticados permitem o controle de temperatura por termostato. Consiste em
um sistema que apresenta recipiente adequado para colocar gua, que permite o aquecimento,
conforme Figura 7.
Figura 7: Aquecimento em banho-maria

Fonte: Dos autores

Biotecnologia

SUMRIO

31

1.8 AQUECIMENTO EM ALTAS TEMPERATURAS


Quando se necessita aquecer substncias em temperaturas superiores a 100 C, deve-se
utilizar outros materiais para esse fim: glicerina (at 220 C), leo minerais (250 a 300 C ), parafina
(at 220 C), fluidos de silicone (at 250 C ).
O aquecimento de qualquer lquido acima de seu ponto de ebulio pode provocar um
superaquecimento; para evitar isso, aconselha-se adicionar prolas de vidro ou de porcelana ao
lquido, antes que se inicia o aquecimento. As mesmas tm a funo de produzir um fluxo constante
de pequenas bolhas de pequenas bolhas de vapor quando aquecidos em um solvente, quebrando as
bolhas grandes dos gases produzidos, promovendo dessa forma uma ebulio suave e reduzindo a
probabilidade de ocorrncia de solavancos.
Tambm se pode recorrer a placas de aquecimento, porm as mesmas apresentam a
dificuldade de medir a temperatura de trabalho, e as mudanas de temperatura so lentas. O
controle da temperatura realizado manualmente por uma chave de controle, sendo que o
termostato indica quando a temperatura atingida. Algumas chapas de aquecimento incluem um
motor para agitao magntica, permitindo simultaneamente o aquecimento e a agitao de uma
mistura, conforme pode ser visto na Figura 8.
Figura 8: Aquecimento em placas

Fonte: Dos autores

Outra tima alternativa como fonte de calor so as mantas de aquecimento, cuja temperatura
regulada por um controlador de calor. A verdadeira temperatura da manta no pode ser controlada
com facilidade; porm, aps certa experincia torna-se relativamente fcil o controle. So ideais
para reaes e destilaes que exigem temperaturas relativamente elevadas. So muito fceis de
usar e de operao segura, devendo-se tomar o cuidado em evitar o derrame de lquidos no poo
da manta de aquecimento, j que a superfcie da base de cermica pode estar muito quente e fazer
o lquido pegar fogo. Na montagem da aparelhagem pode-se optar pela utilizao de macacos de
laboratrio ou blocos de madeira, para serem colocados sob a manta de aquecimento; neste caso a
manta abaixada e a aparelhagem fica presa na mesma posio. Outro cuidado que se deve ter

Biotecnologia

SUMRIO

32

em utilizar manta de tamanho compatvel com a vidraria que contm a soluo, a fim de se evitar
superaquecimentos (Figura 9).
Figura 9: Aquecimento em manta

Fonte: Dos autores

Biotecnologia

SUMRIO

33

1.9 AQUECIMENTO EM BICO DE BUNSEN


Existem vrios tipos de bicos de gs que so usados em laboratrio, tais como: bico de
Bunsen, bico de Tirril, bico de Mecker etc. Todos obedecem ao mesmo princpio de funcionamento:
o gs combustvel introduzido em uma haste vertical, onde h uma abertura para a entrada de
ar atmosfrico, sendo queimado na sua parte superior. Tanto a vazo do gs como a entrada de ar
podem ser controladas de forma conveniente.
O bico de Bunsen um bico de gs, especialmente construdo para uso de laboratrio,
utilizado para aquecimento at temperatura de 800 0C, por meio da combusto do gs (Figura 10).
Figura 10: Bico de Bunsen

Fonte: Dos autores

tubo.

Observando o bico de Bunsen, verifica-se que ele constitudo de trs partes: base, anel e

Entre a base e o tubo, h um anel de encaixe no qual existem orifcios ou janelas. A entrada
de ar ocorre atravs das janelas emparelhadas. Quando elas esto justapostas, pode-se dizer que
esto abertas; quando o anel cobre totalmente a janela do tubo, pode-se dizer que esto fechadas.
A chama luminosa (amarela) obtida quando o anel est fechado. Neste caso, a quantidade
de oxignio pequena, consequentemente menor ser a queima e menor ser a quantidade de calor
produzida pela chama. A chama no luminosa (azul) obtida quando o anel est aberto. Neste
caso, a quantidade de oxignio maior; maior ser a queima e maior ser a quantidade de calor
produzida pela chama.
Portanto, quando o anel est fechado, a combusto incompleta e h formao de fuligem
(carbono). Quando o anel est aberto, a combusto completa e no h formao de fuligem.
Para acender o bico de Bunsen, proceda da seguinte maneira:
- Primeiramente, verifique se as janelas do anel esto fechadas: o bico de Bunsen deve ser aceso com
as janelas fechadas para evitar que a chama se recolha para o interior do tubo.
- A seguir, abre-se a vlvula de gs da bancada. Feito isso, segure um fsforo aceso um pouco acima
e ao lado da extremidade do tubo. Abra o registro e acenda a chama. A chama que se obtm
grande, amarela e luminosa. Abre-se em seguida a entrada de ar, lentamente, at que a chama se
torne azul. Controle a quantidade de gs com o registro e gire o anel gradativamente at abrir por
completo as janelas do bico de Bunsen. Se, durante o funcionamento do bico, ouvir-se um rudo
tpico, deve-se regular a entrada de ar e de gs.

Biotecnologia

SUMRIO

34

- Eventualmente, quando a mistura de ar e de gs no estiver bem regulada, a queima se d dentro do


tubo. Se isto acontecer, apague imediatamente o bico, no deixando o gs escapar, a fim de evitar
exploses.

O mtodo apropriado para desligar o bico :


1) fechar a torneira da mesa do laboratrio
2) fechar a entrada de gs do bico de Bunsen.

Utilizado para aquecimento de misturas ou solues, de alguns graus acima da temperatura


ambiente at cerca de 600 C, podendo ser utilizados tambm para calcinaes em cadinhos. Devese tomar o cuidado de no usar diretamente a chama do Bico de Bunsen para aquecer bquer,
bales, erlenmeyer; nestes casos utilizar tela de amianto, que tem a funo de distribuir o calor de
maneira uniforme, no permitindo que a chama entre em contato direto com o material que contm
o lquido a ser aquecido.
Pode-se aquecer um lquido em um tubo de ensaio, diretamente na chama. Neste caso o tubo
deve estar seco por fora, deve ser ligeiramente inclinados e segurados por uma pina e deve-se
direcionar o tubo na direo em que no haja algum.

Biotecnologia

SUMRIO

35

1.10 RESFRIAMENTO EMPREGANDO BANHO DE GELO


Em muitas tcnicas torna-se necessrio resfriar o frasco que contm a nossa soluo em
temperaturas inferiores temperatura ambiente. Neste caso, deve-se usar banho de gelo, que
consiste num banho de gelo e gua, cuja temperatura fica prxima a 0 C. A quantidade de gua
deve permitir que o frasco fique apoiado ao fundo de maneira segura.
Caso desejar um banho com temperaturas levemente abaixo de 0 C, deve-se adicionar um
pouco de cloreto de sdio ao banho, atingido assim temperaturas de at 10 C.
Utilizando dixido de carbono slido (gelo seco), adicionados a um banho com lcool
isoproplico, pode-se atingir temperaturas de 78,5 C. Neste caso, tome o cuidado para no se
queimar com o gelo seco. J utilizando nitrognio lquido, pode-se atingir temperaturas de 195,8 C.
Referncias:
CHRISPINO, lvaro. Manual De Qumica Experimental. So Paulo: Editora tica. 2 Edio, 1994.230 p.
CIENFUEGOS, Freddy. Segurana No Laboratrio. Rio De Janeiro: Intercincia, 2001.269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio De Janeiro: Freitas Bastos, 2009. 390 p.

Biotecnologia

SUMRIO

36

1.11 UTILIZAO DE EVAPORADOR ROTATRIO


(ROTAEVAPORADOR)
Pode-se evaporar um solvente, sob presso reduzida, utilizando-se de evaporadores
rotatrios. Este aparelho contm um motor que permite a evaporao rpida de solventes, por
aquecimento, aplicando um vcuo no sistema, promovendo tambm o giro do balo que contm
a soluo. Pode-se colocar um banho de gua sob o balo para aquecer a soluo e aumentar a
presso de vapor do solvente. A velocidade de rotao do balo e a temperatura do banho de gua
podem ser selecionadas, de acordo com o desejado. Quando o solvente evapora, os vapores so
resfriados pelo condensador e recolhidos em um balo, sendo que o produto permanece no balo
em rotao (Figura 11).
Figura 11: Evaporador rotativo

Fonte: Dos autores.

Referncias:
CHRISPINO, lvaro. Manual de Qumica Experimental. So Paulo: Editora tica. 2 edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana no laboratrio. Rio de Janeiro: Intercincia, 2001. 269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio de Janeiro: Freitas Bastos, 2009. 390 p.
PAVIA, Donald L et al. Qumica Orgnica experimental: Tcnicas de escala pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

37

1.12 TRANSFERNCIA DE LQUIDOS


Se o material em manuseio for lquido, deve-se cuidar para que o frasco no esteja umedecido;
caso isso tenha ocorrido, seque-o previamente. Ao verter o lquido de um frasco, deve-se faz-lo do
lado oposto ao rtulo. Isso evita que o mesmo seja danificado, caso o lquido escorra. Ao transferir
o lquido de um frasco para o outro, deve-se utilizar um basto de vidro, para evitar que o lquido
escorra para fora do frasco. A Figura 12 mostra o procedimento.
Figura 12: Transferncia de lquidos

Fonte: Dos autores.

Referncias:
OLIVEIRA, C. M. A. et al. Guia de laboratrio para o ensino de qumica: instalao montagem e operao. CRQ-IV:
So Paulo, 2007. 53 p.

Biotecnologia

SUMRIO

38

1.13 TRANSFERNCIA DE SLIDOS


Caso o slido em manuseio seja corrosivo, deve-se cuidar para que o frasco no esteja
umedecido. Caso esteja umedecido, limpe-o previamente. Quando retirar uma tampa plstica
rosquevel de um frasco, evite deix-la sobre a bancada com o lado aberto tocando a bancada, a
fim de evitar contaminaes. Jamais coloque objetos sujos no interior do frasco e s retorne uma
substncia ao seu frasco original, se tiver certeza absoluta que a mesma no foi contaminada
durante o manuseio.
Para transferir o slido, deve-se pegar uma pequena quantidade do mesmo com uma
esptula, a Figura 13 apresenta o procedimento.
Figura 13: Transferncia de slidos

Fonte: Dos autores.

Referncias:
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

39

1.14 TCNICAS DE PESAGEM


A pesagem feita com a utilizao de balanas, sendo uma das mais importantes tcnicas
de laboratrio. Existe uma grande variedade de balanas no mercado, diferenciando-se conforme a
sensibilidade e preciso. As balanas podem ser:
a) Semianaltica: apresentam o prato para colocao da amostra, podendo ou no ter protees
laterais (Figura 14) e superiores que evitam que as correntes de ar provoquem erros nas leituras ou
instabilidade no valor informado. Sua sensibilidade da ordem de 0,1 a 0,001 g;
Figura 14: Balana semianaltica

Fonte: Dos autores

b) Analticas: apresentam o prato para a colocao da amostra com proteo lateral, com o objetivo
de evitar que as correntes de ar provoquem instabilidade ou erros de leitura. Apresentam
sensibilidade de 0,0001 a 0,00001 g sendo, dessa forma, utilizadas quando se requer uma maior
preciso na pesagem. necessrio salientar que, para uma maior estabilidade da balana durante
a pesagem, preciso construir uma plataforma com isolamento pra colocar a balana (Figura 15).
Figura 15: balana analtica

Fonte: Dos autores.

Biotecnologia

SUMRIO

40

Cuidados com a balana:


a) No remova os pratos;
b) Ligue-a previamente deixando-a estabilizar por cerca de 30 min;
c) Observe se a balana est nivelada;
d) Coloque as substncias de maneira centralizada na balana e a temperatura ambiente;
e) Coloque a balana em um local com o mnimo de vibrao, variao de temperatura e mudanas
de temperatura;
f) Mantenha-a sempre limpa;
g) No coloque o material a ser pesado diretamente na balana; coloque-o em um recipiente seco e
previamente pesado (tarado), tais como: bquer pequeno, papel filtro, vidro relgio etc.;
h) Caso o material que for pesado tenha a propriedade de evaporar, oxide ou absorva a umidade,
tampe o recipiente que contm a substncia;
i) Execute todas as operaes cuidadosamente e com movimentos suaves;
j) No manuseie os objetos que esto sendo pesados com as mos, utilize pinas ou esptulas.

Existem vrios tipos de balana analtica: manuais, eltricas e digitais. O princpio, porm,
o mesmo. Consiste em se fazer uma comparao entre a massa que se quer medir e a massa de
pesos de referncia.
As balanas manuais, mais antigas, possuem dois braos iguais presos por estribos a uma
barra central. Estes braos abrigam os pratos da balana, onde se efetua a pesagem. Os pesos de
referncia (analticos) so manuseados sempre por intermdio de uma pina adequada. Nunca
so manuseados diretamente com a mo. Todo este sistema est armazenado dentro de uma caixa
fechada com paredes de vidro e janelas laterais.
As balanas eltricas, ainda utilizadas, possuem o mesmo princpio. Porm, um dos pratos
interno e o outro externo. No prato externo coloca-se o corpo cuja massa se quer medir. O prato
interno possui barras horizontais ao longo de sua altura, onde so depositados pesos analticos
(massas de referncia) por meio de botes situados na parte frontal e balana. Existe uma escala
fixa, que d valores de massa da centena at o dcimo de grama. Tambm existe uma escala mvel,
que registra valores de massa das trs ltimas casas depois da vrgula.
As balanas digitais, mais modernas, possuem somente um prato. Internamente, possuem
um sistema eletrnico, com placas de circuito impresso, que substitui os pesos de referncia. Estas
balanas so mais precisas e prticas de manusear, pois possuem um sistema de taragem. So
calibradas com um peso de referncia. Com a balana estabilizada e no nvel, calibra-se o zero com
o prato livre de qualquer corpo. Depois, procede-se a calibrao da massa deste peso de referncia.
Tem-se, da, um intervalo de calibrao. A partir dele, o sistema eletrnico da balana est apto
para medir qualquer outra massa, dentro de seu limite de medida.
A balana analtica um instrumento de preciso, de construo delicada que exige do
operador o mximo cuidado para obter resultados corretos. Por isso, recomenda-se observncia
rigorosa do que segue:
a) A balana analtica deve ser instalada em local adequado, de preferncia em sala especial, separada
do laboratrio, onde ela no fique sujeita ao de vapores corrosivos. Um lugar onde, tambm
no incida luz solar direta, nem se verifiquem mudanas bruscas de temperatura. A balana
colocada sobre uma plataforma fixa a uma parede to livre quanto possvel de vibraes e bem
nivelada;
b) Nenhum cristal, p ou gota de material deve permanecer sobre a mesa da balana, ou no interior
da mesma;
c) A caixa da balana deve ser mantida fechada enquanto no estiver em uso;
d) A balana deve ser conservada no nvel;

Biotecnologia

SUMRIO

41

e) Enquanto no estiverem em uso, a alavanca e o prato devero ser mantidos suspensos (travados) e
sem objetos ou pesos sobre seu prato;
f) A colocao de massas no prato deve ser feita cuidadosamente, evitando choque, com o auxlio de
pinas apropriadas e sempre com a balana travada;
g) Os reagentes nunca so colocados diretamente sobre o prato, mas em recipientes apropriados (vidro
de relgio, frascos de pesagem etc.) e no caso de pequenas quantidades de material inofensivo,
pode ser usado papel gessado ou papel de alumnio;
h) Sendo volteis, a pesagem de lquidos e slidos corrosivos, requer cuidados especiais; semelhantes
materiais tm de ser pesados em recipientes perfeitamente fechados;
i) A carga mxima da balana nunca deve ser ultrapassada;
j) O prato da balana sempre deve ser conservado rigorosamente limpo. Qualquer corroso, mesmo
pequena de sua cromagem requer a sua substituio ou conserto;
k) Evitar apoiar-se sobre a plataforma-suporte da balana, quando em operao ou no, para evitar
oscilaes, desnvel e, portanto, desequilbrio do aparelho;
l) sempre aconselhvel que as balanas sejam ligadas 30 minutos antes do uso, para ambientao e
autocalibrao;
m) Colocar o recipiente de pesagem no centro do prato da balana;
n) Cuidar para que o material de pesagem no encoste nas paredes da balana.

Referncias:
CHRISPINO, lvaro. Manual de Qumica Experimental. So Paulo: Editora tica. 2. edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana no laboratrio. Rio de Janeiro: Intercincia, 2001. 269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio de Janeiro: Freitas Bastos, 2009. 390 p.
PAVIA, Donald L et al. Qumica Orgnica experimental: Tcnicas de escala pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

42

1.15 MTODOS DE PESAGEM


Em resumo, as etapas envolvidas na utilizao de uma balana analtica so: acerto do nvel;
acerto do zero; pesagem propriamente dita e leitura da massa do objeto no painel da balana.
Normalmente, os objetos so pesados em frascos de pesagem. Estes so: vidro de relgio, pesa-filtro
(frasco de forma cilndrica e com tampa esmerilhada) e, em algumas situaes, bequer de 50 mL
ou 100 mL. Tambm so utilizados, em situaes especficas, papel alumnio e papel gomado. Os
dispositivos de trava e semitrava, os botes que acionam as massas aferidas (pesos de referncia),
bem como detalhes de operao, variam de uma balana para outra. Por isso, desenvolveremos as
tcnicas de pesagem aqui descritas de forma genrica.
Existem dois mtodos comumente usados para pesagem de reagentes:
1.15.1 Pesagem por adio
Consiste em adicionar o reagente ao recipiente de pesagem.
Para balanas analticas digitais, deve-se proceder da seguinte maneira: aps a balana estar
estabilizada e zerada, coloca-se um recipiente de pesagem adequado (vidro de relgio ou frasco
de pesagem) sobre o prato da mesma. Procede-se a taragem da balana, que o procedimento
de descontar a massa do recipiente. Aps, com o auxlio de uma esptula adequada, vai-se
colocando no recipiente pequenas pores do reagente a ser pesado, at atingir a massa desejada.
Este procedimento deve ser feito de forma lenta e com todo o cuidado, pois qualquer quantidade
de reagente que, por descuido, cair no prato da balana (fora do recipiente) vai gerar um erro de
pesagem.
Etapas de pesagem por adio
Antes de iniciar o processo de pesagem, verifique se o prato da balana est limpo e se a
balana est zerada.
As etapas envolvidas na utilizao de uma balana analtica so:
- Ligar a balana apertando no boto ON.
- Zerar a balana, apertando na tecla TARE.
- Introduzir o recipiente de pesagem sobre o centro do prato da balana.
- Fechar as portas laterais da balana e tare a balana (boto TARE) com o recipiente no qual vai ser
colocado o material a ser pesado.
- Adicionar o material sobre o recipiente.
- Fazer a leitura da massa do material diretamente no mostrador, cuidando para que as portas laterais
da balana estejam fechadas.

1.15.2 Pesagem por diferena


Consiste em retirar de um recipiente (pesa-filtro) o valor a ser pesado.
Para balanas analticas digitais, deve-se proceder da seguinte maneira: aps a balana estar
estabilizada e zerada, coloca-se o pesa-filtro (contendo uma quantidade de reagente superior a que
se quer pesar) sobre o prato da mesma, e procede-se a taragem. A partir deste momento, o pesafiltro no deve mais ser manuseado diretamente com a mo. Deve-se usar luvas ou um pedao de
papel filtro para manuse-lo. Isto porque a gordura natural das mos adere no frasco, alternado o
peso inicial.

Biotecnologia

SUMRIO

43

Aps ter-se definido a massa de reagente a ser pesada, tira-se o frasco do interior da balana e
se retira pequenas pores de reagente. Este procedimento deve ser feito com cuidado, inclinandose o frasco e batendo-se levemente a tampa deste na sua borda, para que o reagente caia aos poucos
no recipiente que vai ser utilizado para solubilizar o slido.
A cada retirada de pequena poro de reagente do pesa-filtro, tampa-se o mesmo, colocando-o
na balana para, com a tampa lateral desta fechada, proceder-se nova leitura. Este procedimento
repetido vrias vezes, at que a balana indique que j a quantidade desejada de reagente foi
retirada.
Referncias:
CHRISPINO, lvaro. Manual de Qumica Experimental. So Paulo: Editora tica. 2 edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana no laboratrio. Rio de Janeiro: Intercincia, 2001. 269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio de Janeiro: Freitas Bastos, 2009. 390 p.
PAVIA, Donald L et al. Qumica Orgnica experimental: Tcnicas de escala pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

44

1.16 MEDIDAS DE VOLUME


Em trabalhos de laboratrio, as medidas de volume so efetuadas com provetas graduadas,
quando se deseja uma medida aproximada de volume. J quando se quer uma medida mais
grosseira, utilizam-se bqueres com escalas, e quando se deseja medidas precisas, utilizam-se
aparelhos volumtricos como pipetas e bales volumtricos. A leitura do volume de lquidos deve
ser feita pela parte inferior do menisco.
1.16.1 Pipetas
H dois tipos de pipetas: pipetas de transferncia (ou volumtricas) e pipetas graduadas. As
de transferncia apresentam um bulbo na parte central e apenas um trao de referncia. Servem
para escoar um determinado volume de um recipiente para outro. Com pipeta graduada pode-se
medir vrios volumes. As figuras de pipetas j foram evidenciadas, mas a ttulo de diferenciao,
a Figura 16 evidencia os diferentes tipos, assim como tem-se as pipetas automticas, para volumes
discretos.
Figura 16: Pipeta volumtrica (A), pipeta graduada (B) e pipeta automtica (C)

A
Fonte: Dos autores.

1.16.2 Uso de pipetas em geral


Depois de perfeitamente limpa, a pipeta ambientada, lavando-se com pequenas quantidades
de soluo a medir, para remoo de possveis gotas de gua destilada, que provocariam uma
pequena diluio na soluo. Em seguida, introduzida na soluo. Faz-se a suco (nunca com a
boca) at acima da marca do zero (marca superior), tendo o cuidado de evitar a formao de bolhas.
Aps, a extremidade superior fechada com o dedo indicador (nunca com o polegar). Seca-se a
parte externa da pipeta com um papel filtro. Depois, relaxando levemente a presso do dedo, deixase escoar lentamente o lquido para zerar e, s ento, procede-se o escoamento desejado. Aps o
escoamento, aguarda-se 15 segundos. Se alguma gota ainda ficar na posio inferior da pipeta, esta
removida, encostando-se a ponta da mesma contra a parede do recipiente. Nunca se deve soprar

Biotecnologia

SUMRIO

45

a pequena poro de lquido que fica retido na extremidade da pipeta, salvo em pipetas especiais.
Estas possuem duas listras na ponta superior. Nestes casos, pode-se retirar o resduo de lquido
de seu interior, fechando-se a extremidade superior com o dedo indicador e, com a outra mo,
segurando o bulbo da pipeta. Com isto, provoca-se ligeiro aumento da temperatura do ar interno,
causando uma expanso suficiente para expulsar o resduo de lquido.
A Figura 17 mostra como se manuseia corretamente uma pipeta.
Figura 17: manuseio correto da pipeta

Fonte: Manuseio de pipetas, 2014.

Para proceder suco de lquidos existem os pipetadores. O exemplo clssico de pipetador


o de trs vias. Compreende de um bulbo de borracha com trs aberturas:
- uma superior para se retirar o ar interno do bulbo e outras duas inferiores. Uma para fazer a
suco do lquido e a outra para liber-lo. Ultimamente, foram confeccionados pipetadores tipo
seringas, que promovem a suco do ar interno da pipeta, fazendo com que o lquido suba.

Biotecnologia

SUMRIO

46

As pipetas volumtricas e como todos os aparelhos volumtricos, devem ser aferidos quando
se necessita utiliz-los em anlises volumtricas. Esta tcnica baseia-se na determinao da massa
de gua destilada contida dentro da pipeta. De uma forma resumida, so feitas trs medidas de
gua destilada, em temperatura conhecida, para cada pipeta. Escoa-se esta quantidade para frascos
erlenmeyer de 125 mL (com tampa), pesados previamente em balana analtica. Estes frascos
so pesados novamente e, com o auxlio de tabelas apropriadas, faz-se a converso dos pesos
encontrados para os respectivos volumes corrigidos (nas temperaturas medidas).
Mais recentemente, surgiram as micropipetas. Estas servem para se obter medidas de
volumes extremamente pequenos. Estas pipetas so utilizadas, em sua grande parte, em anlises de
cromatografia, onde se necessitam volumes muito pequenos de amostra para a leitura do aparelho.
Em alguns laboratrios, em que se exige maior preciso nas anlises, so utilizadas pipetas
automticas. Deve-se evitar a sua utilizao com lquidos corrosivos como cido sulfrico ou cido
clordrico. Neste tipo de pipeta deve-se sempre utilizar ponteiras plsticas.
1.16.3 Uso de buretas
As buretas so constitudas de tubos de vidro calibrados que permitem o fcil controle de
escoamento de volumes variveis de lquidos.
Ao ser utilizada, deve ser fixada na posio vertical, fixa em um suporte. Inicialmente devese ambientar a mesma com o reagente a ser utilizado, lavando a mesma com cerca de 5 mL do
mesmo, o qual deve ser adicionado com o auxlio de um funil. Enche-se ento a bureta, at um
pouco acima do marco zero, e deixa-se escoar o reagente at que atinja o zero da escala, tomando o
cuidando na leitura do mesmo a fim de evitar erros. Durante esse processo deve-se eliminar todas
as bolhas de ar que possam existir. Coloca-se ento o frasco que vai receber o lquido abaixo da
bureta, deixando o lquido escoar lentamente. A torneira da bureta deve ser controlada com a mo
esquerda. Aps escoar a quantidade necessria do lquido deve-se aguardar alguns segundos para
fazer a leitura do volume retirado.
As buretas, assim como as pipetas volumtricas, tambm necessitam ser aferidas, caso sejam
utilizadas em determinaes quantitativas mais precisas. A tcnica de aferio de buretas segue a
mesma lgica da tcnica descrita para aferio e pipetas volumtricas. Porm, um pouco mais
complexa, pois se faz a aferio de cada segmento de 5 ou 10 mL. A Figura 18 evidencia uma bureta.

Biotecnologia

SUMRIO

47

Figura 18: Bureta em um suporte universal

Fonte: Dos autores.

1.16.4 Uso de Bales Volumtricos


Os bales volumtricos so bales de fundo chato, gargalo comprido e calibrado para conter
determinados volumes lquidos. Apresentam um trao fino gravado em torno do gargalo, que
indica at onde o nvel do lquido deve ser elevado para completar o volume do frasco.
O gargalo deve ser estreito para que uma pequena variao de volume provoque uma
sensvel diferena na posio do menisco.
Para se acertar o menisco do lquido marca, deve-se observar o balo apoiado numa
superfcie horizontal.
Os bales volumtricos so usados na preparao de solues de concentrao conhecida e
na diluio de solues j preparadas.
Procedimentos durante o uso do balo volumtrico na preparao de solues:
O reagente devidamente pesado e passado para um bquer, onde dissolvido. A soluo
assim obtida passada para o balo. O bequer lavado vrias vezes com pequenas pores de gua
destilada para que ocorra uma transferncia quantitativa, cuidando-se para no exceder a marca
do gargalo. S ento a soluo diluda, fazendo-se o solvente escoar pelas paredes do balo, at
que o lquido chegue extremidade inferior do gargalo. Espera-se o excesso de lquido escoar.
Com o auxlio de um basto de vidro, cuja extremidade possui um pedao de papel filtro
preso com uma fita durex, promove-se a secagem da parte superior do gargalo. Somente depois
deste procedimento feito o ajuste final, com o auxlio de uma pequena pipeta, de tal maneira que
o menisco fique tangente ao trao de referncia do balo. Em seguida, agita-se vigorosamente at
que a soluo se misture perfeitamente. Em caso de diluies de solues concentradas, se este
processo for exotrmico, procede-se uma diluio inicial num bequer com pouco volume de gua.
Espera-se esfriar e, ento, repete-se o procedimento para reagentes slidos acima citados.

Biotecnologia

SUMRIO

48

Referncias:
Manuseio de pipetas. Disponvel em: <http://coracaodefarmaceutico.blogspot.com.br/2013/05/controle-dequalidade-nocoes-basicas.html>. Acesso em: 31/03/2014
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013.128 p.

Biotecnologia

SUMRIO

49

1.17 PROCESSO DE SEPARAO POR FILTRAO


A filtrao tem por finalidade remover impurezas slidas de um lquido ou de separar um
slido desejado de uma soluo em que ele foi precipitado ou cristalizado. Isso efetuado passando
a mistura por um material poroso que retm as partculas do slido.
A fase lquida (filtrado) atravessa o material poroso, enquanto a fase slida (precipitado) fica
retida.
Tal material poroso pode ser: papel de filtro, algodo, tecido, vidro sinterizado, porcelana
porosa, fibras de vidro ou amianto etc. O mais usado em laboratrio o papel de filtro. Existem
papis de filtro de vrias porosidades, e a escolha depende do tamanho e da natureza das partculas
do slido.
A passagem do lquido pelo material poroso pode ser efetuada pela ao da gravidade
(filtrao simples) ou por reduo da presso (filtrao por suco).
1.17.1 Filtrao Simples
Utiliza-se um funil simples em que foi adaptado um cone de papel de filtro.
A filtrao, com auxlio do papel de filtro, feita por gravidade, sem suco.
O papel de filtro circular dobrado e inserido num funil de vidro, como est descrito na
Figura 19. O papel de filtro, de forma circular, dobrado pela metade e depois esta metade
dobrada novamente, adquirindo aproximadamente um quarto do tamanho original. A segunda
dobra deve ser feita de maneira que fique um intervalo de 5 mm entre as duas pontas. De uma das
pontas do papel, rasga-se um pequeno tringulo irregular, para facilitar a adeso do papel ao funil.
Em seguida, abre-se o papel de tal maneira que adquira a forma de um cone, e coloca-se no funil de
modo que o corte no papel fique aderido ao vidro. A Figura 19 mostra o procedimento do uso do
papel filtro.
Figura 19: Uso do papel filtro para filtrao simples

Fonte: Filtrao, 2014.

Umedece-se o papel com uma pequena quantidade do solvente com que se est trabalhando,
de modo a se obter uma boa aderncia. Para uma rpida filtrao, o papel deve ser ajustado no
funil de modo que o ar no penetre entre o papel e o funil. O dimetro do papel de filtro utilizado
deve ser tal que sua parte superior deve estar a 1 cm abaixo da borda do funil de vidro.

Biotecnologia

SUMRIO

50

A transferncia feita com o auxlio de um basto de vidro, recolhendo-se o filtrado em um


bquer. A extremidade inferior da haste do funil deve ser encostada na parede interna do bquer
usado no recolhimento do filtrado. Deve-se manter, durante toda a filtrao, o nvel de soluo a
da altura do papel de filtro no funil. Os ltimos traos do slido so transferidos para o papel
de filtro com o auxlio de jatos de solvente, utilizando um frasco lavador. Lava-se o slido com
pequenas pores do solvente.
1.17.2 Filtrao por suco
O processo de separao pode ser acelerado por meio de uma filtrao por suco, a chamada
filtrao presso reduzida ou filtrao a vcuo.
efetuada utilizando uma aparelhagem como a da Figura 20: o frasco kitassato A, provido
de um funil de Buchner, ligado a um frasco de segurana B, vazio, que por sua vez est conectado
a uma trompa de gua C (ou uma bomba de vcuo). Corta-se um crculo de papel de filtro, cujo
dimetro deve ser 1 a 2 mm menor do que o dimetro interno do funil de Buchner. Coloca-se o papel
no funil de modo a cobrir os orifcios do funil, sem entretanto chegar at as paredes do mesmo. Ligase a trompa de gua, umedece-se o papel de filtro com o solvente e efetua-se a filtrao. Terminada
esta, abre-se a entrada de ar do kitasato do frasco de segurana, antes de fechar a torneira da trompa
de gua.
Este tipo de filtrao tem a vantagem sobre a filtrao simples, por ser mais rpida e por
deixar menor quantidade de impurezas e solvente no slido.
Figura 20: Filtrao por suco

Fonte: Dos autores

Referncias:
Filtrao. Disponvel em: <http://www.soq.com.br/conteudos/ef/misturas/p2.php>. Acesso em 31/03/2014.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

51

1.18 PROCESSO DE SEPARAO POR CENTRIFUGAO


Muitas vezes a centrifugao mais efetiva na remoo de impurezas slidas do que as
tcnicas convencionais de filtrao. utilizada na separao de misturas slido-lquidas ou de
dois lquidos imiscveis; baseando-se no princpio de que o slido ou lquido de maior densidade
ir para o fundo do recipiente, de maneira rpida e eficiente. Com esse processo partculas muito
pequenas que poderiam passar pelos filtros tradicionais so removidas. Na centrifugao, deve-se
tomar alguns cuidados:
a) Utilizar culos de proteo;
b) Colocar os tubos aos pares na centrifuga e sempre em sentido oposto um ao outro, a fim de
balancear o peso sobre o eixo central;
c) Se ao ligar a centrfuga ocorrerem vibraes, deslig-la e revisae todos os seus passos.

A Figura 21 apresenta uma centrfuga.


Figura 21: Centrfuga

Fonte: Dos autores

Referncias:
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

52

1.19 PROCESSO DE SEPARAO POR PRECIPITAO


Quando se forma uma substncia insolvel pela reao de duas substncias em soluo,
a substncia insolvel formada precipita-se, ou seja, deposita-se, mais ou menos lentamente, no
fundo do recipiente em que ocorreu a reao.
Uma das maneiras de separar esse precipitado do restante da soluo atravs da filtrao
simples ou filtrao a vcuo.
Referncias:
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

53

1.20 PROCESSO DE SEPARAO POR DECANTAO


Neste processo no necessrio usar papel filtro para separar partculas insolveis. Quando as
partculas so grandes e pesadas pode-se deixar a soluo em repouso para promover a decantao,
ou seja: o depsito das mesmas no fundo do recipiente. A seguir, derrama-se cuidadosamente o
lquido deixando as partculas slidas.
Referncias:
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013.128 p.

Biotecnologia

SUMRIO

54

1.21 TCNICAS DE PREPARO DE SOLUES


Um dos procedimentos mais realizados em laboratrio o preparo de solues.
As solues so definidas como misturas homogneas de dois ou mais componentes. Duas
palavras muito empregadas na discusso das solues so: soluto e solvente. A substncia presente
em maior quantidade geralmente chamada de solvente e a de menor quantidade, soluto.
Os solutos podem ser de origem slida ou lquida. Ambos podem ter sua massa pesada
em balana. Porm, o mais comum que somente os solutos slidos tenham sua massa pesada
em balana. A massa de soluto lquido, normalmente, convertida a volume, por intermdio da
respectiva massa especfica e, posteriormente, este volume medido com algum instrumento para
medida de volume.
A maioria das reaes que ocorre num laboratrio envolve o uso de diferentes solues
comuns ou solues padro. As solues comuns so usadas em reaes nas quais no necessrio
ter a concentrao exata do soluto, ou seja, em procedimentos no quantitativos. As solues
padres so utilizadas nas determinaes quantitativas, ou seja, em ensaios que tm por objetivo
determinar, com bom nvel de exatido, quantidades de uma substncia a partir da reao com
uma soluo de concentrao conhecida e exata. Por este motivo, o preparo destas solues deve
ter alto rigor analtico.
1.21.1 Preparao de solues comuns
1.21.1.1 A partir de um reagente slido (soluto slido)
Etapas para o preparo de solues a partir de um soluto slido:
1. Passar gua destilada em todo o material.
2. Secar cuidadosamente a esptula e o vidro de relgio.
3. Pesar no vidro de relgio a massa de soluto necessria.
4. Transferir o soluto do vidro de relgio para um bquer lavando o vidro de relgio com solvente, de
modo a arrastar todo o soluto.
5. Dissolver todo o soluto utilizando apenas uma parte do solvente e agitando com um basto de
vidro.
6. Verter a soluo para o balo volumtrico, com auxlio de um funil, lavando o bquer, o basto de
vidro e o funil com solvente para arrastar todo o soluto, cuidando para no exceder a marca do
gargalo.
7. Aps a soluo diluda, fazendo o solvente escoar pelas paredes do balo, at que o lquido
chegue extremidade inferior do gargalo. Se o gargalo do balo volumtrico estiver com a parte
superior da marca molhado este deve ser secado com a ponta de um basto de vidro envolvida
com papel filtro. Faz-se o ajuste final, com o auxlio de uma pipeta de Pasteur ou de um contagotas, lentamente, de tal maneira que o menisco fique tangente ao trao de referncia.
8. Fechar o balo e homogeneizar a soluo invertendo vrias vezes o balo volumtrico.
9. A seguir, transfira a soluo para um frasco apropriado e devidamente etiquetado com o nome do
composto, a concentrao da soluo, identificao de quem preparou a soluo e data.

1.21.1.2 A partir de um reagente lquido (soluto lquido ou diluio de uma soluo


previamente preparada)
Etapas para o preparo de solues a partir de um soluto lquido:
1. Passar gua destilada em todo o material.

Biotecnologia

SUMRIO

55

2. Medir o volume de soluto necessrio com o auxlio de uma pipeta e transferir para um bquer.
3. Diluir o soluto utilizando apenas uma parte do solvente e agitando com um basto de vidro.
4. Verter a soluo para o balo volumtrico, com auxlio de um funil, lavando o bquer, o basto de
vidro e o funil com solvente para arrastar todo o soluto, cuidando-se para no exceder a marca do
gargalo.
5. Aps a soluo diluda, fazendo-se o solvente escoar pelas paredes do balo, at que o lquido
chegue extremidade inferior do gargalo. Se o gargalo do balo volumtrico estiver com a parte
superior da marca molhado este deve ser secado com a ponta de um basto de vidro envolvida
com papel filtro. Faz-se o ajuste final, com o auxlio de uma pipeta de Pasteur ou de um contagotas, lentamente, de tal maneira que o menisco fique tangente ao trao de referncia.
6. Fechar o balo e homogeneizar a soluo invertendo vrias vezes o balo volumtrico.
7. A seguir, transfira a soluo para um frasco apropriado e devidamente etiquetado com o nome do
composto, a concentrao da soluo, identificao de quem preparou a soluo e data.

IMPORTANTE: Toda a soluo cida ou bsica deve ser preparada adicionando-se cido ou
base gua (e nunca o contrrio) para evitar exploso, devido ao alto calor de dissoluo desses
reagentes.
1.21.2 Preparao de soluo padro
Uma soluo denominada PADRO quando sua concentrao exatamente conhecida.
A preparao de uma soluo padro requer, direta ou indiretamente, o uso de um reagente
quimicamente puro e com composio perfeitamente definida. Os reagentes com tais caractersticas
so chamados de PADRES PRIMRIOS. Portanto, se obtm uma soluo padro se esta for
preparada diretamente a partir de um padro primrio, ou se for padronizada ao reagir com um
padro primrio.
Para que uma substncia possa servir como padro primrio, so requeridas certas exigncias:
- Ela deve ser de fcil obteno, purificao, dissecao e conservao;
- As impurezas que por ventura existam no reagente devem ser facilmente identificveis;
- O reagente no deve ser higroscpico ou voltil;
- O reagente deve ser bastante solvel.

Quando em uso numa titulao, uma bureta deve ser manipulada corretamente, para evitar
maiores erros.
Coloca-se em um erlenmeyer a amostra a ser titulada, cuja massa ou volume deve ser
conhecido com exatido. Conforme o caso adiciona-se a seguir as substncias que forem necessrias
(ex.: solvente, indicador).
Separadamente, coloca-se a soluo, que ser usada como titulante, em uma bureta. Acertase o zero. Em seguida, coloca-se o erlenmeyer sob a bureta e deixa-se o titulante escoar, gota a gota.
Controla-se a torneira da bureta com a mo esquerda ou direita.
Uma pessoa destra usar sua mo esquerda na torneira fazendo uma leve presso nesta para a
esquerda, de modo a prevenir vazamentos, e com a mo direita agitar continuamente o erlenmeyer.
Um indivduo canhoto dever proceder de modo inverso. Quando possvel, aconselhvel o uso
de agitador com barra magntica, para uma melhor agitao do meio reagente.
Observa-se atentamente a soluo do erlenmeyer. Cada gota do titulante, caindo na soluo,
provoca uma alterao visual (geralmente mudana de cor) que desaparece com a agitao.
medida que se aproxima o ponto final da titulao, a alterao demora mais tempo para desaparecer.
Diminui-se a velocidade de adio do titulante, de modo que a gota se misture completamente com
a soluo, antes que caia a gota seguinte.

Biotecnologia

SUMRIO

56

Alm destes detalhes tcnicos, quando o ponto final de uma titulao est prximo,
frequentemente necessrio adicionar mistura reagente uma frao de gota do titulante. Para
fazer isto, deixa-se formar parcialmente uma gota e toca-se a extremidade da bureta com a parede
interna do erlenmeyer. Lavam-se as paredes do frasco com uma pequena poro de gua de um
frasco lavador e agita-se a mistura.
No se deve arrastar com gua a frao da gota retida na extremidade da bureta.
Quando ocorrer uma alterao permanente na soluo, interrompe-se a adio de titulante e
l-se o volume de lquido na bureta.
Referncias:
CHRISPINO, lvaro. Manual de Qumica Experimental. So Paulo: Editora tica.2 edio, 1994. 230 p.
CIENFUEGOS, Freddy. Segurana no laboratrio. Rio de Janeiro: Intercincia, 2001. 269 p.
LENZI, Ervim et al. Qumica Geral Experimental. Rio de Janeiro: Freitas Bastos, 2009. 390 p.
PAVIA, Donald L et al. Qumica Orgnica experimental: Tcnicas de escala pequena. Porto Alegre: Bookman, 2009.
880 p.
POSTMA, James M.; ROBERTS, Julian L.; HOLLENBERG, Leland. Qumica no Laboratrio. Barueri, SP: Manole, 5
edio, 2009. 546 p.
ROSA, Gilberto; GAUTO, Marcelo; GONALVES, Fbio. Qumica Analtica: Prticas de Laboratrio. Porto Alegre:
Bookman, 2013. 128 p.

Biotecnologia

SUMRIO

57

CAPTULO 2
EXTRAO E QUANTIFICAO DE CIDOS
NUCLEICOS E PROTENAS
Adriane Pozzobon, Andressa Dametto, ngela Maria Schorr-Lenz, Camille Eichelberger Granada,
Cludia Stein, Edina Aparecida dos Reis Blasi, Fernanda Oliveira Diefenthaler, Giseli Buffon,
Guilherme Pinto Bertuzzi, Ivan Cunha Bustamante Filho, Jorge Almeida Guimares,
Jlia Pasqualini Genro, Luana Maria Wollinger, Luclia Santi, Marcia Ines Goettert,
Markus Berger Oliveira, Pmela Maria Seibel, Raul Antonio Sperotto, Ronize Zeni da Silva,
Thais Fernanda Dornelles, Vernica Contini, Vinicius de Abreu Waldow,
Walter Orlando Beys da Silva

Biotecnologia

SUMRIO

58

2.1 EXTRAO DE DNA HUMANO A PARTIR DE SANGUE PERIFRICO


MTODO DE SALTING-OUT
A extrao do DNA nuclear o primeiro passo para a realizao de anlises genticas em
humanos, com aplicaes tanto em pesquisas quanto em situaes prticas do dia-a-dia. Constitui
o passo essencial para anlises de sequenciamento, anlises forenses, diagnstico molecular
de doenas, entre outras aplicaes. Embora o DNA humano possa ser extrado de qualquer
clula nucleada, existem fontes mais ou menos abundantes e que apresentam graus variados de
dificuldades tcnicas.
Uma das fontes mais comumente utilizadas para a extrao de DNA humano so os leuccitos
circulantes do sangue. Basicamente, esse processo de extrao consiste na lise das membranas das
clulas, com a liberao do DNA, e posterior separao do DNA dos componentes proteicos. O
mtodo de salting-out, descrito por Lahiri e Nurnberger (1991), promove a remoo das protenas
atravs de uma soluo saturada de cloreto de sdio. considerado um mtodo rpido, seguro e
econmico para a extrao de DNA a partir de sangue perifrico.
Protocolo adaptado de: Lahiri DK, Nurnberger JIJr (1991). A rapid non-enzymatic method
for the preparation of HMW DNA from blood for RFLP studies. Nucleic Acids Research, 19: 5444.
1. Coletar sangue perifrico (aproximadamente 4 mL) em um tubo contendo EDTA (100 L
EDTA 15%).
2. Transferir o sangue total para um tubo de centrfuga de 15 mL e, aps, adicionar igual
volume do reagente TKM1.
Dica: identificar a amostra no tubo e registrar a quantidade de sangue para colocar a mesma
quantidade do reagente.
3. Adicionar 250 L de Nonidet P-40 para causar a lise das clulas. Misturar vigorosamente e
passar no vrtex.
Dica: o Nonidet muito viscoso, portanto, interessante realizar a pipetagem lentamente
para que o reagente seja adicionado com facilidade e no ocorra desperdcio. A mistura deve ser
feita por agitao manual e dever ocorrer a formao de espuma.
4. Centrifugar por 10 minutos a 3.000 rpm, em temperatura ambiente ( 25C).
Importante: necessrio balancear as amostras na centrfuga.
5. Descartar o sobrenadante por inverso, com cuidado para no perder o pellet que se
encontra ao fundo do tubo.
Dica: utilize um bquer grande, contendo hipoclorito de sdio, para fazer o descarte do
produto lquido. Aps descartar o sobrenadante, pode-se verter lentamente o tubo em papel
absorvente, visando retirar o restante do lquido.
6. Ressuspender o pellet em 5 mL de TKM1.
Dica: agitar vigorosamente, ou utilizar o vrtex, visando a maior dissoluo possvel do
material.
7. Centrifugar por 10 minutos a 3.000 rpm.
* Repetir os passos 5, 6 e 7, para que o pellet fique o mais limpo possvel.
Dica: antes da ltima centrifugao, pode-se ligar o banho-maria para incubao a 55 C.
8. Retirar o sobrenadante por inverso. Ressuspender o pellet em 800 L de TKM2 e transferir
para um microtubo de 1,5 mL ou 2 mL.

Biotecnologia

SUMRIO

59

Dica: dissolver o pellet o mximo possvel, quando ele j estiver no microtubo. Pode-se
utilizar o vrtex.
9. Adicionar 50 L de SDS 10% e agitar.
Dica: pode-se misturar a suspenso com o auxlio de uma pipeta ou agitar manualmente.
10. Incubar por 10 a 20 minutos, a 55C.
Dica: o objetivo da incubao homogeneizar o material, mas possvel que algumas
amostras no dissolvam totalmente ao fim dos 20 minutos.
11. Adicionar 300 L de NaCl 6 M no tubo e agitar.
12. Centrifugar a 12.000 rpm, durante 5 minutos.
Dica: durante esta centrifugao, pode-se preparar os microtubos contendo 1 mL de etanol
70% gelado Passo 15.
13. Coletar o sobrenadante em um novo tubo de 15 mL, previamente identificado, com o
auxlio de uma micropipeta.
Dica: o DNA est contido no sobrenadante, portanto NO coletar o pellet (composto por
resduos de protenas).
14. Adicionar ao sobrenadante dois volumes de etanol 100% gelado. Inverter o tubo
lentamente para a precipitao do DNA.
Dica: a inverso do tubo deve ser suave, e o DNA aparecer na forma de uma nuvem branca
suspensa no lquido.
15. Com o auxilio de uma micropipeta, ou de uma pipeta de vidro descartvel, coletar o
DNA e transferi-lo para um microtubo de 1,5 mL, contendo 1 mL de etanol 70%.
16. Centrifugar a 12.000 rpm por 5 minutos.
17. Com o auxilio de uma micropipeta, remover o sobrenadante. O DNA compe o pellet no
fundo do tubo.
Dica: o pellet poder ter diferentes tamanhos e colorao esbranquiada ou transparente.
18. Deixar os tubos abertos por cerca de 30 minutos para que evapore o restante do etanol.
19. Adicionar em torno de 350 L de TE, e inverter suavemente. Levar geladeira.
20. Armazenar o DNA em temperatura ambiente, ou em 4 C por um dia e, aps, armazenar
a -20 C.

Biotecnologia

SUMRIO

60

Materiais Utilizados:
- Tubos 15 mL. O dobro de tubos da quantidade de amostras.
- Microtubos 2,0 mL. O dobro de microtubos da quantidade de amostras.
- Etanol/lcool 100 % a temperatura ambiente ou gelado.
- Etanol/lcool 70 % gelado.
Reagentes:
Soluo TKM 1 (1000 mL)
- Tris 10 mM = 1,211 g
- KCl 10 mM = 0,745 g
- MgCl2 10 mM = 2,033 g
- EDTA 2 mM = 0,744 g
- Acertar pH em 7,6.
- Armazenar a 4 C.
Soluo TKM 2 (100 mL)
- 100 mL de TKM 1
- NaCl 0,4 mM = 2,337 g
- Armazenar a 4 C.
SDS 10 % (10 mL)
- 1,0 g de SDS
- 10 mL de gua Milli-Q
- Armazenar em temperatura ambiente.
NaCl 6M (100 mL)
- 32,66 g de NaCl
- 100 mL de gua Milli-Q
- Aquecer para dissolver. Armazenar em temperatura ambiente.
Soluo TE (50 mL)
- Tris 10 mM = 0,6 g
- EDTA 1 mM = 0,0186 g
- Acertar pH em 8,0. Armazenar a 4 C.

Biotecnologia

SUMRIO

61

2.2 EXTRAO DE DNA DE AMOSTRAS VEGETAIS


O processo de extrao de DNA vegetal consta inicialmente, do rompimento da parede e
membrana celular, liberando a molcula de DNA. O isolamento de DNA de plantas e de material
vegetal proveniente de cultura de tecidos uma etapa importante na anlise da estrutura e
organizao do genoma de plantas.
Mtodo de Doyle e Doyle (1987)
1. Utilizar cerca de 150 mg de lminas de folhas frescas ou 50 mg de folhas liofilizadas ou
secas. Pulverizar as amostras em nitrognio lquido. O material pode ser triturado em cadinho e
transferido para o tubo, ou diretamente no tubo, usando um micropistilo.
Dica: uma possibilidade utilizar discos foliares cortados com a tampa dos tubos eppendorf
de 1,5 ml.
2. Transferir o material para um tubo eppendorf de 2 mL, e adicionar 650 L do tampo de
extrao:
para 10 mL
2 % CTAB

0,2 g

1,4 M NaCl

2,8 mL do estoque (5 M NaCl)

100 mM Tris-HCl (pH 8,0)

1 mL do estoque (1 M Tris Cl pH 8,0)

20 mM EDTA (pH 8,0)

400 uL do estoque (0,5 M EDTA, pH 8,0)

1 % polivinilpirrolidona

0,1 g do produto

3. Adicionar a uma alquota do tampo a ser usado, pouco antes do uso:


0,2 % b-mercaptoetanol
50 mg.mL-l de proteinase K
4. Misturar os tubos em vrtex, e coloc-los em banho-maria a 55oC por uma hora.
5. Adicionar 650 L de clorofrmio:lcool isoamlico (24:1) e misturar at formar uma
emulso.
6. Centrifugar a soluo por 5 minutos a 12.000 rpm.
7. Coletar a fase aquosa superior e transferir para um novo tubo, com cuidado para no
pipetar a interface. Caso o volume da fase superior no for superior fase intermediria com
fragmentos de tecido, adicionar mais tampo, misturar vigorosamente e centrifugar novamente.
8. Adicionar 200 L do tampo de extrao sem proteinase K e b-mercaptoetanol, e adicionar
650 L de clorofrmio:lcool isoamlico (24:1), misturando at formar uma emulso.
9. Centrifugar a soluo por 5 minutos a 12.000 rpm.
10. Coletar a fase aquosa superior e transferir para um novo tubo, com cuidado para no
pipetar a interface.
11. Repetir esses trs passos anteriores mais uma vez.
12. Coletar a fase aquosa superior e transferir para um novo tubo, e adicionar um volume
igual de isopropanol.
13. Centrifugar por 5 minutos a 12.000 rpm.
14. Lavar o pellet com 1 mL de etanol 70% por duas vezes para remover sais e secar ao ar ou
sob vcuo num dessecador.

Biotecnologia

SUMRIO

62

15. Ressuspender o DNA em 20 L de tampo TE contendo ribonuclease [RNAse] (10 g.L-l).


Em geral prepara-se um estoque dissolvendo 100 mg de RNAse em 10 mM de Tris-HCl (pH 7,5) e 15
mM NaCl; aquecer em gua fervente por 15 minutos e resfriar lentamente temperatura ambiente.
Mtodo de Dellaporta et al. (1983)
1.

Ligar o Vapor trap e o banho a 65 C.

2.

Homogeneizar material em nitrognio lquido.

3.

Adicionar 500 l EB (manter no gelo).


Dica: Realizar at o passo 8 na capela de exausto.

4.

Adicionar 35 L de SDS 20%, agitar no vrtex, e manter a 65 C por 10 minutos.

5.

Adicionar 130 L de Acetato de Sdio 5 M, e manter no gelo por 5 minutos.

6.

Agitar no vrtex, e centrifugar a 13.000 rpm por 5 minutos.

7.

Transferir sobrenadante para novo tubo.

8.

Adicionar 60 L de Acetato de Sdio 5 M e 640 L de Isopropanol Absoluto.

9.

Agitar no vrtex, e centrifugar a 13.000 rpm por 10 minutos.

10.

Descartar sobrenadante.

11.

Ressuspender o pellet em 200 L de BTE.

12.

Agitar no vrtex e centrifugar a 13.000 rpm por 5 minutos.

13.

Transferir sobrenadante e adicionar 20 L Acetato de Sdio 5 M e 450 L Etanol Absoluto.

14.

Agitar no vrtex e centrifugar a 13.000 rpm por 10 minutos.

15.

Descartar sobrenadante.

16.

Lavar o pellet com etanol 70%.

17.

Secar no Speed Vac por 5 minutos.

18.

Dissolver pellet em 50 L de gua Milli-Q (soluo estoque)

19.

Diluir 1 L da soluo estoque em 49 L de gua Milli-Q

20.

Usar 1 L para PCR.


EB (Extraction Buffer)

1,0 mL

Tris HCl 0,5 M (pH 8,0)

100 mM

1,0 mL

EDTA 0,25 M (pH 8,0)

50 mM

2,5 mL

NaCl 2 M

500 mM

7,2 L

-mercaptoetanol

10 mM

5,5 mL

H2O

q.s.p.

BTE
0,50 mL

Tris HCl 0,5 M (pH 8,0)

50 mM

0,02 mL

EDTA 0,25 M (pH 8,0)

1 mM

9,50 mL

H2O

q.s.p.

Biotecnologia

SUMRIO

63

Referncias:
DELLAPORTA, S. L.; WOOD, J.; HICKS, J.B. A plant DNA minipreparation: version II. Plant Molecular Biology
Reporter 1: 19-21, 1983.
DOYLE, J.J.; DOYLE, J.L. A rapid DNA isolation procedure for small quantities of fresh leaf tissue. Phytochemical
Bulletin 19: 11-15, 1987
DOYLE, J.J.; DOYLE, J.L. Isolation of plant DNA from fresh tissue. Focus 12: 13-15, 1990.

Biotecnologia

SUMRIO

64

2.3 EXTRAO DE DNA DE BACTRIAS ENDOFTICAS DE RAIZ


Bactrias promotoras de crescimento vegetal podem ser encontradas dentro das razes de
plantas. Estas podem ocupar o espao intracelular (em estruturas especializadas denominadas
ndulos) ou extracelular (no espao entre duas clulas vizinhas). O processo de extrao de DNA
inicia com a separao das clulas destes micro-organismos das clulas da planta, rompimento da
sua parede celular liberando o DNA e sucessivas etapas de limpeza e purificao.
1. Separar a raiz do solo rizosfrico.
2. Desinfestar as razes obtidas por imerso em lcool 70 % e soluo de hipoclorito (2 %) por
2 minutos cada. Aps este procedimento, lavar as razes com gua destilada e esterilizada (cinco
vezes).
3. O tecido vegetal desinfestado obtido deve ser cortado em pequenos pedaos.
4. Adicionar 10 gramas do tecido a 90 mL de soluo salina estril (NaCl 0,85 %) e manter sob
agitao por 12 horas a 28C.
5. Filtrar o sobrenadante com filtro de porcelana G1 estril, diretamente para um tubo Falcon
estril de 50 mL.
6. Centrifugar a 5.000 rpm por 25 minutos. Descartar o sobrenadante.
7. Repetir os passos 5 e 6 at que toda a soluo do tecido vegetal seja filtrada.
8. Ressuspender o pellet em 1970 L de soluo TE1 e adicionar 50 L de Lisozima (100 mg.
mL-1). Manter a 37 C por 1 hora.
Dica: para aumentar a eficincia da lisozima, a soluo pode ser levemente agitada a cada 15
minutos.
Dica: recomendado colocar em banho a 37 C.
Soluo

Componentes

Quantidade

Objetivo

TE 1

Tris 1 M (pH 8)

1 mL (CFinal 10 mM)

EDTA 0,5 M (pH 8)

5 mL (CFinal 25 mM)

Soluo tampo
Inibir a atividade
das nucleases

gua destilada estril

Completar para 100 mL

Esta soluo deve ser armazenada na geladeira. CFinal = concentrao final.


9. Adicionar 400 L da Soluo de Lise, agitar fortemente e manter a 60 C por 30 minutos,
agitando o tubo eventualmente.
Soluo
Soluo de Lise

Componentes

Quantidade

EDTA 0,5M pH8

20 mL (CFinal 100mM)

SDS

25 gramas

Tris-HCl 1M pH8

5 mL (CFinal 50mM)

gua destilada estril

Completar para 100 mL

Objetivo
Auxlio na lise da
parede celular

CFinal = concentrao final.


10. Retirar do banho e manter por 10 minutos a temperatura ambiente.
11. Adicionar 480 L de Acetato de Amnio (CH3COONH4) 8M e manter no gelo por 1 hora.
12. Centrifugar a 5.000 rpm por 30 minutos.
13. Coletar o sobrenadante e transferi-lo para outro tubo.

Biotecnologia

SUMRIO

65

Dica: At este momento teremos aproximadamente 3 mL de soluo para transferir para


outro tubo. Para facilitar o manuseio dos tubos costuma-se dividir em 3 alquotas de 1 mL e, a
partir deste momento, trabalhar com microtubos de 2 mL.
14. Adicionar 1 volume de fenol-clorofrmio, agitar vigorosamente com a mo, e centrifugar
a 10.000 rpm por 5 minutos e coletar a fase aquosa (parte superior).
15. Repetir a etapa 13 usando clorofrmio apenas.
16. Em um novo tubo, adicionar fase aquosa 5 L de soluo de NaCl 5M e 0,6 volumes de
Isopropanol gelado. Manter a mistura over night no freezer.
17. Centrifugar a 12.000 rpm por 20 minutos.
18. Adicionar ao pellet 500 L de Etanol 70 % e centrifugar a 12.000 rpm por 10 minutos.
Dica: Nem sempre o pellet estar visvel, por isso deve-se cuidar para no perd-lo durante
as lavagens.
19. Descartar o Etanol 70 % e secar o pellet por 1 hora a 35 C.
20. Ressuspender o pellet em 30 L de TE2.
Soluo

Componentes

Quantidade

Objetivo

TE 2

Tris 1 M (pH 8)

1 mL (CFinal 10 mM)

EDTA 0,5 M (pH 8)

200 L (CFinal 1 mM)

Manter o DNA extrado em ambiente


adequado

gua destilada estril

Completar para 100 mL

Armazenamento na geladeira. CFinal = concentrao final.


21. Para verificar a eficincia a extrao do DNA, checar 2 L da soluo em gel de agarose
0,8 %.

Biotecnologia

SUMRIO

66

2.4 EXTRAO DE DNA BACTERIANO DE SOLO


O solo intensamente habitado por micro-organismos promotores de crescimento de plantas.
Esta extrao de DNA consiste na separao das clulas procariticas dos agregados de solo, lise
celular e sucessivas lavagens com o objetivo de remover o material orgnico contido no solo e que
inibe muitas reaes de biologia molecular.
1. Separar o solo das razes da planta.
2. Pesar 10 gramas de solo e adicionar este a 50 mL de soluo de Crombach. Deixar agitando
por 10-12 horas.
Soluo

Composio

Quantidade

Objetivo

Crombach

EDTA 0,5 M pH8

2 mL (CFinal = 1 mM)

Tris-HCl

4g (CFinal = 25 mM)

Estabilizar a
soluo

gua destilada

Completar o volume para 1 L

CFinal = Concentrao final


3. Centrifugar o sobrenadante em tubos Falcon (15 mL) a 10.000 rpm por 10 minutos. Repetir
o procedimento at obter um pellet de aproximadamente 3 gramas.
4. Ressuspender o pellet obtido em 8 mL de soluo de Crombach e adicionar 0,1 grama de
Lisozima.
5. Incubar a 37 C por 3 horas.
Dica: para aumentar a eficincia da lisozima, a soluo pode ser levemente agitada a cada
15-30 minutos.
6. Adicionar 750 L de soluo de SDS 10 % e incubar a 65 C por 30-45 minutos.
Dica: a soluo de SDS deve ser mantida em um frasco mbar, protegido da luz.
7. Adicionar 1650 L de acetato de potssio 8M (CH3COOK) e incubar a temperatura
ambiente por 10 minutos.
8. Centrifugar a 10.000 rpm por 20 minutos e coletar o sobrenadante.
9. Adicionar 4950 L de soluo de PEG 50 % NaCl 1 M e incubar no gelo por 1 hora.
Soluo

Composio

Quantidade

Concentrao
final

PEG 50% NaCl 1 M

PEG 6000

250 g (CFinal = 50 %)

50 %

NaCl

29,22 g (CFinal = 1 M)

1M

gua destilada

Completar para 500 mL

---

CFinal = concentrao final


10. Centrifugar a 10.000 rpm por 20 minutos. Descartar o sobrenadante.
11. Ressuspender o pellet em 750 L de TE2 e transferir a soluo para um microtubo de
1,5 mL (a composio da soluo TE2 est descrita no protocolo de extrao de DNA de bactrias
endofticas da raiz).
12. Adicionar 1 volume de fenol:clorofrmio e agitar vigorosamente.
13. Centrifugar a 5.000 rpm por 5 minutos, retirar a fase aquosa (parte superior) e transferir
para um novo microtubo estril.
14. Repetir os passos 12 e 13 duas vezes usando apenas clorofrmio.
15. Precipitar o DNA com 0,6 volumes de isopropanol gelado e manter no freezer over night.

Biotecnologia

SUMRIO

67

16. Centrifugar a 12.000 rpm por 20 minutos e descartar o sobrenadante.


17. Lavar o pellet com 500 L de etanol 70 %, centrifugar a 12.000 rpm por 5 minutos.
18. Descartar o eanol 70 % e secar o pellet por 1 hora a 35 C.
19. Ressuspender o pellet em 30 L de TE2.
20. Para verificar a eficincia da extrao do DNA, 2 L da soluo devem ser checados em
gel de agarose 0,8 %.
21. Aps verificar se a extrao foi eficiente, purificar o DNA obtido em coluna especfica
para DNA de solo.
Dica: a purificao do DNA ao final do procedimento uma etapa essencial. O solo carrega
consigo uma quantidade muito grande de compostos orgnicos que no conseguimos remover
totalmente pela extrao convencional. Estes compostos inibem a maioria dos procedimentos de
biologia molecular.

Biotecnologia

SUMRIO

68

2.5 EXTRAO DE DNA DE UM ISOLADO BACTERIANO


Para confirmao do gnero e da espcie bacteriana, necessrio o uso de tcnicas de biologia
molecular como caracterizao do gene 16S rDNA. Para isso, devemos ter um DNA de excelente
qualidade. A extrao de DNA descrita a seguir inicia pela multiplicao do isolado bacteriano,
seguida pela lise da parede celular e membrana plasmtica e sucessivas lavagens para remoo de
excessos de meio de cultura e demais componentes celulares.
1. Multiplicar o isolado bacteriano em um meio rico, que propicie seu pleno desenvolvimento.
2. Aliquotar 1,5 mL da cultura bacteriana crescida em microtubos de 1,5 ou 2 mL. Centrifugar
por 3 minutos a 12.000 rpm.
3. Descartar o sobrenadante e adicionar 700 L de TES. Homogeneizar e centrifugar por 3
minutos a 12.000 rpm.
Soluo

Composio

Quantidade

Objetivo

TES

Tris 1 M (pH 8)

1 mL (CFinal 10 mM)

Soluo de limpeza

EDTA 0,5 M (pH 8)

5 mL (CFinal 25 mM)

NaCl 5 M

3 mL (CFinal 150mM)

gua destilada estril

Complete para 100 mL

Armazenamento: geladeira.
4. Descartar o sobrenadante e ressuspender o pellet em 500 L de TE1 (a composio da
soluo TE1 est descrita no protocolo de extrao de DNA de bactrias endofticas).
5. Adicionar 25 L de Lisozima (20 mg/mL) e incubar a 37C por 30 minutos.
Dica: o uso de uma Lisozima de boa qualidade de fundamental importncia.
6. Adicionar 108 L de SDS 20 % e 6 L de Proteinase K (20 mg/mL) e incubar a 58 C por 15
minutos. Esfriar a temperatura ambiente.
Soluo

Proteinase K

Composio

Quantidade

Objetivo

Proteinase K

100 mg (CFinal = 20mg/mL)

Glicerol

2,5 mL

Degradao
proteica

CaCl2 0,5 M

200 L

Tris 50 mM (pH 8)

1 mL

gua ultrapura estril

1,3 mL

Armazenamento no freezer. CFinal = concentrao final.


Dica: a soluo de SDS deve ser mantida em um frasco mbar, protegido da luz.
7. Adicionar 200 L de Acetato de Amnio (CH3COONH4) 8 M, agitar com cuidado e deixar
no gelo (ou freezer) por 30 minutos.
Dica: esta soluo deve ficar no gelo por no mnimo 30 minutos, mas pode ficar por tempo
indeterminado sem prejudicar a amostra.
8. Retirar do gelo (ou freezer) e centrifugar por 20 minutos a 12.000 rpm.
9. Coletar todo o sobrenadante e transferir para um novo microtubo de 1,5 mL estril.
Dica: se voc no conseguir retirar o volume de 500 L, completar com TE1.
10. Adicionar 1 volume de fenol:clorofrmio e agitar vigorosamente.

Biotecnologia

SUMRIO

69

11. Centrifugar por 5 minutos a 5.000 rpm, coletar a fase aquosa (parte superior) e transferi-la
para um novo microtubo.
Dica: se esta soluo no tiver volume de no mnimo 500 L, completar com TE2.
12. Repetir os passos 10 e 11 usando somente clorofrmio.
13. Repetir os passos 10 e 11 usando somente clorofrmio:lcool isoamlico (24:1).
14. Adicionar 8 L de uma soluo de NaCl 5 M e 0,6 volumes de isopropanol gelado.
Misturar com cuidado e manter por 20 minutos no gelo.
Dica: nesta fase a soluo deve ter 500 L. Se no tiver, completar o volume com TE2.
Dica: esta soluo deve ficar no gelo por no mnimo 20 minutos, mas pode ficar por tempo
indeterminado sem prejudicar a amostra.
15. Centrifugar por 20 minutos a 12.000 rpm.
16. Descartar o sobrenadante, lavar o pellet com 500 L de etanol 70 % e centrifugar por 5
minutos a 12.000 rpm.
17. Retirar o etanol 70 % e deixar o pellet secar a 35 C por 1 hora.
18. Ressuspender o pellet em 30 L de TE2 (a composio da soluo TE2 est descrita no
protocolo de extrao de DNA de bactrias endofticas).
19. Checar 2 L da soluo em gel de agarose 0,8 %.

Biotecnologia

SUMRIO

70

2.6 EXTRAO DE DNA BACTERIANO DIRETAMENTE DE AMOSTRAS


DE LEITE
O leite um alimento com alto valor nutricional, sendo assim um substrato adequado
para o crescimento de diversos micro-organismos, em especial patgenos associados s infeces
alimentares. Os mtodos bioqumicos para anlise da presena de patgenos levam dias para
ficar prontos, enquanto que as tcnicas moleculares, cada vez mais utilizadas, podem ser teis na
deteco de patgenos. O protocolo a seguir til para o isolamento do DNA de bactrias gramnegativas, tais como Listeria monocytogenes (Agostini et al., 2012), Streptococcus agalactiae e Escherichia
coli, diretamente do leite, sem ser necessrio o seu isolamento em meio de cultura.
Protocolo de extrao baseado em De Gracia (1997)
1. Em um microtubo de 1,5 mL, adicionar 200 L da amostra de leite.
2. Acrescentar 20 L de Tween 20.
3. Homogeneizar por 10 segundos em agitador orbital (vrtex).
4. Centrifugar a 12.000 g por 10 minutos a 20 C.
5. Descartar o sobrenadante por inverso.
6. Suspender o sedimento em 300 L de tampo de Lise [60 L de tampo de extrao (100
mM Tris-HCl pH 8,0; 100 mM EDTA; 250 mM NaCl), 30 L de SDS 10 %, 15 L de pK 20 mg/mL,
195 L de gua Milli-Q autoclavada].
7. Incubar a 37 C por uma hora homogeneizando a cada 15 minutos.
8. Adicionar 250 L de fenol tamponado.
9. Centrifugar a 12.000 g por 5 minutos.
10. Transferir 200 L de sobrenadante a um novo microtubo de 1,5 mL.
11. Adicionar 100 L de fenol-clorofrmio-lcool-isoamlico (25:24:1).
12. Centrifugar a 12.000 g por 5 minutos.
13. Transferir 150 L do sobrenadante a um novo microtubo.
14. Adicionar 26,5 L de acetato de sdio (2M).
15. Adicionar 400 L de etanol absoluto.
16. Precipitar por 18 horas a -20C.
17. Centrifugar a 12.000 g por 20 minutos.
18. Descartar o sobrenadante por inverso.
19. Secar o sedimento.
Dica: pode-se usar um cotonete, tendo o cuidado para no tocar no pellet. Secar bem o tubo,
pois o lcool interfere na qualidade do DNA.
20. Dissolver o pellet com 30 l de TE (10 mM Tris-HCl, 1 mM EDTA, pH 8,0).
21. Incubar a 56 C por 15 minutos.
22. Estocar a -20 C at o momento da amplificao.

Biotecnologia

SUMRIO

71

Referncias:
DE GRACIA, A. S. Deteco de DNA de Brucella abortus em amostras de leite bovino experimentalmente
contaminado atravs da reao em cadeia pela polimerase (PCR). 1997. 37 f. Dissertao (Mestrado em
Epidemiologia Experimental Aplicadaa Zoonoses) Faculdade de Medicina veterinria e zootecnia da Universidade
de So Paulo, So Paulo, 1997.
AGOSTINI, C. KRELING C.S, BUSTAMANTE-FILHO, I.C, SOUZA C.F. V, BIOLCHI, V, POZZOBON A. (2012).
Deteco de Listeria monocytogenes pela tcnica da reao em cadeia da polimerase (PCR) em amostras de leite
bovino in natura. Rev. Inst. Latic. Cndido Tostes, Nov/Dez, n 389, 67: 15-20.

Biotecnologia

SUMRIO

72

2.7 EXTRAO DE PLASMDEO (MINIPREP)


Plasmdeos so molculas de DNA circular extracromossomais, em dupla hlice, que podem
ser transferidos de clula para clula. Estas molculas no carregam informao gentica essencial
para o desenvolvimento bacteriano em condies adequadas, porm, carregam genes acessrios
que podem conferir resistncia a ambientes inspitos, torn-las mais competitivas, virulentas, etc.
1. Multiplicar o isolado bacteriano em um meio rico, que propicie seu pleno desenvolvimento.
2. Aliquotar 1,5 mL da cultura bacteriana multiplicada em microtubos de 1,5 ou 2 mL e
centrifugar por 6 minutos a 12.000 rpm.
3. Descartar o sobrenadante e ressuspender o pellet em 200 L da soluo I.
Soluo
Soluo I

Componentes

Quantidade

Objetivo

Tris 1 M (pH 8)

2 mL

EDTA 0,5 M (pH 8)

2 mL

Homogeneizao das
clulas

Glicose 1 M

2,5 mL

Autoclavar a soluo. Armazenar na geladeira.


4. Adicionar 5 L de RNAse e manter por 5 minutos a temperatura ambiente.
5. Adicionar 200 L da soluo II, agitar com a mo e manter no gelo por 5 minutos.
Soluo

Componentes

Quantidade

Objetivo

Soluo II

NaOH 1 M

20 mL

SDS 20%

5 mL

gua destilada estril

Completar para 100 mL

Lise celular e
abertura de poros na
membrana

No autoclavar a soluo. Manter a temperatura ambiente.


rpm.

6. Adicionar 200 L da soluo III, agitar com a mo e centrifugar por 10 minutos a 12.000
Soluo

Componentes

Quantidade

Soluo III

Acetato de Amnio 5 M
(pH 5,2)

60 mL

cido actico glacial

11,5 mL

gua destilada estril

Completar para 100 mL

Objetivo

Precipitao de
protenas e restos
celulares

No autoclavar esta soluo. Armazenar na geladeira. Colocar no gelo antes de usar.


7. Coletar sobrenadante para um novo microtubo e centrifugar por 10 minutos a 12.000 rpm.
8. Coletar sobrenadante, adicionar 1 volume de isopropanol gelado e manter no gelo por 20
minutos.
Dica: o tempo mnimo para precipitao do DNA plasmidial 20 minutos, porm, se voc
deixar mais tempo, poder aumentar a eficincia da precipitao.
9. Centrifugar por 20 minutos a 12.000 rpm.
10. Descartar o sobrenadante e adicionar ao pellet 500 L de etanol 70 %.
Dica: nesta fase nem sempre o pellet est visvel.
11. Centrifugar por 5 minutos a 12.000 rpm.
12. Retirar o mximo de lquido e secar a temperatura ambiente.

Biotecnologia

SUMRIO

73

13. Ressuspender o pellet em 50 L de soluo TE2 (a composio da soluo TE2 est descrita
no protocolo de extrao de DNA de bactrias endofticas de raiz).
14. Para verificar a eficincia da extrao, checar 2 L em gel de agarose 0,8 %.

Biotecnologia

SUMRIO

74

2.8 EXTRAO DE RNA UTILIZANDO TRIZOL


O mtodo de extrao de RNA total pelo reagente Trizol (Invitrogen) uma adaptao
do mtodo original descrito por Chomczynski e Sacchi (1987) que utiliza uma soluo de fenol e
isotiocianato de guanidina, geralmente empregando 1 mL de Trizol para 10 cm2 de tecido.
1. Adicionar 1 mL de Trizol em cada tubo eppendorf contendo os fragmentos do tecido.
2. Fragmentar o tecido no homogenizador at completa dissoluo do mesmo.
3. Manter 5 minutos em temperatura ambiente.
4. Adicional 0,2 mL de Clorofrmio.
5. Agitar por 15 segundos no vrtex.
6. Manter 3 minutos em temperatura ambiente.
7. Centrifugar 12.000 g por 15 minutos a 4 C.
Dica: cuidado ao retirar os tubos da centrfuga, pois as fases separadas podem ser misturadas.
8. Pipetar a fase aquosa para um tubo limpo identificado.
Dica: aspirar lentamente a fase do sobrenadante que contm o clorofrmio e o RNA para no
furar a interface que contm restos de membranas celulares.
9. Adicionar 0,5 mL de Isopropanol (lcool isoproplico).
10. Estocar no freezer (-20 C) por 12 a 18 horas.
11. Centrifugar 12.000 g por 15 minutos a 4 C.
Desprezar sobrenadante (o RNA precipita formando um pellet, como um gel).
Dica: cuidado ao verter, pois o pellet pode ser descolado.
12. Adicionar Etanol 75% gelado (1 mL por tubo).
Dica: retirar o etanol da geladeira ou freezer somente na hora de pipetar para manter gelado.
13. Centrifugar 8.000 g por 10 minutos a 4 C.
14. Desprezar sobrenadante
15. Secar o pellet para remover todo o excesso do lcool.
Dica: pode ser utilizado um cotonete para secar o tubo, porm, tome cuidado para no
encostar no pellet. O excesso de lcool interfere na leitura, portanto, tente deixar o mais seco possvel.
pellet.

16. Ressuspender o pellet com gua Milli-Q com DEPC autoclavada conforme o tamanho do
Dica: para pellets menores usar entre 10 e 20 L. Para pellets maiores, entre 30 e 50 L.
17. Incubar em banho-maria por 10 minutos a 60 C
18. Manter 1 minuto no gelo e dar uma breve centrifugada (4.000 rpm).
19. Estocar a -20 ou -80 C ou proceder quantificao.

Referncia:
CHOMCZYNSKI, P; SACCHI, N. Single-step method of RNA isolation by acid guanidinium thiocyanate-phenolchloroform extraction. Analytical Biochemistry 162(1): 156-9. 1987.

Biotecnologia

SUMRIO

75

2.9 EXTRAO DE RNA DE AMOSTRAS VEGETAIS UTILIZANDO


CONCERT PLANT RNA REAGENT
Dentre alguns mtodos indicados para a extrao de RNA de tecidos vegetais ricos em
polissacardeos encontra-se o Concert Plant RNA Reagent (Invitrogen). indicado principalmente
para tecidos de difcil extrao, como razes e sementes, produzindo RNA de alta qualidade e
quantidade. No deve ser utilizado para espcies de plantas que possuem altos nveis de compostos
fenlicos e leos.
1.

Ligar a centrfuga a 4 C.

2.

Esfriar os tubos em nitrognio lquido antes de transferir as amostras.

3.

Homogeneizar material (no mximo 100 mg) em nitrognio lquido at virar um p.

4.

Adicionar 500 L do reagente Concert frio (4C) e agitar bem no vrtex at ressuspender toda a amostra.

5.

Deixar os tubos deitados por 5 minutos a temperatura ambiente. importante deixar os tubos deitados,
pois aumenta a superfcie de contato da amostra com o reagente.
Dica: realizar esse procedimento na capela de exausto.

6.

Centrifugar a 12.000 rpm por 5 minutos a 4 C.

7.

Transferir sobrenadante para novo tubo (cerca de 300 L).

8.

Adicionar 200 L NaCl 2,5 M ou 100 L NaCl 5 M.


Dica: agitar batendo na bancada algumas vezes.

9.

Adicionar 300 L Clorofrmio e misturar bem invertendo o tubo vrias vezes.

10.

Centrifugar a 12.000 rpm por 10 minutos a 4 C.

11.

Transferir sobrenadante para novo tubo


Dica: puxar lentamente para no perturbar a fase orgnica.

12.

Adicionar um volume igual de Isopropanol Absoluto e misturar invertendo o tubo vrias vezes.

13.

Deixar 10 minutos sob temperatura ambiente.

14.

Centrifugar a 12.000 rpm por 10 minutos a 4 C.

15.

Descartar sobrenadante, deixando somente o pellet.

16.

Adicionar 1 mL de etanol 75 %.

17.

Centrifugar a 12.000 rpm por 3 minutos.

18.

Descartar sobrenadante, deixando somente o pellet.

19.

Centrifugar brevemente e remover o lquido residual com a pipeta sem perturbar o pellet.

20.

Dissolver pellet em 10-50 L de gua Milli-Q.

21.

Se a soluo estiver turva, centrifugar a 12.000 rpm por 1 minuto e transferir sobrenadante para novo
tubo.

22.

Guardar no Ultra-freezer.

Biotecnologia

SUMRIO

76

2.10 EXTRAO DE PROTENAS TOTAIS DE AMOSTRAS DE TECIDO


DE MAMFEROS
A obteno de um extrato proteico de um tecido de mamfero (ex. miocrdio, mucosa
intestinal) consiste na macerao da amostra em soluo com de lise da membrana celular. Para
tanto, se utiliza um homogeneizador de tecido, seguido de centrifugaes para separar debris
celulares e protenas eludas na soluo. As amostras processadas podem ser quantificadas por
mtodos usuais e analisadas por SDS-PAGE.
Extrao de protenas:
1. Dissecar 1 cm de amostra e pesar cerca de 100 mg;
Dica: realizar todo o procedimento com as amostra em contato com gelo para evitar
degradao das protenas.
2. Fatiar a amostra em uma placa de petry utilizando tesoura de ponta fina ou lamina de
bisturi;
3. Acondicionar as amostras em microtubos e rotul-los devidamente;
4. Adicionar 500 L de Tampo de lise nos microtubos com as amostras;
50 ml
50 mM Tris

0,3025 g do produto

150 mM

0,4383 g do produto

1 mM EDTA

0,01861 g do produto

0,1% SDS

0,050 g do produto

1% Triton X-100

500 L do produto

Inibidor de protease a escolher


Dica: pesar os reagentes em p e aps ressuspender estes em 40 mL de H2O ultrapura,
adicionar os reagentes lquidos (Triton X-100 e inibidores de protease). Fazer no dia da extrao,
mantendo-o gelado.
5. Homogeneizar as amostras em homogeneizador, 5x de 1 minuto ou at a obteno de
extrato aquoso. Adicionar 650 l de clorofrmio: lcool isoamlico (24:1) e misturar at formar uma
emulso.
Dica: limpar o homogeneizador entre cada amostra, utilizar 2 falcons com 15 ml de gua
destilada e SDS a 10 % (intercalar gua, SDS, gua pelo menos 3 x e trocar as solues a cada nova
amostra).
6. Centrifugar a amostra a 12.000 rpm, por 1 hora a 4 C;
7. Transferir cuidadosamente o sobrenadante para novos microtubos, separar uma alquota
de 30 L para quantificao de protenas. Identificar e armazenar a -20C. Descartar o pellet.
Referncias:
FREDERICK M. Ausubel, et al. Current Protocols in Molecular Biology. John Wiley & Sons, 2003.

Biotecnologia

SUMRIO

77

2.11 EXTRAO DE PROTENAS TOTAIS DE AMOSTRAS VEGETAIS


Este kit comercial de extrao de protenas pode ser utilizado para extrair uma amostra
qualitativa das protenas totais presentes em qualquer amostra vegetal, proveniente de qualquer
espcie de planta.
Protocolo de extrao de protenas de plantas utilizando o kit Plant Total Protein Extraction
(SIGMA-ALDRICH)
Dica: Os reagentes devem ser preparados somente na hora do procedimento de extrao.
Preparando os reagentes:
Protein Extraction Reagent Type 4:
1. Adicionar 15 mL de gua ultrapura ao contedo do frasco (vem com o kit). O volume final
da soluo ser de 23 mL.
2. Inverter o frasco diversas vezes com cautela para homogeneizar (cuidado para no formar
muita espuma). A completa solubilizao pode exigir aquecimento de 20-25 C. No deixar a
temperatura ultrapassar 30 C, pois pode ser prejudicial s protenas.
3. Fazer alquotas da soluo homogeneizada com volume de 990 L e congelar a -20 C para
utilizao futura.
Soluo de metanol para extrao de protenas de seis amostras:
1. Identificar um frasco.
2. Colocar 41,58 mL de Metanol.
3. Adicionar 420 L de Protease Inhibitor Cocktail (vem com o kit).
4. Misturar e armazenar no freezer.
Protocolo Detalhado para 6 amostras:
1. Pulverizar o tecido foliar da planta em nitrognio lquido at formar um p bem fino.
Dica: o tecido deve ser mantido congelado durante todo o procedimento. O p das amostras
do tecido deve permanecer com colorao cinza-esverdeada. Se o p comear a ficar com colorao
verde escuro porque o tecido est sofrendo descongelamento.
2. Identificar tubos eppendorfs de 2 mL com o nome das amostras.
3. Transferir aproximadamente 250 mg da amostra congelada para os seus respectivos
eppendorfs, mantendo a amostra sempre congelada.
Dica: Colocar gelo em um bquer e colocar o eppendortf dentro para pesar a massa necessria
na balana semi-analtica. Aps, deixar as amostras pesadas no nitrognio lquido.
4. Adicionar 1,5 mL da Soluo de Metanol em cada amostra. Homogeneizar no vrtex
por 30 segundos. Armazenar no freezer por aproximadamente 5 minutos, colocando no vrtex
periodicamente.
Dica: a baixa temperatura essencial para manter as protenas precipitadas e para evitar a
solubilizao da Soluo de Metanol.
5. Retirar as amostras do freezer e centrifugar a 16.000 g por 5 minutos a 4 C.
6. Descartar o sobrenadante com auxlio de uma pipeta.
Dica: tome muito cuidado para no perturbar o pellet.

Biotecnologia

SUMRIO

78

7. Repetir os passos 4, 5 e 6 mais duas vezes.


Dica: Caso as amostras sejam de tecidos vegetais que apresentem alto teor de compostos
fenlicos e taninos, repetir os passos 4, 5 e 6 em torno de 4 a 5 vezes para uma melhor extrao
destes componentes com a Soluo de Metanol.
8. Inverter o eppendorf com a tampa aberta sobre um papel toalha para descartar qualquer
resduo de metanol.
Dica: O pellet no necessita estar totalmente seco. Porm, qualquer resduo visvel de soluo
de metanol deve ser evitado.
9. Adicionar 1,5 mL de acetona pr-refrigerada a -20 oC e agitar no vrtex por 30 segundos.
10. Armazenar no freezer por 5 minutos.
11. Centrifugar a 16000g durante 5 minutos a 4oC.
12. Descartar o sobrenadante invertendo o tubo.
Dica: Caso o pellet se mova, descartar o sobrenadante com uma pipeta, cuidando para no
perturbar o pellet.
13. Adicionar novamente 1,5 mL de acetona pr-refrigerada a -20oC e agitar no vrtex por 30
segundos.
14. Armazenar no freezer por 5 minutos.
15. Centrifugar a 16000 g durante 10 minutos a 4oC.
16. Descartar sobrenadante com uma pipeta, cuidando para no perturbar o pellet.
17. Deixar o pellet secar por 10 minutos, para tanto deixar o eppendorf virado de lado com a
tampa aberta sobre um papel toalha, a fim de remover qualquer acetona residual por evaporao.
18. Acrescentar 1 mL de Working Solution (WS) em cada amostra. 990 L Reagent Type 4
(alquotas feitas anteriormente) + 10 L Protease Inhibitor Cocktail
Dica: a Working Solution deve ser preparada somente na hora.
19. Agitar no vrtex por 15 minutos.
Dica: Depois de ter adicionado a WS nas amostras, as mesmas devem ser agitadas
continuamente. Cuidar para que a temperatura das amostras no passe dos 30oC para evitar
degradao proteica.
20. Centrifugar as amostras a 16000 g por 30 minutos para sedimentar os restos de tecido da
planta.
21. Coletar o sobrenadante (onde esto as protenas) e colocar em um novo eppendorf
devidamente identificado.

Biotecnologia

SUMRIO

79

2.12 QUANTIFICAO DE DNA UTILIZANDO O QUBIT


O fluormetro Quibit 2.0 (Invitrogen) altamente especfico e sensvel para quantificao
de DNA dupla fita, DNA simples fita, RNA e protenas. Ele utiliza corantes arcades (fluorescentes
especficos) para quantificar as molculas de interesse, sendo que a fluorescncia emitida apenas
quando esto ligados a molculas-alvo especficas, mesmo em baixas concentraes. Apresenta
como vantagem o uso de um volume pequeno da amostra (1-20 l) e boa sensibilidade, sendo capaz
de quantificar amostras entre 10 pg/L e 100 ng/L.
Protocolo baseado nas instrues do fabricante do Kit Qubit dsDNA HS (High Sensitivity)
(Invitrogen).
1. Preparar a soluo de trabalho (Working Solution) com o fluorforo na proporo de 1:200.
2. Para a quantificao usa-se uma curva padro com valor de 0 a 200, utilizando duas
solues padro, na quantidade de 10 L do padro e 190 L da soluo de trabalho.
3. Adicionar 10 mL de cada padro Qubit ao tubo apropriado e misturar em vrtex por 2-3
segundos, tomando cuidado para no criar bolhas.
Dica: deve-se pipetar com preciso, pois fundamental para garantir a exatido da anlise.
4. Pipetar nos tubos 199 L da soluo e 1 L do DNA extrado de cada amostra.
Dica: o DNA pode ser diludo 5, 10 ou 20 vezes, dependendo da amostra.
5. Ligar o aparelho. Na tela inicial do Qubit 2.0 Fluorometer, pressione DNA, e em
seguida, selecione dsDNA Alta Sensibilidade como o tipo de ensaio. A tela Padres exibida
automaticamente. Se voc j tiver realizado uma calibrao para o ensaio selecionado, o aparelho
ir pedir para escolher entre ler novos padres ou usar a calibragem anterior.
6. Na tela Padres, pressione Yes para executar uma nova calibrao ou pressione No para
utilizar a ltima calibrao.
7. Para uma nova calibrao, insira o tubo contendo padro 1 no aparelho, feche a tampa e
pressione Read. A leitura vai demorar cerca de 3 segundos.
8. Remova o padro 1.
9. Insira o tubo contendo Padro 2 , feche a tampa e pressione Read.
10. Remova o padro 2.
11. A tela Sample ser automaticamente exibida.
12. Insira um tubo de amostra no aparelho, feche a tampa e pressione Read.
13. Aps a concluso da medio, o resultado ser exibido na tela.
Importante: o valor obtido corresponde concentrao da amostra que foi diluda (em ng/
mL). Para calcular a concentrao da amostra original utilize o seguinte clculo:
Concentrao da amostra = valor QF x (200)
onde: Valor QF = o valor dado pelo aparelho
X = microlitros da amostra adicionada

Biotecnologia

SUMRIO

80

2.13 QUANTIFICAO DE RNA UTILIZANDO O QUBIT


A quantificao de RNA pode ser realizada utilizando-se o Qubit RNA Assay Kit e o
equipamento Qubit Fluorometer. utilizado um fluroforo que se liga especificamente s fitas de
RNA e um fluormetro que quantifica a intensidade de fluorescncia presente em cada amostra,
que diretamente proporcional concentrao de RNA da amostra.
1. Diluir as amostras de RNA 20 vezes: 1 L do RNA total + 19 L de gua Milli-Q.
2. Preparar a soluo de trabalho (Working Solution - WS) que ser utilizada na calibrao
e quantificao. Para cada amostra: 199 L tampo (vem com o kit) + 1 L fluorforo (vem com
o kit). O fluorforo congela na geladeira, portanto, deve ser retirado alguns minutos antes da
quantificao. No esquecer que o equipamento deve sempre ser calibrado antes de qualquer
quantificao. A calibrao realizada com os dois padres que vm junto com o kit (Standard 1
= 0 ng/L e Standard 2 = 10 ng/L). Logo, se voc tiver quatro amostras para quantificar, deve
preparar WS suficiente para seis amostras.
Dica: se voc tiver que quantificar vrias amostras, preparar WS para uma reao a mais,
para que no falte WS devido a erros de pipetagem ou de calibrao da micropipeta.
3. Preparao dos padres para a calibrao:
Standard 1: 190 L WS + 10L Standard 1
Standard 2: 190 L WS + 10L Standard 2
4. Preparao das amostras:
Cada amostra: 199 L WS + 1 L RNA (diludo 20X).
5. Agitar por 5 segundos no vrtex.
6. Ligar o fluormetro e selecionar RNA. Aps calibrar o equipamento, quantificar cada
uma das amostras de RNA.
Dica: caso alguma das amostras apresente uma concentrao de RNA muito alta ou muito
baixa (fora da curva padro), possvel variar o volume de RNA diludo que se usa na reao.
Por exemplo, ao invs de usar 1 L de RNA diludo 20X, pode ser utilizado 2, 5 ou 10 L. Basta
informar ao equipamento o volume de RNA utilizado na reao. Tome cuidado que ao utilizar
volumes maiores de RNA, o volume de WS ser menor, pois a reao sempre tem volume final de
200 L. Alternativamente, a soluo de RNA pode ser menos diluda (5 ou 10X), ou mesmo utilizar
RNA no diludo.

Biotecnologia

SUMRIO

81

2.14 QUANTIFICAO DE DNA E RNA UTILIZANDO


ESPECTROFOTOMETRIA DE DENSIDADE PTICA - L-QUANT
Aps a extrao do DNA importante que seja realizada a quantificao do material obtido,
pois isso ir possibilitar o aperfeioamento das demais anlises genticas que sero realizadas, por
exemplo, uma reao em cadeia da polimerase (PCR). Uma das tcnicas mais fceis e rpidas de
quantificao de cidos nucleicos atravs da espectrofotometria de densidade ptica, a qual se
baseia no fato de que cada substncia apresenta um comprimento de onda especfico com o qual
ocorre o mximo da absoro de luz. As molculas de cidos nucleicos - DNA e RNA - absorvem
luz no comprimento de onda de 260 nm e as protenas no comprimento de 280 nm.
O aparelho L-Quant permite estimar a concentrao de DNA e RNA, em ng/L, de forma
rpida e sem a necessidade de diluies do material. Alm disso, tambm possvel identificar a
pureza do DNA/RNA atravs da razo de absorbncias a 260/280 nm.
Protocolo adaptado de: Manual de Instrues do equipamento Quantificador L- Quant.
Loccus biotecnologia. Verso 1.0.0.
- Primeiramente prepare as amostras que pretende quantificar. Prepare tambm um
microtubo com a soluo que representar o BRANCO no momento da quantificao.
IMPORTANTE: Antes de ler qualquer absorbncia de amostras, o branco deve ser lido.
O branco se refere soluo na qual a amostra se encontra diluda antes da quantificao. Por
exemplo, no caso de uma amostra ser diluda em gua destilada, o branco dever ser apenas
gua destilada. Essa leitura deve ocorrer antes das leituras das amostras para que seu valor seja
diretamente descontado do valor total de leitura das absorbncias referentes.
- Selecionar o tipo de amostra: No Menu Principal, item 1 (Selecionar Tipo Amostra) para
selecionar o tipo de amostra da qual ser realizada a leitura. Selecione a opo conforme sua
amostra: DNA de fita dupla, DNA de fita simples, RNA ou protena.
PASSO 1 Leitura do BRANCO:
1. Abra as placas metlicas levantando a placa superior at o limite.
2. Com uma micropipeta, aplique 2 L da soluo referente ao BRANCO no centro.
3. Abaixe delicadamente a placa metlica superior at o limite.
Dica: evite a formao de bolhas ao aplicar a soluo. Em caso positivo, abra as placas
metlicas, limpe as plataformas superiores e inferiores com o papel absorvente*, reaplique o branco
e feche as placas novamente.
* Papel absorvente = usa-se guardanapos de leno cortado em pequenos quadradinhos de 1
cm. Utilize uma pina para pegar o quadradinho e realizar a limpeza do quantificador. NO utilizar
papel higinico ou papel toalha, pois estes podem riscar a base onde as amostras so aplicadas.
4. Selecione a opo BRANCO na seo Funo e pressione a tecla Enter. Imediatamente, a
leitura ser iniciada, e aparecer um aviso notificando sobre o sucesso da leitura.
5. Aps a leitura do BRANCO, levante a placa metlica superior e limpe (suavemente, sem
fazer fora) as plataformas superior e inferior de leitura.
PASSO 2 Leitura das AMOSTRAS:
1. Aplique 2 L da amostra no centro da plataforma de leitura, de modo a formar uma gota
exatamente no centro.

Biotecnologia

SUMRIO

82

2. Abaixe delicadamente a placa metlica superior. Verifique se houve formao de um canal


conectando as duas superfcies da plataforma de leitura com a amostra aplicada. Em caso negativo,
abra as placas metlicas, limpe as plataformas superiores e inferiores com o papel absorvente,
reaplique a amostra e feche as placas novamente.
Dica: evite formao de bolhas.
3. Selecione a opo Amostras para iniciar a leitura da Amostra.
4. Aps realizar a leitura, levante a placa metlica superior e limpe as plataformas de leitura
(superior e inferior). O resultado da quantificao da amostra estar descrito no canto inferior
direito em valor de ng/L.
Dica: h a opo de visualizar os resultados das leituras clicando no terceiro item descrito
como Dados_08, por exemplo.
5. Quando as leituras estiverem completas, selecione a opo Sair e Salvar. Assim, poder
voltar ao Menu Principal e imprimir os valores quantificados.
Ateno: se houver mais amostras para serem lidas com o mesmo BRANCO, repita os
procedimentos do PASSO 2. As informaes das leituras sero armazenadas conforme sua sequncia.
Ento, tenha o cuidado de organiz-las, de modo que lembre a sequncia. O equipamento permite
salvar at 10 arquivos diferentes (Dados 01 - Dados 10), e em cada um desses arquivos podem ser
registradas as leituras de at 30 amostras utilizando como referncia um mesmo BRANCO.

Biotecnologia

SUMRIO

83

2.15 QUANTIFICAO DE PROTENAS UTILIZANDO O QUBIT


A quantificao de protena pode ser realizada utilizando-se o Qubit Protein Assay Kit
e o equipamento Qubit Fluorometer. utilizado um fluroforo e um fluormetro que quantifica
a intensidade de fluorescncia presente em cada amostra, que diretamente proporcional
concentrao de protena da amostra.
1. Diluir as amostras de protena 20 vezes: 1 L de protena total + 19 L de gua Milli-Q.
2. Preparar a soluo de trabalho (Working Solution - WS) que ser utilizada na calibrao
e quantificao. Para cada amostra: 199 L tampo (vem com o kit) + 1 L fluorforo (vem com
o kit). O fluorforo congela na geladeira, portanto, deve ser retirado alguns minutos antes da
quantificao. No esquecer que o equipamento deve sempre ser calibrado antes de qualquer
quantificao. A calibrao realizada com os trs padres que vm junto com o kit (Standard 1 = 0
ng/L, Standard 2 = 200 ng/L e Standard 3 = 400 ng/L). Logo, se voc tiver quatro amostras para
quantificar, deve preparar WS suficiente para sete amostras.
Dica: se voc tiver que quantificar vrias amostras, preparar WS para uma reao a mais,
para que no falte WS devido a erros de pipetagem ou de calibrao da micropipeta.
3. Preparao dos padres para a calibrao:
Standard 1: 190 L WS + 10 L Standard 1
Standard 2: 190 L WS + 10 L Standard 2
Standard 3: 190 L WS + 10 L Standard 3
4. Preparao das amostras:
Cada amostra: 199 L WS + 1 L protena (diludo 20 X).
5. Agitar por 5 segundos no vrtex.
6. Ligar o fluormetro e selecionar protena. Aps calibrar o equipamento, quantificar cada
uma das amostras de protena.
Dica: caso alguma das amostras apresente uma concentrao de protena muito alta ou muito
baixa (fora da curva padro), possvel variar o volume de protena diludo que se usa na reao.
Por exemplo, ao invs de usar 1 L de protena diludo 20 X, pode ser utilizado 2, 5 ou 10 L.
Basta informar ao equipamento o volume de protena utilizado na reao. Tome cuidado ao utilizar
volumes maiores de protena, pois o volume de WS ser menor, uma vez que a reao sempre tem
volume final de 200 L. Alternativamente, a soluo de protena pode ser menos diluda (5 ou 10
X), ou mesmo utilizar a soluo de protena no diluda.

Biotecnologia

SUMRIO

84

2.16 QUANTIFICAO DE PROTENAS PELO MTODO DE BRADFORD


O mtodo baseia-se na adio de etanol, cido fosfrico e um corante chamado Azul Brilhante
de Coomassie G-250 soluo contendo protenas. No pH de reao, a interao entre a protena de
alto peso molecular e o corante provoca o deslocamento do equilbrio do corante da forma aninica
(vermelha) para a forma catinica (azul), que absorve fortemente em 595 nm.
Mtodo Bradford:
Reagentes
1. Albumina 1 mg/mL (armazenada a -20 C)
2. Soluo de Comassie Blue (armazenada 4 C)
0,05 g Comassie (Briliant Blue G)
25 mL de Etanol 95%
50 mL de cido ortofosfrico 85%
500 mL de gua Milli-Q
Procedimento
1. Identificar os tubos da curva e das amostras.
2. Descongelar a albumina em gelo;
3. Pipetar a Curva padro de Albumina, em duplicata ou triplicata, conforme os volumes
indicados na segunda coluna da tabela 1.
Tabela 1 Volumes aplicados nos tubos para quantificao de protena pelo mtodo
Bradford.
Tubos
Branco
1
2
3
4

Albumina 1mg/mL
10 L
20L
30 L
40 L

NaOH 1N
50 L
40 L
30 L
20 L
10 L

Comassie Blue
2,5 mL
2,5 mL
2,5 mL
2,5 mL
2,5 mL

Dica: dependo das necessidades do experimento, mais pontos de curva podem ser
adicionados, ou a curva pode ter maior amplitude. Isto deve ser determinado para cada tipo de
amostra.
4. Pipetar 10 L das amostras em duplicata ou triplicata nos tubos identificados.
5. Nos tubos da curva de albumina, pipetar os volumes indicados de NaOH 1 N na terceira
coluna da tabela 1, e homogeneizar no vrtex.
6. Nos tubos de amostras, pipetar 40 L de NaOH 1 N e homogeneizar no vrtex.
7. Em todos os tubos, adicionar 2,5 mL de soluo de Coomassie Blue, e homogeneizar no
vrtex.
8. Reservar soluo por 5 minutos e, posteriormente, fazer a leitura em 595 nm, zerando com
o Branco e comeando pela Curva.
Clculo
Calcular o FCP (fator de calibrao parcial) de cada ponto da curva:
FCP1 = Q1/A1
Onde: Q = quantidade de protena adicionada e A = absorbncia

Biotecnologia

SUMRIO

85

Calcular a FCM (fator de calibrao mdio) = mdia das FCPs


Estabelecer uma faixa: FCM +10% e -10% ver quais se encaixam. Se algum ponto ficar fora,
calcular novo FCM com os que esto dentro da faixa. Calcular a protena das amostras:
Abs x FCM x 100 (para passar para mL) = mg/mL de protena
Dicas:
Quando dosar um tipo de amostra nova, recomenda-se testar diferentes diluies da mesma
para definir qual diluio resulta em absorbncias que fiquem dentro da curva.
Para uma curva mais precisa, recomenda-se mais pontos por curva.
O presente protocolo recomenda que a quantificao seja feita em duplicata. Porm, realizar
a curva e amostras em triplicata ou mesmo quatriplicata dar mais segurana estatstica a dosagem
de protenas.
Em caso de amostras com pouca protena, pode-se fazer uma curva diluda, usando BSA 0,1
mg/mL.
Evitar dosar amostras com excesso de detergentes (> 2%), o que pode levar a interferncia no
mtodo.
Referncias:
BRADFORD, M. Analytical Biochemistry. 72, 248-254, 1976.

Biotecnologia

SUMRIO

86

2.17 QUANTIFICAO DE PROTENAS PELO MTODO DE LOWRY


O mtodo de Lowry et al. (1951) baseado na complexao do cobre em meio alcalino
formando uma cuproprotena de cor azul, lido espectrofotometricamente. Os ons cobre, em meio
alcalino, reagem com as ligaes peptdicas das protenas, formando um complexo de cor prpura
proporcional concentrao de protenas presentes na amostra. A albumina bovina utilizada
como padro.
Mtodo de Lowry:
Reagentes
1. Albumina 1 mg/mL
2. Folin 1 N armazenado na geladeira
3. Reativo A - Soluo de NaOH 0,1 M com Na2CO3 2%.
4. Reativo B Partes iguais de B1 (CuSO4 1%) e B2 (tartarato de Na e K 2%):
Dica: Armazenar o reagente B1 em frasco mbar; e o reagente B2 em frasco plstico.
5. Reativo C Partes Reativo Alcalino Cobre:
50 partes do Reativo A para 1 parte do Reativo B. Preparar somente na hora do uso e em
frasco mbar.
Adicionar os reagentes na ordem: A, B1 e B2. Na tabela abaixo, alguns valores padres para
volumes de rotina.
Volume A
20 mL
30 mL
40 mL
50 mL
100 mL

Volume B
0,4 mL = 200 L B1 + 200 L B2
0,6 mL = 300 L B1 + 300 L B2
0,8 mL = 400 L B1 + 400 L B2
1,0 mL = 500 L B1 + 500 L B2
2,0 mL = 1.000 L B1 + 1.000 L B2

Procedimentos
1. Identificar os tubos da curva e das amostras.
2. Descongelar a albumina;
3. Preparar o Reativo C (quantidade necessria de acordo com o nmero de amostras e suas
duplicatas);
4. Pipetar a Curva padro de Albumina.
Tubos
Branco
1, 1
2, 2
3, 3
4, 4
5, 5
6, 6

Padro de
albumina 1mg/
mL
0
10 L
20 L
40 L
60 L
80 L
100 L

gua Milli-Q

Q (Clculo)

100 L
90 L
80 L
60 L
40 L
20 L
0

0,00 mg
0,01 mg
0,02 mg
0,04 mg
0,06 mg
0,08 mg
0,10 mg

5. Pipetar as amostras em duplicatas nos tubos identificados, adicionando em cada um 10 L


da amostra e 90 L de gua.
6. Adicionar 1 mL do reativo C na curva e nas amostras.

Biotecnologia

SUMRIO

87

7. Homogeneizar os tubos no vrtex e aps, deixar 10 minutos em repouso.


8. Adicionar 100 L de Folin 1 N na curva e nas amostras.
9. Homogeneizar os tubos no vrtex e manter em ambiente escuro por 20 minutos (a cor
estvel por at 2 horas).
10. Realizar leitura em espectrofotmetro a 650 nm, em cubeta de plstico, lavando-a com
gua entre diferentes amostras.
Clculo
Calcular o FCP (fator de calibrao parcial) de cada ponto da curva:
FCP1 = Q1/A1
Onde: Q = quantidade de protena adicionada e A = absorbncia
Calcular a FCM (fator de calibrao mdio) = mdia das FCPs
Estabelecer uma faixa: FCM +10% e -10% ver quais se encaixam. Se algum ponto ficar fora,
calcular novo FCM com os que esto dentro da faixa. Calcular a protena das amostras:
Abs x FCM x 100 (para passar para mL) = mg/mL de protena
Dicas:
Quando dosar um tipo de amostra nova, recomenda-se testar diferentes diluies da mesma
para definir qual diluio resulta em absorbncias que fiquem dentro da curva.
Para uma curva mais precisa, recomenda-se mais pontos por curva.
O presente protocolo recomenda que a quantificao seja feita em duplicata. Porm, realizar
a curva e amostras em triplicata ou mesmo quatriplicata dar mais segurana estatstica dosagem
de protenas.
Em caso de amostras com pouca protena, pode-se fazer uma curva diluda, usando BSA 0,1
mg/mL.
Evitar dosar amostras com excesso de detergentes (> 2 %), o que pode levar interferncia
no mtodo.
Referncias:
LOWRY, O.H., Rosebrough, N.J., Lewis-Farr, A., Randall, R.J. (1951). Protein measurement with the folin phenol
reagent. J. Biol. Chem. 193, 265-275.

Biotecnologia

SUMRIO

88

2.18 QUANTIFICAO DE PROTENAS PELO MTODO BCA


Mtodo do cido bicinconnico (BCA) (Smith et al., 1985):
1. O mtodo de BCA um ensaio colorimtrico utilizado para determinar a concentrao de
protena em uma determinada amostra, com a sensibilidade variando de 0,5 g/mL a 1,5 mg/mL.
Este ensaio baseado na deteco de algumas ligaes peptdicas entre aminocidos especficos da
seguinte forma:
1.1 as ligaes peptdicas das protenas reduzem o Cu2+ presente em um dos reagentes
1.2 o cido bicinconnico liga-se ao cobre reduzido (Cu+), formando uma colorao prpura
que pode ser lida em espectrofotmetro (562 nm).
no kit.

2. Curva padro com albumina bovina (BSA), utilizando a soluo de BSA padro includa

2.1 A curva padro preparada em eppendorfs, sendo transferido um volume para a


microplaca de 96 poos para quantificao, conforme descrito na tabela abaixo:
Tubo
1
2
3
4
5
6
7
8

gua (L)
0
125
375
175
325
325
325
400

BSA Sol (L)


300 do estoque
375 do estoque
325 do estoque
175 do tubo 2
325 do tubo 3
325 do tubo 5
325 do tubo 6
0

Volume usado (L)*


10
10
10
10
10
10
10
10

[BSA] (g/mL)
2000
1500
1000
750
500
250
125
0= branco

* ser coletado para adicionar em cada poo da microplaca


2.2 Adicionar 200 L do mix do reagente de BCA 50:1 (196 L do reagente A + 4 L do
reagente B).
2.3 Incubar 30 min a 37 oC e fazer a leitura em espectrofotmetro (562 nm)
2.4 Plotar os dados em Excel e pedir a equao da reta: y = a + bx.
Dica: para uma curva ser considerada boa, o valor de R2 deve ser o mais prximo de 1, sendo
satisfatrio valores acima de 0,98.
3. Ensaio:
3.1 A uma microplaca de 96 poos adiciona-se 10 L de amostra e 200 L do mix do reagente
BCA 50:1 (196 L do reagente A + 4 L do reagente B).
Dica: preparar o mix do reagente de BCA em um eppendorf ou tubo de ensaio para todas as
amostras + um branco. Misturar. Desta forma, a soluo ser homognea para todos.
3.2 Incubar o ensaio por 30 min a 37 oC
3.3 Passado o tempo, realizar a leitura em espectrofotmetro a 562 nm.
4. Clculo:
4.1 Para leitura em placa de 96 poos: aplicar o valor de absorbncia encontrado na equao
da reta (para se obter a quantidade de protena em g) e multiplicar por 100 (para se obter a
quantidade de protena por mL)
4.2 O resultado a quantidade de protena de uma determinada amostra em g/mL.
Referncias:
SMITH, P.K., et al. 1985. Measurement of protein using bicinchoninic acid. Analytical Biochemistry 150:76-85.

Biotecnologia

SUMRIO

89

CAPTULO 3
GENOTIPAGEM DE POLIMORFISMOS EM
AMOSTRAS HUMANAS
Camile Wnsch, Guilherme Pinto Bertuzzi, Jlia Pasqualini Genro, Luana Maria Wollinger,
Pricila Girardi, Raquel Piccinini Castoldi, Vernica Contini

A genotipagem de polimorfismos em humanos, geralmente, se baseia em tcnicas bsicas


de biologia molecular. Contudo, h variao de utilizao dessas tcnicas de acordo com o tipo de
polimorfismo a ser analisado. Para tanto, antes de definir os diferentes procedimentos metodolgicos
a serem utilizados, necessrio compreender alguns aspectos relacionados classificao dos
polimorfismos que ocorrem na espcie humana.
A variao do genoma humano, em pequena escala, pode se dar por meio de variaes no
tamanho de uma determinada regio ou na sequncia de bases nitrogenadas que ocorrem em
um determinado ponto do material gentico. As alteraes mais comuns da sequncia de bases
nitrogenadas em um determinado local do genoma so conhecidas como polimorfismos de
nucleotdeo nico (SNPs, do ingls single nucleotide polymorphisms), os quais apresentam, na maioria
das vezes, apenas dois alelos possveis. Os SNPs descritos no genoma humano so catalogados
em um banco de dados pblico e identificados por nmeros iniciados por rs (do ingls, reference
SNP) (http://www.ncbi.nlm.nih.gov/projects/SNP). Outras variantes polimrficas de sequncia
de bases podem caracterizar os polimorfismos de insero/deleo (InDel), os quais so formados
pela insero (ou deleo) de um ou mais nucleotdeos no repetidos em um determinado ponto do
genoma.
Os polimorfismos de tamanho, geralmente, apresentam uma sequncia repetitiva, que
aparece em nmero varivel de vezes, conferindo tamanhos diferentes regio. So constitudos
por blocos cujo nmero de unidades repetitivas varivel. De acordo com o comprimento dessa
unidade de repetio, os polimorfismos de tamanho podem ser classificados em microssatlites
(com unidades de repetio de 1, 2 ou 4 nucleotdeos) ou minissatlites (com unidades de repetio
de 10 a 50 nucleotdeos) que tambm podem ser denominados VNTRs (do ingls, variable number
tandem repeats).
A seguir, sero apresentadas individualmente as tcnicas bsicas que so utilizadas para a
genotipagem de polimorfismos em humanos. Na seo seguinte, descrevem-se mais especificamente
as metodologias de genotipagem que se utilizam dessas tcnicas.

Biotecnologia

SUMRIO

90

3.1 REAO EM CADEIA DA POLIMERASE (PCR)


A genotipagem de polimorfismos, como os descritos acima, realizada, geralmente,
utilizando metodologias baseadas na Reao em Cadeia da Polimerase (PCR). A PCR consiste na
amplificao (cpia) de determinadas regies do genoma (neste caso, a regio dos polimorfismos)
a partir de alteraes cclicas de temperatura, que regulam a ao da enzima envolvida na reao,
a DNA Polimerase. O procedimento realizado em um aparelho, capaz de realizar as alteraes
de temperatura de acordo com programas previamente definidos, denominado termociclador. O
resultado obtido a amplificao da regio de interesse com bilhes de cpias, o que permitir as
anlises posteriores. Tal reao ocorre de acordo com as seguintes fases:
1. Desnaturao inicial (95 C 5 minutos)
2. Desnaturao (95 C 15 segundos a 1 minuto)
3. Anelamento (50 a 65 C 1 minuto)
4. Extenso (72 C 1 minuto)
* Os passos 2, 3 e 4 se repetem de 30 a 40 vezes.
5. Extenso final (72 C 10 minutos)
As temperaturas e os tempos apresentados acima so totalmente variveis, de acordo com as
especificidades da reao (propriedades dos primers utilizados, tamanho do fragmento de interesse,
caractersticas da sequncia de nucleotdeos etc.).
Para que ocorra a PCR, necessria a presena de alguns reagentes especficos, os quais so
discutidos abaixo:
- DNA Polimerase: enzima responsvel por sintetizar as cpias da regio de interesse. Atua
adicionando nucleotdeos durante a fase de extenso.
Nota: as enzimas geralmente so comercializadas juntamente com uma soluo tampo
(buffer) especfica, necessria para a ao correta da Polimerase. Deve-se, portanto, sempre estar
atento s orientaes trazidas pelo fabricante.
- MgCl2: co-fator necessrio para o correto funcionamento da DNA Polimerase.
- Primers: sequncias de oligonucleotdeos especficas para determinadas regies do genoma.
Tambm conhecidos como iniciadores, so os responsveis por indicar DNA Polimerase o local a
ser amplificado/copiado.
Nota: Portanto, cada polimorfismo a ser genotipado exige um conjunto de primers especfico
para a regio na qual se encontra.
- dNTPs: desoxirriobonucleotdeos trifosfatados. So utilizados pela DNA Polimerase como
matria-prima para a amplificao do fragmento de interesse.
Nota: devem estar presentes dNTPs dos quatro tipos (Adenina, Citosina, Guanina e Timina),
geralmente, em igual concentrao.
As concentraes de todos os reagentes mencionados acima variam de acordo com a PCR que
se est realizando. Em geral, esses reagentes compem uma reao cujo volume total de 25 L ou
50 L, com diferentes concentraes de cada reagente. Entretanto, necessrio o desenvolvimento
de protocolos especficos para cada regio do genoma a ser amplificada. Ou seja, cada polimorfismo
a ser genotipado exige uma reao com concentraes que podem ser distintas.
Dessa forma, esse captulo no ir definir volumes e condies de amplificao, uma vez que
essas so caractersticas totalmente variveis. Entretanto, existem algumas condies bsicas que
podem servir como ponto de partida para a padronizao de reaes de PCR especficas, as quais
podem ser encontradas nos protocolos disponibilizados pelos fabricantes.

Biotecnologia

SUMRIO

91

Protocolo de PCR bsico


(Taq DNA polymerase Life TechnologiesTM Protocols)
Componentes: Concentrao final na reao:
10X PCR buffer 1X
10 mM dNTP mix

0,2 mM cada dNTP

50 mM MgCl2 1,5 nM
Primer mix (10 mM cada)

0,5 M cada

Taq polimerase (5U/L)

1,0 a 2,5U

Nota: deve-se acrescentar gua Milli-Q, ou de injeo, para completar o volume final da
reao. A concentrao de DNA total acrescentado reao pode variar conforme as especificaes
da PCR.
Cuidados durante a realizao da tcnica:
- Usar os EPIs (Equipamentos de Proteo Individual) necessrios e falar o mnimo durante
a realizao do procedimento.
- Manter todos os reagentes protegidos da luz e no gelo at o momento em que for us-los.
Dica: fazer alquotas dos reagentes para que no haja contaminao desses.
- Identificar os microtubos conforme as amostras a serem amplificadas.
Preparar uma reao geral de PCR (contendo os reagentes bsicos: buffer ou tampo,
dNTPs, MgCl2, primers, Taq polimerase, gua) em um nico microtubo, considerando o nmero
de amostras a serem amplificadas. Em seguida, distribuir nos microtubos individuais, previamente
identificados, e adicionar o DNA de cada amostra. No caso da realizao da reao em uma placa,
recomenda-se montar um esquema/ desenho da placa, com a localizao de cada amostra a ser
genotipada.
Dica: multiplicar a quantidade de cada reagente pelo nmero de amostras a serem
amplificadas + Controle Negativo.
Importante: a presena de um tubo de Controle Negativo, sem adio de DNA, essencial
para garantir a qualidade do procedimento.

Biotecnologia

SUMRIO

92

3.2 DIGESTO ENZIMTICA


A digesto enzimtica, ou clivagem com enzima de restrio, uma reao em que so
utilizadas endonucleases de restrio com stios de corte especficos. Essas enzimas so capazes de
clivar o material gentico em algumas regies, a partir do reconhecimento de sequncias especficas,
denominadas stios de restrio. Em outras palavras: as enzimas de restrio cortam as molculas
de DNA em cada regio que apresente um stio de restrio.
Nota: cada enzima de restrio apresenta um stio especfico e uma determinada condio
para reao (tempo e temperatura de incubao, concentrao, etc.); tais informaes so sempre
fornecidas pelo fabricante desses reagentes.

Biotecnologia

SUMRIO

93

3.3 ELETROFORESE EM GEL


A eletroforese um mtodo utilizado, entre outras possibilidades, para visualizao
de material gentico. A tcnica se baseia na separao de fragmentos de espcies eletricamente
carregadas, a partir da exposio a uma corrente eltrica.
Tecnicamente, o mtodo consiste na produo de um gel que pode ser de agarose ou de
poliacrilamida pelo interior do qual passam as molculas a serem analisadas. No caso do DNA,
as molculas iro migrar pelo gel em direo ao plo positivo, e, de acordo com o tamanho,
migram em diferentes velocidades. Dessa forma, ao fim do processo, podem ser visualizadas
bandas que correspondem a fragmentos de DNA de tamanhos distintos. Pela utilizao de corantes
fluorescentes, como o brometo de etdio, que se intercala s molculas de DNA, por exemplo. As
bandas ficam visveis sob iluminao ultravioleta (UV).
Existem diferentes condies para realizao da eletroforese. Alm do material com o qual
se produz o gel, pode-se variar a concentrao do mesmo, o tempo de corrida e a intensidade
da corrente eltrica. O principal fator determinante dessas condies a diferena, em nmero
de pares de bases (pb), entre os fragmentos a serem separados. Portanto, para cada protocolo
de genotipagem, por exemplo, h um determinado conjunto de condies para a realizao da
eletroforese. Mais uma vez, esse captulo no ir discutir essas condies especficas, uma vez que
so altamente variveis, mas faremos algumas consideraes tcnicas importantes.
Consideraes tcnicas:
- As tcnicas de eletroforese em gel so realizadas em cubas, preenchidas por uma soluo
tampo lquida, onde o gel imerso e pela qual passa a corrente eltrica. A soluo tampo,
geralmente, formada por Tris, cido Brico e EDTA (TBE 1X) e tem como funo permitir o fluxo
de eltrons.
Nota: Para a preparao de 1 litro de TBE 10X: dissolve-se 55 g de cido brico, 108 g de
Tris-base e 9,25 g de EDTA em 1 litro de gua Milli-Q (pH desejado de 8,6), Aps o preparo
recomendado autoclavar a soluo.
- Os gis so sintetizados em formas especficas, capazes de produzir uma estrutura slida
com poos verticais, onde so aplicadas as amostras de DNA a serem analisadas. O volume de
agarose ou poliacrilamida necessrio para preenchimento dessas formas varia de acordo com o
tamanho do equipamento.
Eletroforese em gel de agarose:
- O preparo do gel realizado diretamente a partir de agarose slida.
- A concentrao do gel varivel e a quantidade de agarose deve ser calculada de acordo
com essa concentrao. Por exemplo: para um gel com concentrao de 1%, dissolve-se 1g de
agarose em 100 mL da soluo TBE 1X; portanto, um gel com concentrao de 1,5 % deve ser feito a
partir da dissoluo de 1,5 g de agarose em 100 mL de TBE 1X.
- Para que ocorra a dissoluo completa da agarose, e posterior solidificao, necessrio
aquecer. Aps o aquecimento, ento, a soluo fica homognea as partculas de agarose no mais
esto visveis e pode ser colocada nas formas para solidificao.
Dica: ao aquecer, em um aparelho micro-ondas, evite que a soluo transborde durante
a fervura. Para isso, o ideal pausar o aquecimento a cada 10 segundos, aproximadamente, e
movimentar o frasco em movimentos circulares, para homogeneizao. Em aproximadamente 30

Biotecnologia

SUMRIO

94

segundos a mistura j se encontra dissolvida. importante tambm evitar a formao de bolhas no


momento de verter a soluo na forma.
- O corante de visualizao (brometo de etdio ou assemelhado) deve ser adicionado ao gel
ainda no estado lquido, aps resfriamento parcial.
Dica: o brometo de etdio uma substncia carcinognica. Seu manuseio e de todo o material
em contato deve ser feito cuidadosamente, utilizando luvas sem talco (azuis), em rea isolada e
especfica. Ao homogeneizar a soluo, no respirar o vapor.
- Aps a solidificao do gel, imergir completamente em TBE 1X no interior da cuba e aplicar
as amostras a serem analisadas.
Dica: no momento da aplicao das amostras necessrio adicionar um corante, como o azul
de bromofenol, para monitorar a migrao das molculas de DNA no gel.
- Posicionar o gel sempre de modo que os poos estejam prximos ao plo negativo para que,
ao ser atrado pelo plo positivo, o DNA migre pelo interior do gel.
- Examinar o resultado sob radiao UV (em um transiluminador).
Dica: no olhar diretamente para a luz UV, sempre fechar a tampa do transiluminador e
utilizar culos de proteo antes de lig-lo.
- essencial, em procedimentos de genotipagem de polimorfismos, adicionar um marcador
de peso molecular (em pb), conhecidos com Ladder. Os diferentes marcadores auxiliam na
identificao do tamanho dos fragmentos de interesse. Por exemplo, um Ladder de 50 pb produzir
uma sequncia de fragmentos de 50 pb a 500 pb no gel, em mltiplos de 50 pb. Nota: os padres
gerados por diferentes Ladders so fornecidos pelo fabricante quando da compra do material.
- Devido ao potencial carcinognico do brometo de etdio, o descarte do gel e das luvas
utilizadas no seu preparo e manipulao deve ser feito em lixeiras especficas (saco laranja),
prprias para material infectante e perigoso. A lavagem dos materiais utilizados deve ser realizada
em local especfico, assim como a vidraria de preparo dos gis de agarose deve ser de uso exclusivo
dessa tcnica.
Eletroforese em gel de poliacrilamida:
- O preparo do gel pode ser realizado diretamente a partir de acrilamida e bis-acrilamida
slidas. Entretanto, devido toxicidade desses compostos no estado slido, costuma-se preparar
uma soluo aquosa de acrilamida 30 %, a partir da qual so feitas diluies para se atingir a
concentrao de cada gel.
- Para preparao da soluo de acrilamida 30 %: dissolve-se 15 g de acrilamida e 0,4 g de
bis-acrilamida em 50 mL de gua destilada.
- O gel assume estado slido aps o processo de polimerizao da acrilamida, que forma uma
rede de poliacrilamida. Para que essa polimerizao ocorra, necessria a adio dos catalisadores
Persulfato de Amnio e TEMED.
Importante: as concentraes desses reagentes variam de acordo com o volume do gel a ser
produzido.
- A montagem das cubas de eletroforese em gel de poliacrilamida pode variar
significativamente de acordo com o modelo do equipamento. Em geral, as cubas so verticais
e o gel polimerizado entre duas placas de vidro. Geralmente, a corrida ocorre, assim como na
eletroforese em gel de agarose, a partir da imerso em soluo de TBE 1X.
- A colorao de gis de poliacrilamida pode ser realizada de diferentes maneiras. As mais
comuns so a imerso em nitrato de prata ou em soluo aquosa de brometo de etdio; entretanto,
cada tcnica apresenta condies e caractersticas bastante especficas.

Biotecnologia

SUMRIO

95

3.4 METODOLOGIAS DE GENOTIPAGEM BASEADAS NA PCR


a) Genotipagem de VNTR: PCR
Para a genotipagem de polimorfismos do tipo VNTR, a metodologia simples: consiste na
realizao de uma PCR especfica para a regio polimrfica, utilizando primers que se localizem
em local externo regio repetitiva. Com isso, ocorrer a amplificao de fragmentos de diferentes
tamanhos, conforme o nmero de repeties que cada molcula de DNA apresenta.
Aps a amplificao, realiza-se a eletroforese das amostras amplificadas e, de acordo com a
posio das bandas no gel, possvel determinar os alelos presentes em cada amostra.
Dica: ao estabelecer um protocolo para genotipagem de VNTR, essencial conhecer o
tamanho da unidade de repetio, bem como o nmero de repeties presentes nos alelos mais
frequentes. Isso permitir desenvolver condies de amplificao e eletroforese mais adequadas
deteco dos fragmentos de tamanhos distintos.
b) Genotipagem de SNP: PCR-RFLP
A metodologia de genotipagem de SNP por PCR-RFLP (PCR Restriction Fragment Length
Polymorphism) baseia-se na deteco de padres eletroforticos distintos, aps digesto das amostras
a serem genotipadas com enzima de restrio especfica. Por apresentarem sequncias distintas,
os dois alelos possveis tm reaes diferentes aps a clivagem, e tal diferena fica visvel aps a
realizao da eletroforese.
Para realizao da metodologia de PCR-RFLP, portanto, necessrio que o polimorfismo
crie ou anule um stio de restrio para alguma enzima. Ou seja: apenas um dos alelos possveis
apresentar o stio de restrio, de modo que, em amostras de DNA que contenham tal alelo, o
produto de PCR ser clivado e observado na forma de fragmentos menores aps a eletroforese.
Trs etapas compem tal metodologia de genotipagem:
(I) Amplificao do fragmento de interesse: consiste na realizao de uma PCR, utilizando
primers especficos, localizados em regio externa ao local de ocorrncia do SNP.
Dica: antes de fazer a clivagem, checar o produto da PCR em uma eletroforese simples, que
objetiva a visualizao de bandas de apenas um tamanho.
(II) Clivagem do produto da PCR com enzima de restrio especfica: as condies para a
reao de clivagem variam de acordo com a enzima utilizada. Cada enzima de restrio apresenta
uma determinada concentrao e determinado tempo e temperatura de incubao que possibilitam
a clivagem dos fragmentos de PCR.
(III) Eletroforese para deteco dos diferentes alelos: na eletroforese final, podem ser
visualizados trs fragmentos distintos de tamanhos: (a) o fragmento de tamanho igual ao produto
da PCR, que corresponde ao alelo que no apresenta o stio de restrio para a enzima e que,
portanto no clivado; (b) e (c) fragmentos de menor tamanho, resultado da clivagem do produto
da PCR; correspondem ao alelo que apresenta o stio de restrio e que, portanto, clivado
durante a digesto.
Dica: podero ser observados, ento, trs padres eletroforticos distintos para cada uma
das amostras: (1) amostras de indivduos homozigotos para o alelo que no apresenta o stio de
clivagem exibiro apenas um fragmento maior, o fragmento do produto da PCR; (2) amostras de
indivduos homozigotos para o alelo que possui o stio de clivagem apresentaro dois fragmentos
menores, produtos da digesto enzimtica; e (3) amostras de indivduos heterozigotos para o SNP
apresentaro os trs fragmentos possveis.

Biotecnologia

SUMRIO

96

c) Genotipagem de SNP: PCR em Tempo Real (Sistema de discriminao allica TaqMan Applied Biosystems)
A metodologia para a genotipagem de SNPs pelo sistema de discriminao allica TaqMan
segue o princpio geral da PCR convencional. No entanto, a PCR em tempo real permite a
quantificao dos cidos nucleicos durante o processo, por meio da utilizao de compostos
fluorescentes (fluorforos), os quais emitem sinais de fluorescncia na medida em que aumenta a
quantidade de produto da PCR. A PCR em tempo real requer uma plataforma de instrumentao
especfica, com sistemas para a excitao e coleta da fluorescncia e um software acoplado para a
anlise dos dados.
O sistema TaqMan utiliza sondas (fragmentos de DNA marcados com fluorforos) que
hibridizam com regies especficas do genoma, localizadas entre os stios de ligao dos primers.
A sonda marcada com um fluorforo reprter na extremidade 5 e com uma molcula quencher
na extremidade 3- assim, quando a sonda est intacta, a proximidade entre o fluorforo reprter e
o quencher impede a emisso de fluorescncia. Durante a reao da PCR ocorre a hibridizao dos
primers e da sonda e, durante a extenso dos primers pela enzima Taq Polimerase, por sua atividade
5-3 exonuclease, ocorre a clivagem da sonda. Desta forma, a fluorescncia emitida pelo fluorforo
reprter pode ser detectada pelo sistema. Assim, o sistema capaz de produzir, ao fim da PCR,
uma descrio da intensidade de fluorescncia detectada a cada ciclo.
Para a genotipagem de SNPs pelo sistema de discriminao allica TaqMan so necessrias,
portanto, alm dos reagentes de uma PCR convencional, duas sondas (marcadas com fluorforos
distintos), as quais so especficas para cada alelo do polimorfismo a ser genotipado. Diversos
ensaios j padronizados, com conjuntos de primers e sondas especficas, esto disponveis para a
genotipagem de milhares de SNPs em humanos. Os demais reagentes necessrios PCR (enzima
Taq Polimerase, dNTPs, tampo da reao) tambm podem ser adquiridos balanceados, e em
conjunto, em um master mix especfico para o sistema de discriminao allica TaqMan.
Existem diferentes modelos de equipamentos de PCR em tempo real, os quais podem variar
nos sistemas pticos, na capacidade de amostras e nos softwares de anlise dos dados. No entanto,
para a genotipagem de polimorfismos atravs do sistema de discriminao allica TaqMan
algumas condies bsicas podem ser observadas:
- O ensaio padronizado de cada SNP (contendo os primers e as sondas) adquirido,
geralmente, em uma concentrao de 40X.
Dica: para cada ensaio disponibilizado sempre a informao correspondente aos fluorforos
reprteres. De formal geral, os dois alelos possveis do polimorfismo so marcadores com as
fluorescncias VIC e FAM, respectivamente.
- O master mix de genotipagem, geralmente, est em uma concentrao de 2X.
Dica: recomenda-se uma padronizao na concentrao de DNA de todas as amostras a
serem genotipadas.
Dica 1: recomenda-se sempre observar as condies descritas e sugeridas pelo fabricante,
tanto na preparao da reao, quanto no funcionamento do software.
Cuidados durante a realizao da tcnica:
- Usar luvas sem talco (azul) para manusear o equipamento.
- Manter todos os reagentes TaqMan protegidos da luz e no gelo at o momento em que for
us-los. A exposio excessiva luz pode afetar as sondas fluorescentes.

Biotecnologia

SUMRIO

97

Dicas: fazer alquotas dos reagentes TaqMan para que no haja contaminao desses;
enrolar os tubos e alquotas dos ensaios em um pedao de papel alumnio para evitar a exposio
excessiva de luz.
- Assim como em uma reao de PCR convencional, recomenda-se preparar uma reao
geral de PCR (contendo o master mix e o ensaio) em um nico microtubo, considerando o nmero
de amostras a serem amplificadas, e distribuir posteriormente. Da mesma forma, indispensvel a
presena de um ou mais controles negativos da reao.
Leitura dos resultados:
A leitura dos resultados da genotipagem de SNPs por PCR em tempo real dita
endpoint, pois avalia a emisso de fluorescncia das sondas no final da termociclagem. Assim,
para um determinado SNP, trs grupos diferentes podem ser observados, de acordo com o tipo
de fluorescncia emitida. Por exemplo, para um SNP com os alelos T (sonda marcada com o
fluorforo VIC) e G (sonda marcada com o fluorforo FAM), so possveis trs gentipos, cada
qual correspondendo a uma leitura de fluorescncia: (i) amostras homozigotas TT exibiro a
fluorescncia VIC; (ii) amostras homozigotas GG emitiro a fluorescncia FAM e (iii) amostras de
heterozigotos exibiro as duas fluorescncias (VIC e FAM).
Embora o funcionamento do software de anlise dos resultados varie conforme o modelo do
equipamento de PCR em tempo real utilizado, basicamente os resultados podem ser visualizados
de duas maneiras:
1. Allelic Discrimination Plot
- Grfico com o resultado final da reao. Exibe a classificao das amostras nos trs gentipos
possveis do SNP analisado.
- Clicando sobre os poos individuais da placa possvel identificar a amostra no grfico e
vice-versa.

Biotecnologia

SUMRIO

98

2. Amplification Plot
- Permite a visualizao individual de cada amostra durante o ciclo da PCR.
- O exemplo abaixo corresponde a uma amostra heterozigota (deteco das duas fluorescncias
durante a amplificao).

Biotecnologia

SUMRIO

99

CAPTULO 4
ANLISES FISIOLGICAS EM AMOSTRAS
VEGETAIS E ANIMAIS
Adriane Pozzobon, Andressa Dametto, Bruna Caye, Cludia Stein, Dalana Faleiro, Dbora Mara Kich,
dina Aparecida dos Reis Blasi, Eduardo Cremonese Filippi-Chiela, Giseli Buffon,
Isabel Cristina Gouva de Borba, Luciana Knabben Oliveira Becker Delving, Marcia Ines Goettert,
Mardja Manssur Bueno e Silva, Raul Antonio Sperotto, Ronize Zeni da Silva,
Vinicius de Abreu Waldow

Biotecnologia

SUMRIO

100

4.1 EXTRAO E QUANTIFICAO DE CLOROFILAS


As clorofilas so os pigmentos naturais mais abundantes presentes nas folhas, sendo
fundamentais para a produo de oxignio e acares por meio da fotossntese. O contedo
de clorofila nas folhas comumente utilizado para estimar o potencial fotossinttico e,
consequentemente, analisar o desenvolvimento e crescimento da planta.
Mtodo de Ross, 1974:
1. Identificar e pesar os tubos eppendorf de 2,0 mL que sero utilizados (Pi).
2. Pulverizar o material vegetal em nitrognio lquido (N2) utilizando cadinho e pistilo.
3. Transferir para os tubos eppendorf em torno de 100 mg do material pulverizado.
4. Adicionar 1,5 mL de Acetona 85% e agitar vigorosamente.
5. Deixar em repouso por 30 minutos em local escuro.
Dica: pode ser colocado em uma gaveta.
6. Centrifugar a 12.000 rpm por 3 minutos.
7. Coletar o sobrenadante em outro tubo (pode ser um tubo Falcon de 15 mL) e repetir o passo
4 e 6 com o pellet restante at a completa extrao das clorofilas, que alcanada quando o pellet
apresenta-se descolorido. Colocar os tubos com o pellet em estufa a 60 C por no mnimo cinco dias.
Aps, pesar os tubos contendo o peso seco (Pf).
8. Acertar o volume final na proveta, pra facilitar o clculo posterior.
Dica: Utilizar Acetona 85% para acertar o volume final em 10 mL.
11. Realizar a leitura no espectrofotmetro (645 nm e 663 nm).
12. Calcular as concentraes de clorofilas (g/l):
Cloa = (0,0127 X Absorbncia663nm) (0,00269 X Absorbncia645nm)
Clob = (0,0229 X Absorbncia645nm) (0,00468 X Absorbncia663nm)
13. Calcular o peso seco: PS: Pf Pi

14. Calcular a concentrao de clorofila (a, b, ou total) em relao ao peso seco.


Referncia:
ROSS, C. W. Plant Physiology Laboratory Manual. Belmont, CA, USA: Wadsworth Publishing Company, 1974.

Biotecnologia

SUMRIO

101

4.2 QUANTIFICAO DE ACARES SOLVEIS TOTAIS


Este protocolo utilizado para quantificar os acares solveis totais (glicose, frutose,
sacarose) de uma amostra, utilizando-se o reagente Antrona.
1. Homogeneizar material em nitrognio lquido.
2. Adicionar 2 mL de etanol 80% em 100 - 250 mg de material e agitar no vrtex.
3. Manter a 75 C por 10 minutos.
4. Centrifugar a 10.000 g por 10 minutos.
5. Transferir sobrenadante para novo tubo e lavar o precipitado (frao insolvel) com 2 mL
de etanol 80%. Coletar novamente o sobrenadante.
6. Seguir imediatamente a reao.
Reao:
950 L Antrona (Preparao: 150 mg Antrona + 100 mL H2SO4 72%)
50 L da amostra
7. Incubar reao em agua fervente, por 10 minutos.
8. Aps resfriamento das amostras, realizar leitura em espectrofotmetro (650 nm).
9. Calcular a concentrao de acares solveis totais atravs de uma curva de concentrao
de glicose (0-100 g de glicose).
10. Calcular a razo entre o contedo de acares solveis totais e o peso seco da amostra.

Biotecnologia

SUMRIO

102

4.3 QUANTIFICAO DE CARBONILAO OU OXIDAO DE


PROTENAS
A quantificao de carbonilao de protenas um mtodo para determinar a existncia de
estresse oxidativo em amostras biolgicas, que levam a uma maior oxidao e, consequentemente,
degradao das mesmas.
Mtodo de Levine et al., 1994:
1. Preparar o Tampo de Extrao:
Tris HCl 1 M (pH 8,0)

0,5 mL

(50 mM)

EDTA 50 mM

0,4 mL

(2 mM)

PMSF 100 mM

100 L

(1 mM)

Benzamidina 100 mM

100 L

(1 mM)

H2O MilliQ q.s.p.


TOTAL 10 ml
2. Pulverizar material (0,2 - 0,5 g) em nitrognio lquido (N2).
3. Adicionar 1 mL do Tampo de Extrao em cada amostra.
4. Centrifugar a 11000 g por 15 minutos a 4 C.
5. Coletar sobrenadante e utilizar imediatamente nos passos posteriores.
6. Transferir 500 L do extrato para novo tubo.
7. Adicionar 50 L de streptomicina 10% e manter a temperatura ambiente por 15 minutos.
8. Centrifugar a 11000 g por 10 minutos a 4 C.
9. Coletar sobrenadante e transferir para um tubo novo.
10. Adicionar 500 l de TCA 20% e manter a temperatura ambiente por 15 minutos.
11. Centrifugar a 11000 g por 10 minutos a 4 C e descartar sobrenadante.
12. Ressuspender o precipitado em 500 L de DNPH (10 mM, 2 M HCl).
13. Incubar por 1 hora a temperatura ambiente, agitando a amostra de 15 em 15 minutos.
14. Adicionar 500 L de TCA 20% e manter a temperatura ambiente por 15 minutos.
15. Centrifugar a 11000 g por 10 minutos a 4 C e descartar sobrenadante.
16. Lavar precipitado com 1 mL de Etanol:Acetato de Etila (1:1) e manter a temperatura
ambiente por 10 minutos.
17. Centrifugar a 11000 g por 3 minutos a 4 C.
18. Repetir a lavagem por mais duas vezes (passos 16 e 17).
19. Ressuspender precipitado em 0,6 mL de Ureia 6 M (pH 2,4) e manter a temperatura
ambiente por 15 minutos.
20. Realizar leitura no espectrofotmetro (A370).
21. Determinar o contedo de Carbonil de acordo com a frmula:
Carbonil (M) = (A370 / 22.000) x 1.000.000
22. Determinar o teor de protenas de cada amostra por Bradford (1976).
23. Calcular a razo entre o contedo de Carbonil e o teor de protenas de cada amostra.

Biotecnologia

SUMRIO

103

Referncia:
LEVINE, R. L; WILLIAMS, J. A.; STADTMAN, E. R.; SHACTER, E. Carbonyl assays for determination of oxidatively
modified proteins. Methods Enzymol, v. 57, p. 233-346, 1994.

Biotecnologia

SUMRIO

104

4.4 QUANTIFICAO DO NVEL DE PEROXIDAO LIPDICA


UTILIZANDO TBARS
Este protocolo, indiretamente, utilizado para quantificar o nvel de peroxidao lipdica,
por meio da quantificao de substncias que reagem com o cido tiobarbitrico (TBARS).
Determinao de TBARS (Hodges et al., 1999)
1. Homogeneizar as amostras em N2 lquido.
2. Adicionar 0,2 - 0,5 g em tubo previamente pesado e identificado.
3. Adicionar 1,5 ml de etanol 80%.
4. Centrifugar a 3.000 g por 10 minutos a temperatura ambiente.
5. Coletar sobrenadante e seguir imediatamente os passos seguintes.
6. Para determinao de TBARS, adicionar 0,5 ml de extrato diludo (1:5) nas reaes:
TBA 100 l TCA 100%
50 l BHT 0,1%
350 l H2O
TBA +
100 l TCA 100%
50 l BHT 0,1%
325 l TBA 1%
25 l H2O
7. Agitar as amostras vigorosamente e incubar a reao 95 C por 25 minutos.
8. Aps o resfriamento, realizar as leituras em espectrofotmetro (440, 532 e 600nm).
9. Calcular os equivalentes de MDA (TBARS) da seguinte maneira:
[(Abs 532 + TBA) (Abs 600 + TBA) (Abs 532 TBA Abs 600 TBA)] = A
[(Abs 440 + TBA Abs 600 + TBA) x 0,0571] = B
TBARS (nmol. ml-1) = (A B/157.000) x 106
10. Calcular a razo entre o contedo de TBARS e o peso seco da amostra.
Referncia:
HODGES, D.M.; DELONG, J.M.; FORNEY, C.F.; PRANGE, R.K. 1999. Improving the thiobarbituric acid-reactivesubstances assay for estimating lipid peroxidation in plant tissues containing anthocyanin and other interfering
compounds. Planta 207: 604-611.

Biotecnologia

SUMRIO

105

4.5 QUANTIFICAO DE VAZAMENTO DE ELETRLITOS


(ELECTROLYTE LEAKAGE ASSAY)
Esta tcnica permite avaliar a integridade das membranas celulares, uma vez que quanto
menor a condutividade eltrica da soluo, menor a quantidade de eletrlitos que extravasaram,
indicando o grau de integridade da membrana celular.
1. Coletar 10 discos foliares medindo aproximadamente 1 cm de dimetro.
2. Incubar em 20 mL de gua destilada.
3. Manter 25 C por 24 horas, com agitao leve e constante.
4. Medir a condutividade eltrica do extrato (L1), utilizando um condutivmetro.
5. Ferver as amostras por 1 hora, com os tubos vedados.
6. Medir novamente a condutividade eltrica (L2).
7. O percentual de danos nas membranas (DM) estimado pela relao:
%DM = (L1/ L2) x 100
Referncias:
BLUM, A., Ebercon, A. Cell membrane stability as a measure of drought and heat tolerance in wheat. Crop Science 21:
43-47, 1981.
SILVEIRA, J.A.G.; Melo, A.R.B.; Vigas, R.A., Oliveira, J.T.A. Salt-induced effects on the nitrogen assimilation related
to growth in cowpea plants. Environmental and Experimental Botany 46: 171-179, 2001.

Biotecnologia

SUMRIO

106

4.6 LOCALIZAO HISTOQUMICA DA PEROXIDAO LIPDICA


UTILIZANDO O REAGENTE DE SCHIFF
Este mtodo identifica os grupamentos aldedos que so produzidos em resposta
peroxidao de lipdios, sendo um excelente marcador de estresse oxidativo e senescncia.
Reagente de Schiff
2 g de fucsina bsica
20 mL de HCl 1 N
2 g de metabissulfito de sdio
4 g de carvo ativado
400 mL de gua destilada
Tcnica para preparar o reagente de Schiff
1. Ferver a gua destilada em um balo volumtrico.
2. Remover do calor e lentamente adicionar a fucsina bsica, sempre agitando
(aproximadamente 5 minutos).
3. Deixar esfriar para 50C e adicionar o HCl. Filtrar.
hora).

4. Esfriar para 25C e adicionar o metabissulfito de sdio. Agitar bem (aproximadamente 1


5. Envolver o recipiente em papel alumnio ou saco preto.
6. Deixar no escuro durante a noite.

7. No dia seguinte, adicionar o carvo ativado e filtrar imediatamente. Repetir este passo at
que o filtrado torne-se incolor.
Deteco histoqumica da peroxidao lipdica descrita conforme Pompella et al. (1987)
As amostras devem ser coradas com reagente de Schiff durante 60 minutos para detectar
aldedos provenientes da peroxidao lipdica. Depois da reao com o reagente de Schiff, a amostra
deve ser lavada com uma soluo de sulfito (0,5% K2S2O5 em HCl 0,05 M) e mantida nessa soluo
para manter a colorao.
Referncia:
POMPELLA, A.; MAELLARO, E.; CASINI, A. F.; COMPORTI, M. Histochemical detection of lipid peroxidation in the
liver of bromobenzenepoisoned mice. American Journal of Pathology 129: 295-301, 1987.

Biotecnologia

SUMRIO

107

4.7 LOCALIZAO HISTOQUMICA DA PERDA DE ESTABILIDADE DE


MEMBRANA UTILIZANDO O REAGENTE EVANS BLUE
Este protocolo permite a localizao histoqumica da perda de estabilidade de membrana
(indicativo de morte celular) utilizando-se o corante Evans Blue, que penetra em clulas mortas,
marcando o tecido com pontos ou regies de cor azulada. Pode ser utilizado tanto para folhas como
razes.
Mtodo de Romero-Puertas et al. (2004)
1. Preparar uma soluo 0,25% de Evans Blue.
Dica: 0,25 g em 100 mL ou 0,50 g em 200 mL de gua Milli-Q.
2. Imergir segmentos foliares de aproximadamente 5 cm nesta soluo (ou razes).
Dica: Pode ser usada uma placa de petri.
3. Manter imerso por cinco horas em temperatura ambiente.
4. Ferver em etanol absoluto para retirar a clorofila das folhas, e assim poder visualizar as
regies demarcadas pelo Evans Blue. Amostras de razes no precisam ser fervidas.
Dica: Para retirada da clorofila pode ser utilizado uma chapa com aquecimento. Cuidar com
a fervura do etanol.
5. Aps a fervura, retirar as folhas e conservar em etanol 70% at a retirada de fotos para
registro.
Dica: Cuidado no manuseio das folhas retiradas do etanol, pois as mesmas enrolam e rasgam
com facilidade.
Referncia:
ROMERO-PUERTAS, MC; Rodrguez-Serrano M, Corpas FJ, Gmez M, Del Ro LA, Sandalio LM (2004) Cadmiuminduced subcellular accumulation of O2- and H2O2 in pea leaves. Plant, Cell and Environment 27: 1122-1134.

Biotecnologia

SUMRIO

108

4.8 LOCALIZAO HISTOQUMICA IN SITU DO ACMULO DE


RADICAL SUPERXIDO (O2-)
O mtodo de localizao histoqumica in situ do acmulo de radical superxido (O2-) em
tecidos vegetais utiliza o reagente NBT (Nitro blue tetrazolium), que reage com o radical superxido
produzindo pontos de cor azul.
Mtodo de Shi et al., (2010):
1. Preparar Tampo Fosfato de Potssio (K2HPO4), 10 mM, pH 7.8;
2. Preparar uma soluo Tampo + NBT (1 mg NBT/mL de Tampo);
Dica: preparar na hora e dissolver bem. O NBT sensvel luz, logo, seu frasco deve ficar
protegido com papel alumnio e no se deve preparar mais do que o necessrio para uso naquele
momento.
3. Imergir segmentos do tecido (no caso de folhas, em torno de 5 cm) nesta soluo;
Dica: podem ser usadas placas de petri para a imerso.
4. Manter trs horas sob iluminao forte e constante;
Dica: pode ser usada a luz de uma capela de exausto, mas importante aproximar ao
mximo as amostras da luz, para que esta seja eficiente.
5. Retirar as folhas da soluo e ferver em etanol absoluto at descolorirem por completo,
ficando esbranquiadas;
Dica: bastante cuidado ao ferver o etanol absoluto. Pode ser utilizada uma chapa com
aquecimento.
6. Retirar as folhas da fervura e conserv-las em etanol 70%.
O2-.

7. Visualizar os pontos escuros (azuis) demarcados pelo NBT que mostram a reao com o

Dica: cuidar ao manusear (fotografar na lupa, por exemplo), pois as folhas rasgam com
facilidade e tambm logo enrolam fora do etanol 70%.
Referncia:
SHI, J.; Fu, X.Z.; Peng, T.; Huang, X.S.; Fan, Q.J., Liu, J.H. 2010. Spermine pretreatment confers dehydration tolerance of
citrus in vitro plants via modulation of antioxidative capacity and stomatal response. Tree Physiology 30: 914-922.

Biotecnologia

SUMRIO

109

4.9 LOCALIZAO HISTOQUMICA IN SITU DO ACMULO DE


PERXIDO DE HIDROGNIO (H2O2)
O mtodo de localizao histoqumica in situ do acmulo de perxido de hidrognio (H2O2)
em tecidos vegetais utiliza o reagente DAB (Diaminobenzidine), que reage com o perxido de
hidrognio produzindo pontos de cor marrom.
Mtodo de Shi et al., (2010):
1. Preparar Tampo Fosfato de Potssio (K2HPO4), 10 mM, pH 7.8;
2. Preparar uma soluo Tampo + DAB (1 mg DAB/mL de Tampo, pH 3.8);
Dica: preparar na hora e misturar bem, pois o DAB no dissolve facilmente. Dependendo
do peso molecular do DAB utilizado, a quantidade de mg do mesmo pode variar em funo do
volume de Tampo. Ajustar o pH com HCl.
DAB;

3. Imergir segmentos do tecido (no caso de folhas, em torno de 5 cm) na soluo Tampo +
Dica: podem ser utilizadas placas de petri para a imerso.
4. Manter 8 horas sob iluminao forte e constante;

Dica: pode ser usada a luz de uma capela de exausto, mas importante aproximar ao
mximo as amostras da luz, para que esta seja eficiente.
5. Retirar as folhas da soluo e ferver em etanol absoluto at descolorirem por completo,
ficando esbranquiadas;
Dica: bastante cuidado ao ferver o etanol absoluto. Pode ser utilizada uma chapa com
aquecimento.
6. Retirar as folhas da fervura e conserv-las em etanol 70%.
7. Visualizar os pontos escuros (marrons) demarcados pelo DAB que mostram a reao com
o H2O2 .
Dica: cuidar ao manusear (fotografar na lupa, por exemplo), pois as folhas rasgam com
facilidade e tambm logo enrolam fora do etanol 70%.
Referncia:
SHI, J.; Fu, X.Z.; Peng, T.; Huang, X.S.; Fan, Q.J., Liu, J.H. 2010. Spermine pretreatment confers dehydration tolerance
of citrus in vitro plants via modulation of antioxidative capacity and stomatal response. Tree Physiology 30: 914-922.

Biotecnologia

SUMRIO

110

4.10 PREPARAO DO TAMPO FOSFATO DE POTSSIO


(K2HPO4) - 10 mM (0,01 M) - PH 7,8
O tampo Fosfato de Potssio necessrio para dissolver os reagentes utilizados no mtodo
de localizao histoqumica in situ de espcies reativas de oxignio. Para o ajuste de seu pH utilizase a soluo descrita abaixo:
Soluo de KH2PO4 (fosfato de potssio monobsico)
- Verificar a molaridade do KH2PO4
- Pesar o necessrio para a quantidade de mLs que se deseja preparar.
Exemplo: para preparar 500 mL (0,5 L) a 10 mM (0,01 M)
PM (g) - 1 M - 1 L
136,09 g - 1 L
X - 0,5 L (H2O destilada)
X = 136,09 g x 0,5
X = 68,05 g KH2PO4
Logo:
PM (g) - 1 M - 1 L
68,05 g - 1 M
X - 0,01 M
X = 68,05 g x 0,01
X = 0,68 g de KH2PO4 em 500 mL de H2O destilada.
Em seguida misturar at dissolver por completo e reservar.
Tampo Fosfato de Potssio K2HPO4 - 10 mM (0,01 M) - pH 7,8
- Verificar a molaridade do K2HPO4 (fosfato de potssio dibsico)
- Pesar o necessrio para a quantidade de mLs que se deseja preparar.
Exemplo: para preparar 500 mL (0,5 L) a 10 mM (0,01 M)
PM (g) - 1 M - 1 L
174,18 g - 1 L
X - 0,5 L (H2O destilada)
X = 174,18 g x 0,5
X = 87,09 g K2HPO4
Logo:
PM (g) - 1 M - 1 L
87,09 g - 1 M
X - 0,01 M
X = 87,09 g x 0,01
X = 0,87 g de K2HPO4 em 500 mL de H2O destilada.
Em seguida misturar at dissolver por completo. Medir o pH do Tampo Fosfato de Potssio
dibsico (K2HPO4) e ajust-lo com a soluo de KH2PO4 at chegar em 7,8.

Biotecnologia

SUMRIO

111

4.11 DETERMINAO DO CONTEDO DE PERXIDO DE


HIDROGNIO (H2O2)
A presena de espcies reativas de oxignio, como o H2O2, comum em qualquer ser vivo.
Porm, em quantidades elevadas podem causar danos s clulas, como peroxidao de lipdeos,
oxidao de protenas, danos aos cidos nucleicos, inibio enzimtica e aumento de morte celular.
Portanto, a determinao do seu contedo essencial para verificao do nvel de estresse oxidativo.
Mtodo de Alexieva et al.; (2001):
1. Homogeneizar as amostras (0,1 - 0,25 g) em nitrognio lquido (N2);
Dica: dependendo da quantidade de tecido, a pulverizao pode ser realizada em cadinhos
ou no prprio eppendorf.
2. Adicionar 1 mL de TCA 0,1 % e agitar no vrtex;
3. Centrifugar as amostras a 12.000 g por 15 minutos a 4oC;
Dica: lembrar-se de ligar a centrfuga refrigerada com antecedncia para que, quando for
utiliz-la, a mesma j esteja na temperatura ideal.
4. Transferir sobrenadante e seguir imediatamente para os prximos passos;
5. Reao: 0,5 mL de extrato + 0,5 mL de Tampo Fosfato 0,1 M (pH 7,0) + 2,0 mL de KI 1 M;
6. Incubar a reao no escuro por 1 hora;
7. Realizar leitura em espectrofotmetro a 390 nm;
8. Calcular a concentrao de H2O2 atravs da curva (0-100 M);
9. Calcular a razo entre o contedo de H2O2 e o peso seco.
Referncia:
ALEXIAVA,V.; Sergiev, I.; Mapelli, S.; Karanov, E. 2001. The effect of drought and ultraviolet radiation on growth and
stress markers in pea and wheat. Plant, Cell and Environment 24: 13371344.

Biotecnologia

SUMRIO

112

4.12 ANLISE DAS ENZIMAS ANTIOXIDANTES SUPERXIDO


DISMUTASE (SOD), CATALASE (CAT), E ASCORBATO PEROXIDASE
(APX)
Para sobreviver a estresses biticos ou abiticos, os organismos desenvolveram sistemas
de remoo das EROs (Espcies Reativas de Oxignio). O sistema antioxidante enzimtico de
fundamental importncia para aumentar a tolerncia da planta ao estresse. Dentre as principais
enzimas, superxido dismutase (SOD), catalase (CAT) e ascorbato peroxidase (APX) so as que
tm recebido maior ateno nesse mecanismo de proteo. Estas enzimas so especializadas na
remoo de perxido de hidrognio (H2O2). Este oxidante relativamente estvel e, pela ausncia
de cargas, tem sua passagem facilitada pela bicamada lipdica da membrana celular, o que sinaliza
para a apoptose celular. Portanto, a quantificao de tais enzimas de fundamental importncia
quando se estuda os danos celulares oxidativos causados pelo acmulo de EROs.
OBTENO DO EXTRATO ENZIMTICO BRUTO
1. PESAGEM DA MATRIA FRESCA
Pesar de 200 a 300 mg de matria fresca.
Dica: caso a pulverizao do material no seja feita no mesmo dia da coleta, deixe as amostras
em nitrognio lquido e logo armazene o material em ultrafreezer (- 80 C). Este processo muito
importante, pois no pode ocorrer degradao do material vegetal. Anote o valor do peso de cada
amostra.
2. MEIO DE EXTRAO
Preparar Mix para pulverizao.
Para 1 reao:
750 L
15 L
150 L
585 L

Tampo Fosfato de Potssio 200 mM, pH 7,8


EDTA 10 mM
cido Ascrbico 200 mM
gua Milli-Q

Dica: mantenha o Mix no gelo durante todo o processo de pulverizao do material.


3. PULVERIZAO
Pulverizar a amostra fresca com nitrognio lquido contendo PVPP (10% 0,04g) e acrescentar
1500 L do meio de extrao.
Dica: divida a alquota do tampo de extrao, desse modo com a primeira parte da alquota
contendo 750 L possvel macerar com mais facilidade a amostra e verte-la para eppendorf de 2
ml. A segunda parte da alquota pode ser utilizada para recolher o restante do material que foi
pulverizado, evitando perda excessiva do mesmo. Seja rpido e preciso na pulverizao, mantendo
sempre a amostra gelada.
4. CENTRIFUGAO
Centrifugar a 12.000 g por 20 minutos, a 4 C. Aps, coletar o sobrenadante e armazenar em
ultrafreezer (-80 C) ou no gelo at o momento das leituras.

Biotecnologia

SUMRIO

113

DETERMINAO DA ATIVIDADE ENZIMTICA


1. SUPERXIDO DISMUTASE (560 nm) - (Gianngiopolitis & Reis, 1977; Beauchamp &
Fridovich, 1971)
1 Preparar Riboflavina diluir 20 L da soluo estoque em 10 mL de gua.
Dica: utilize um becker pequeno forrado com papel alumnio. Prepare uma soluo estoque
de riboflavina 100 mM. Dilua esta soluo no dia da leitura.
Armazene a soluo estoque em eppendorf forrado com papel alumnio e em ultrafreezer.
2 Prepare o MIX para reaes em duplicata para cada amostra contendo:
Para duas reaes:
2000 L
800 L
40 L
300 L
620 L

Tampo Fosfato de Potssio 100 mM pH 7.8


Metionina 70 mM
EDTA 10 M
NBT 1 mM
H2O Milli-Q

3 Branco: Preparar um branco para o escuro (ser utilizado para zerar o espectrofotmetro e
o tubo deve ser envolto em papel alumnio) e dois brancos para a luz (que devem ser submetidos
luz, e quantificados).
Pipetar 1880 do Mix, 100 L de gua e 10 L de riboflavina.
Observao: a preparao do branco no escuro tem por objetivo subtrair da amostra que ser
iluminada o processo de reduo do NBT. O branco mantido na luz juntamente com as amostras
quantificado com o objetivo de definir uma unidade de SOD relativa quantidade de enzima
necessria para inibir 50% a mxima fotorreduo do NBT.
4 Amostras: Pipetar nos tubos de ensaio 1880 L do MIX (em duplicata por amostra), 100 L
da amostra e 20 L de riboflavina.
Agitar no vrtex e em seguida submeter os tubos iluminao intensa durante 10 minutos
junto com os dois tubos do Branco para luz (no contendo a amostra).
Aps 10 minutos na luz, transferir a soluo para as cubetas uma a uma e realizar a leitura
em espectrofotmetro a 560 nm.
Observao: programe o espectrofotmetro para uma leitura pontual.
Ateno: os tubos do Branco submetidos luz devero apresentar uma cor violeta escuro e
devem ficar mais escuros que as reaes com as amostras. A reao de cor violcea se d pois aps
10 minutos de iluminao ocorre a fotorreduo do NBT pela formazana azul.
2. CATALASE (240 nm /10 em 10 segundos / por 90 segundos) (Havir & Michale, 1987;
Anderson et al., 1995)
1 Colocar no banho-maria a 27C o tampo de incubao (contendo 500 L de tampo fosfato
de potssio 200 mM pH 7.0, 400 L de gua Milli-Q) e deixar em banho-maria durante 10 minutos.
2 Preparar 10 mL de perxido de hidrognio (H2O2), diluindo 260 L de H2O2 em 10 mL de
gua Milli-Q.
3 BRANCO: preparar uma reao para zerar o equipamento, contendo 500 L de fosfato de
potssio + 50 L de H2O2 + 450 L de H2O.

Biotecnologia

SUMRIO

114

PARA A HORA DA LEITURA


4 Pipetar no tampo de incubao em banho Maria: 37,5 L H2O, 50 L de H2O2 250 mM e
12,5 L da amostra.
Verter em cubeta de quartzo e submeter leitura em espectrofotmetro a 240 nm.
Volume final da reao 1 mL.
Observao: programe o espectrofotmetro para uma leitura cintica com durao de 90
segundos com intervalos de 10 em 10 segundos. O que deve ser observado o decrscimo na
absorbncia.
Dica: o 4 passo de leitura da enzima deve ser feito de forma rpida e precisa, pois o H2O2
desencadeia o processo de reduo pela enzima ao entrar em contato com a amostra.
3. ASCORBATO PEROXIDASE (290 nm/10 em 10 segundos / por 90 segundos) (Nakano &
Asada 1981)
1 Colocar no banho-maria a 27 C o tampo de incubao (contendo 500 L de tampo fosfato
de potssio 200 mM pH 7,0, 50 L de cido ascrbico 10 mM e 350 L de H2O) e deixar em banhomaria por 5 minutos.
2 Preparar o cido ascrbico e o H2O2:
cido Ascrbico 1 pesar 0,176 g e diluir em 10 mL de gua.
2 pegar 1 mL da soluo e diluir em 9 mL de gua Milli-Q.
H2O2 Pegar 160 L do perxido preparado para a CAT e diluir em 20 mL de gua.
3 BRANCO: preparar uma reao para zerar o equipamento, contendo 500 L de fosfato de
potssio, 50 L de cido ascrbico, 50 L de H2O2 e 400 L de H2O.
PARA A HORA DA LEITURA
4 Pipetar no tampo de incubao em banho-maria: 37,5 L de H2O, 50 L do H2O2 2 mM e
12,5 L da amostra. Verter em cubeta de quartzo e submeter leitura em espectrofotmetro a 290
nm.
Volume final da reao 1 mL.
Observao: programe o espectrofotmetro para uma leitura cintica com durao de 90
segundos com intervalos de 10 em 10 segundos. O que deve ser observado o decrscimo na
absorbncia.
Dica: o 4 passo de leitura da enzima deve ser feito de forma rpida e precisa, pois o H2O2
desencadeia o processo de reduo pela enzima ao entrar em contato com a amostra.
Referncias:
ANDERSON, M.D.; PRASAD, T.K.; STEWART, T.R. Changes in isozyme profiles of catalase, peroxidase, and
glutathione reductase during acclimation to chilling in mesocotyl of maize seedlings. Plant Physiology, v.109, p.12471257, 1995.
BEAUCHAMP, C.; FRIDOVICH, I. Superoxide dismutase: improved assays and an assay applicable to acrylamide
gels. Analytical Biochemistry, v.44, p.276-287, 1971.
GIANNOPOLITIS, I.; REIS, S.K. Superoxide dismutases: I. Occurrence in higer plants. Plant Physiology. v.59, p.309314. 1977.
HAVIR, E.A.; McHALE, N.A. Biochemical and Developmental Characterization of Multiple Forms of Catalase in
Tobacco Leaves. Plant Physiology. v.84, p.450-455. 1987.
NAKANO, Y.; ASADA, K.Hydrogen peroxide is scavenged by ascorbate specific peroxidase in spinach chloroplasts.
Plant and Cell Physiology. v.22, p. 867-880, 1981.

Biotecnologia

SUMRIO

115

4.13 TESTE DE COMETA E MICRONCLEO


Os testes de mutagenicidade e genotoxicidade in vivo e in vitro tm sido utilizados pelas agncias
reguladoras e pela comunidade cientfica para a avaliao da segurana dos novos agentes teraputicos.
Dentre os mtodos disponveis para esta avaliao, destacam-se os ensaios de cometa e microncleo. O teste
de microncleo utilizado para avaliar vrios tipos de danos ao DNA em nvel cromossmico, atuando
como uma importante ferramenta nas informaes do potencial mutagnico de agentes qumicos, fsicos e
biolgicos (Fenech, 2000). J o ensaio cometa capaz de detectar leses que so passveis de correo, alm
de informar sobre a cintica e o tipo de leso a ser reparada, embora no permita que se possa inferir

com fidedignidade no processo de reparo (Singh et al., 1988).


Teste Cometa clulas em suspenso:
Preparo das solues:
PBS (10X) = Phosphate Buffer Solution / pH 7,4
80,0 g de NaCl
2,0 g de KCl
21,7 g de Na2HPO4.7H2O (fosfato de sdio dibsico)
2,0 g de KH2PO4 (dihidrogenofosfato de potssio)
a) Em um bquer com capacidade de 1000 mL ou mais juntar todos os reagentes (NaCl, KCl,
Na2HPO4.7H2O e KH2PO4);
b) Adicionar aproximadamente 400 mL de gua destilada e dissolver os reagentes utilizando
um basto de vidro;
c) Ajustar o pH para 7,4 com NaOH 10 M;
d) Completar at 1 litro com gua destilda.
Soluo de Lise
146,1 g de NaCl (2,5 M)
37,2 g de EDTA (100 mM)
1,2 g de Tris (10 mM)
NaOH (aproximadamente 7,0 g)
a) Pesar e juntar os reagentes (NaCl, EDTA, Tris);
b) Adicionar aproximadamente 400 mL de gua destilada e mexer com o basto de vidro;
c) Adicionar parte das 7,0 g de NaOH slido e mexer com basto de vidro, caso seja necessrio,
adiciona-se o restante de NaOH (os reagentes s dissolvem com o pH prximo a 10,0);
d) Ajustar o pH entre 10,0 e 10,5;
e) Completar com gua destilada at 890 mL;
f) Guardar em temperatura ambiente, protegida da luz.
Soluo de lise (uso):
89 mL da soluo de lise (estoque)
10 mL de DMSO
1 mL de Triton X-100
Refrigerar por 60 minutos antes do uso.

Biotecnologia

SUMRIO

116

Tampo de Eletroforese (300 mM NaOH / 1 mM EDTA) pH > 13


O tampo para eletroforese formado por duas solues: A e B
SOLUO A
200 g de NaOH
500 mL de gua destilada
a) Pesar 200 g de NaOH e colocar em um bquer com capacidade para 1 litro;
b) Adicionar 500 mL de gua destilada;
c) Mexer com basto de vidro at dissolver totalmente;
d) Guardar em temperatura ambiente e, de preferncia, sem exposio luz.
SOLUO B
14,89 g de EDTA
200 mL de gua destilada
a) Pesar 14,89 g de EDTA e colocar em um bquer de 500 mL;
b) Adicionar 200 mL de gua destilada;
c) Mexer com basto de vidro at dissolver totalmente;
d) Guardar em temperatura ambiente e de preferncia sem exposio luz.
Tampo de Eletroforese (uso):
30 mL soluo A
5 mL soluo B
Adicionar gua destilada at completar 1000 mL
Tampo de neutralizao pH 7,5
48,5 g de Tris
a) Pesar 48,5 g de Tris e colocar em um bquer com capacidade para 1 L;
b) Adicionar cerca de 500 mL de gua destilada;
c) Mexer com basto de vidro at dissolver totalmente, caso seja necessrio adicionar mais
gua, porm no completar ainda para 1 L;
d) Acertar o pH com HCl 6 N para 7,5;
e) Adicionar gua destilada at completar 1 L;
f) Guardar em temperatura ambiente, protegida da luz.
Soluo fixadora (colorao com Nitrato de Prata)
150 g de cido tricloroactico (15%)
50 g de sulfato de zinco (5%)
50 mL de glicerol (5%)
a) Pesar e juntar os reagentes em um bquer com capacidade para 1 L;
b) Adicionar 500 mL de gua destilada e dissolver os reagentes;
c) Completar a soluo at 1 L de gua destilda;
d) Guardar a soluo em temperatura ambiente, protegido da luz.

Biotecnologia

SUMRIO

117

Soluo corante (estoque)


A soluo corante formada por duas solues: C e D
SOLUO C:
5 g de carbonato de sdio (5%)
a) Pesar o carbonato de sdio e colocar em um bquer com capacidade para 100 mL;
b) Adicionar cerca de 50 mL de gua destilada e dissolver o reagente;
c) Completar at 100 mL da soluo com gua destilada;
d) Guardar em temperatura ambiente, protegido da luz.
SOLUO D:
0,1 g de nitrato de amnio (0,1%)
0,1 g de nitrato de prata (0,1%)
0,25 g de cido tungstosaliclico (0,25%)
0,15 mL de formaldedo (0,15%)
a) Pesar e juntar os reagentes em um bquer com capacidade para 100 mL;
b) Adicionar cerca de 50 mL de gua destilada e dissolver os reagentes;
c) Completar at 100 mL da soluo com gua destilada.
d) Guardar em temperatura ambiente, protegido da luz.
Soluo corante (uso):
66 mL da soluo C + 34 mL da soluo D
Preparar na hora do uso!
Soluo de parada
a) Em um bquer com capacidade para 100 mL, colocar 1 mL de cido actico e 99 mL de
gua destilada.
Agarose Low Melting Point (LMP)
0,07 g de agarose Low Melting Point
10 mL de PBS (1X)
a) Pesar a agarose e colocar em um bquer com capacidade para 20 mL;
b) Adicionar 10 mL de PBS (1X);
c) Dissolver em microondas;
d) Armazenar na geladeira. Antes de ser utilizada deve ser dissolvida novamente em
microondas.
Dica: esta soluo pode ser armazenada em geladeira e ser reutilizada por at 3 vezes.
Agarose Normal Melting Point (NMP)
0,15 g de agarose Normal Melting Point
20mL de PBS (1X)
a) Pesar a agarose e colocar em um bquer com capacidade para 50 mL;
b) Adicionar 20 mL de PBS (1X);
c) Dissolver em microondas;
d) Armazenar na geladeira. Antes de ser utilizada, deve ser dissolvida novamente em microondas.
Dica: a agarose no dever ser reutilizada, pois fuses sucessivas alteram sua concentrao.

Biotecnologia

SUMRIO

118

PREPARO DAS LMINAS


1. Utilizar sempre lminas novas, de preferncia com tarja fosca;
2. Lavar cada uma com detergente (para retirar a gordura);
3. Estocar em lcool 70% dentro da geladeira at o uso;
4. Identificar as lminas no alto do canto esquerdo;
5. Em um bquer misturar a agarose e o PBS 1X e levar ao microondas at que a agarose
esteja totalmente dissolvida;
6. Mergulhar as lminas, deixando a ponta fosca de fora;
7. Escorrer em papel absorvente e tirar o excesso de gel da regio posterior da parte fosca;
8. Deixar secar em temperatura ambiente.
Dica: preparar as lminas no mnimo 6 dias antes de serem utilizadas.
PROCESSAMENTO
Dica: o processamento, corrida e colorao devem ser realizados com o mnimo possvel de
luminosidade!
1. Preparar a Soluo de Lise Final (envolver com papel laminado) e deixar 60 minutos na
geladeira, antes de iniciar o processo;
2. Envolver os tubos de coleta com papel laminado;
3. Realizar a coleta de sangue total;
4. Tratar as amostras (sangue total) com o extrato e com o controle positivo (etilmetanosulfonato EMS), em concentraes pr-determinadas;
Concentrao do agente teste
Quando o agente teste estudado desconhecido, recomenda-se que as concentraes testadas
no ultrapassem 0,01M, 5 mg/mL ou 5 l/mL (OECD, 2009).
Exemplo:
Concentrao final do EMS: 200 g/mL
Concentrao dos extratos Soluo estoque: 20.000 g/mL
Concentrao final dos extratos 200, 100, 50, e 25 g/mL
(Usar a seguinte frmula para os clculos das diluies: C1xV1 = C2xV2)
1. Pipetar 500 L de cada amostra tratada em placas contendo 24 poos;
2. Envolver a placa com papel laminado;
3. Armazenar em estufa a 37 C durante 3 horas (exposio ao agente mutagnico de 3 a 5
horas);
4. Dissolver a agarose Low Melting Point em microondas e deixar em banho Maria (40 C);
5. Pipetar 5 L de cada amostra tratada e dispensar em um microtubo;
6. Pipetar 85 L de agarose LMP e dispensar no mesmo eppendorf das amostras tratadas e, ao
mesmo tempo, repipetar a mistura;
7. Colocar a amostra na lmina com pr-cobertura, cobrindo com lamnula;
8. Colocar as lminas em cmara mida por 10 minutos na geladeira;
9. Retirar a lamnula, bem devagar, de maneira que a amostra fique na lmina;

Biotecnologia

SUMRIO

119

10. Colocar a grade com lminas na Soluo de Lise Final e deixar na geladeira por, no
mnimo, 24 horas (mximo 48 horas).
CORRIDA (somente depois de 24 horas)
1. Preparar o tampo de eletroforese por, no mnimo, 24 horas antes de iniciar a corrida e
deixar na geladeira, at a temperatura do tampo alcanar 4 C;
2. Quando a temperatura estiver em 4 C, retirar as lminas da soluo de Lise Final com o
auxlio de uma pina;
3. Secar a parte de baixo e a lateral da lmina com papel absorvente;
4. Colocar as lminas na horizontal na cuba de eletroforese, sem espao entre elas e entre as
duas colunas lminas, de maneira que fiquem com as tarjas para a direita (lado positivo);
5. Colocar gelo e gua envolta da cuba, controlando a temperatura que deve ser de 4 C;
6. Colocar o tampo de eletroforese (4 C) at cobrir as lminas e deixar por 25 minutos;
7. Aps os 25 minutos, colocar o eletrodo vermelho no lado da parte fosca da lmina, e o
eletrodo preto no lado oposto;
8. Programar a fonte de eletroforese para 25 V constantes e 300 mA (a corrente controlada
com o volume do tampo);
9. Correr durante 25 minutos;
10. Aps, retirar as lminas com o auxlio de uma pina, secando-as na lateral e na regio
posterior da parte fosca;
11. Colocar as lminas na grade e cobri-las com tampo de neutralizao durante 5 minutos
(repetir 3X).
COLORAO
1. Depois, lavar 2X com gua destilada;
2. Deixar secar por, no mnimo, 2 horas a 37 C na estufa (por mais tempo se for em
temperatura ambiente);
3. Fixar por 10 minutos na soluo fixadora (depois de usar, recolocar no frasco mbar);
4. Lavar 3X com gua destilada;
5. Deixar secar por, pelo menos 5 horas a temperatura ambiente, ou por 1,5 horas a 37 C na
estufa;
6. Reidratar os gis por 5 minutos em gua destilada;
7. Corar as lminas (colocadas na grade de vidro, costa-a-costa) por 30 minutos utilizando a
soluo corante que deve ser preparada na hora, com agitao no escuro;
8. Lavar as lminas 3X com gua destilada;
9. Colocar as lminas na soluo de parada por 5 minutos;
10. Lavar as lminas 3X com gua destilada;
11. Deixar secar em temperatura ambiente.
ANLISE
Em microscpio ptico, analisar 100 ncleos em aumento de 100X. Classific-los de 0 a 4.
Obter escore de 0 a 400 para cada amostra.

Biotecnologia

SUMRIO

120

Teste Cometa clulas em adeso:


PREPARO DAS SOLUES
Meio DMEM
1000 mL gua Milli-Q autoclavada;
8,6 g DMEM ou meio de cultura especfico para a linhagem celular em uso
1,2 g NaHCO3
0,1 g Penicilina
0,06 g Estreptomicina
Ajustar o pH para 7,3 antes de filtrar o meio
Esterilizar: realizar a filtrao do meio com filtro 0,22 m
Soluo de Hanks (1L)
1000 mL gua Milli-Q autoclavada;
1 embalagem de Hanks em p;
1,8 g de NaHCO3 (bicarbonato de sdio)
Realizar a filtrao da soluo de Hanks com filtro 0,22 m
Obs.: as demais solues descritas no protocolo para clulas em suspenso devem ser
preparadas para a realizao deste ensaio.
PREPARO DAS LMINAS
1. Utilizar sempre lminas novas, de preferncia com tarja fosca;

Biotecnologia

SUMRIO

121

2. Lavar cada uma com detergente (para retirar a gordura);


3. Estocar em lcool 70% dentro da geladeira at o uso.
PROCESSAMENTO
Cultura das clulas
a) Fazer a contagem das clulas CHO-k1;
b) Transferir para frascos de cultura com meio de cultura (DMEM + HAM F-10);
Dica: podem ser utilizadas placas de cultura de 6 poos ao invs de frascos de cultura.
c) Incubar overnight na estufa a 37 C com 5% CO2;
d) Aps este perodo, tratar as amostras com o extrato e com o controle positivo (etilmetanosulfonato EMS), em concentraes pr-determinadas;
e) Incubar por 3 horas na estufa a 37 C com 5% CO2;
f) Retirar o meio de cultura das garrafas de cultura;
g) Lavar com 2 mL de soluo de Hanks (repetir este processo 2 vezes);
h) Adicionar 1 mL de tripsina-EDTA no frasco de cultura;
i) Colocar a frasco de cultura por 3 minutos na estufa a 37 C para desprendimento das
clulas;
j) Preparar meio de cultura completo (10% SBF) em um tubo falcon;
k) Passados 3 minutos, verificar por meio de microscopia se as clulas esto soltas;
l) Certificado o desprendimento das clulas, injetar 3 mL de meio completo para inativar a
tripsina-EDTA;
m) Descartar o meio com o restante da tripsina-EDTA e adicionar novo meio de cultura
completo nos frascos com as clulas;
n) Dissolver a agarose Low Melting Point em microondas e deixar em banho Maria (40 C);
o) Pipetar 5 L de cada amostra tratada e dispensar em um eppendorf;
p) Pipetar 85 L de agarose LMP e dispensar no mesmo eppendorf das amostras tratadas e, ao
mesmo tempo, repipetar a mistura;
q) Colocar a amostra na lmina com pr-cobertura, cobrindo com lamnula;
r) Colocar as lminas em cmara mida por 10 minutos na geladeira;
s) Retirar a lamnula, bem devagar, de maneira que a amostra fique na lmina;
t) Colocar a grade com lminas na Soluo de Lise Final e deixar na geladeira por no mnimo
24 horas (mximo 48 horas).
Obs.: aps esse processo, segue-se o protocolo anterior a partir do item CORRIDA.
Teste de Microncleo clulas em suspenso:
PRODUTOS UTILIZADOS
- Soro bovino fetal (contm substratos para o meio);
- RPMI 1640 (meio de cultura especfico para linfcitos T);
- Fitohemaglutinina (induz a diviso dos linfcitos T em G0);
- Formalina 1% (conserva amostras biolgicas);
- Citrato de Sdio 1% (estabiliza protenas);

Biotecnologia

SUMRIO

122

- Fixador Carnoy (retirar os resduos da amostra - hemcias e fixar) 3 metanol/1 cido


actico;
- Padro Etil-metanosulfonato EMS;
- Citocalasina B (interrompe a citocinese durante a anfase);
PREPARO DAS SOLUES
Citocalasina (Soluo Me) - (2 mg/ml):
- No prrpio frasco comercial, acrescenta-se 5 mL de DMSO a 10 mg de Citocalasina B;
- Armazenar no congelador.
Citocalasina (Soluo de Uso) (4 g/ml):
-Acrescenta-se 9,5 mL de Meio RPMI 1640 a 0,5 mL de Soluo Me em tubo estril;
-Armazenar na geladeira.
PBS (10X) = Phosphate Buffer Solution / pH 7,4
80,0 g de NaCl
2,0 g de KCl
21,7 g de Na2HPO4.7H2O (fosfato de sdio dibsico)
2,0 g de KH2PO4 (dihidrogenofosfato de potssio)
a) Em um bquer com capacidade de 1000 mL ou mais juntar todos os reagentes (NaCl, KCl,
Na2HPO4.7H2O e KH2PO4);
b) Adicionar aproximadamente 400 mL de gua destilada e dissolver os reagentes utilizando
um basto de vidro;
c) Ajustar o pH para 7,4 com NaOH 10 M;
d) Completar at 1 litro com gua destilda.
Soluo de Giemsa (colorao da amostra)
20% em PBS
Meio de Cultura RPMI 1640 Meio Incompleto
10 g meio RPMI 1640
10 mg Estreptomicina
100 Unidades/mL ou 5 mg 10 x 106 U Penicilina
1000 mL H2O destilada ou Milli-Q.
a) Em vidraria preferencialmente esterilizada colocar todos os compostos e dissolver sob
agitatao;
b) Medir o pH e ajustar com HCl 1N ou NaOH 1N at que o pH chegue a 7,3;
c) Na Cabine de Segurana Biolgica filtrar o meio usando membrana de Millipore (0,02 m)
estril e verificar o pH novamente.
d) Armazenar em frascos estreis de 250 mL identificados com: nomes do meio e do
responsvel, data fabricao e pH.
Obs.: congelar os frascos em estoque a 20 C.

Biotecnologia

SUMRIO

123

Dica: recomenda-se que o pH fique em torno de 7.25, pois aps a filtrao o pH pode elevar.
Meio de Cultura RPMI 1640 Meio Completo
78% Meio RPMI 1640 Incompleto
20% Soro Bovino Fetal (SFB)
2% Fitohemaglutinina A
a) Em um frasco estril adicionar o meio, soro bovino fetal e fitohemaglutinina A e aps
homogeneizar;
Dica: Preparar o meio completo somente no momento do uso.
PREPARO DAS LMINAS
1. Utilizar sempre lminas novas, de preferncia com tarja fosca;
2. Lavar cada uma com detergente (para retirar a gordura);
3. Estocar em lcool 70% dentro da geladeira at o uso.
* Sempre iniciar o cultivo em segunda-feira ou tera-feira (DIA 0)
PROCESSAMENTO
DIA 0 Cultura das clulas
a) Coletar a amostra de sangue (5 mL) em tubo heparinizado;
b) Retirar da geladeira 20 minutos antes do incio da cultura, o SBF, a Fitohemaglutinina e o
meio RPMI 1640;
c) Limpar a capela de fluxo laminar com lcool 70%;
d) Colocar na capela todos os materiais que sero utilizados na cultura das clulas em
suspenso;
e) Ligar a lmpada UV por 20 minutos;
f) Desligar a UV, e ligar o exaustor e lmpada fria;
g) Colocar na capela, limpando frasco com lcool 70% antes, o SBF, a Fitohemaglutinina, o
meio RPMI 1640 e as amostras de sangue coletado;
h) Adicionar 500 uL de sangue total em frascos ou placas de 12 poos contendo 5 mL de meio
completo;
i) Incubar na estufa a 37C.
DIA 1: 24 horas aps o preparo da amostra
a) Tratamento das amostras (sangue total) com o extrato e com o controle positivo (Etilmetanosulfonato EMS), em concentraes pr-determinadas;
Concentrao do EMS: 200 g/mL
Concentrao dos extratos Soluo estoque: 20.000 g/mL
Concentrao dos extratos: 200, 100, 50, e 25 g/mL
(Usar a seguinte frmula para os clculos das diluies: C1xV1 = C2xV2)
b) Recolocar as amostras na estufa a 37 C.
Obs.: o tratamento com agentes mutagnicos dever ser inserido na cultura de acordo com o
protocolo adotado. Para maiores detalhes, ver protocolo da OECD.

Biotecnologia

SUMRIO

124

Tabela 1. Incubao da cultura celular


0h

24 h

44 h

48 h

Incubar a
37C

Homogeneizar

Adicionar CtB

72 h
Coletar ou
prosseguir a
incubao

96 h
Coletar

Obs.: os agentes testes devero ser adicionados na cultura conforme protocolo abaixo.

Concentrao do agente teste


Quando o agente teste estudado desconhecido, recomenda-se que as concentraes testadas
no ultrapassa 0,01M, 5 mg/mL ou 5 l/mL (OECD, 2009).
Protocolo de tratamento por induo de agente teste.
Tabela 2. Protocolo de tratamento das clulas e colheita para o ensaio do MN in vitro.
Linfcitos e
Clulas de
linhagem
celular,
tratadas com
CtB.

Tratamento por 3-6 horas;


remove a substncia do meio e
adiciona novo meio e CtB.
Tratar por 1,5-2,0 ciclos celulares
na presena da CtB.
Exposio Longa Tratar por 1,5-2,0 ciclos celulares
removendo a substncia teste e
aps adicionar novo meio e a CtB.
Exposio Curta

Coletar aps 1,5-2,0 ciclos


celulares.
Coletar no final do perodo
de exposio.
Coletar aps 1,5-2,0 ciclos
celulares.

Adaptado da OECD 487/2010.

DIA 2: 44 horas aps o preparo da amostra


a) Adicionar de 3-6 g de CtB/mL;
b) Recolocar as amostras na estufa a 37C at completar 72 horas ou 96 horas, dependendo
do protocolo utilizado.
DIA 3 OU 4 (depende do protocolo de tratamento a ser utilizado): 72 ou 96 horas aps o preparo
das amostras
COLETA DAS CLULAS
a) Aps o final da incubao (72 h ou 96 h), colocar a Formalina 1% e o Citrato de Sdio 1%
no banho Maria a 37 C;
b) Transferir o contedo dos frascos ou placas de 12 poos (meio + clulas) em tubo cnico de
aproximadamente 10 mL com tampa e devidamente identificados;
c) Centrifugar a 1.500 rpm por 7 minutos, cuidando o balanceamento;
d) Enquanto centrifuga, preparar para cada amostra:
- Identificar um tubo cnico de plstico e uma pipeta de Pasteur de plstico;
- Preparar fixador Carnoy: mdia de 26 mL de fixador para cada amostra.
a) Ao trmino da centrifugao, descartar o sobrenadante com auxlio de pipeta de Pasteur;
b) Adicionar 4 gotas de Formalina 1% em cada amostra;
c) Agitar cada amostra com o vrtex;
d) Colocar as amostras em banho Maria a 37 C por 5 minutos;
e) Adicionar 4 mL de Citrato de Sdio 1%;

Biotecnologia

SUMRIO

125

f) Logo em seguida, ressuspender com a pipeta de Pasteur especfica da amostra;


g) Colocar as amostras no banho Maria a 37 C por 7 minutos;
h) Adicionar 0,5 mL de fixador Carnoy;
i) Em seguida, ressuspender com a pipeta de Pasteur especfica da amostra;
j) Centrifugar a 1.500 rpm por 7 minutos;
k) Desprezar o sobrenadante com a pipeta de Pasteur;
l) Adicionar 5 mL de fixador e ressuspender (adicionar e ressuspender uma amostra aps a
outra);
m) Centrifugar a 1.500 rpm por 7 minutos;
n) Desprezar o sobrenadante com a pipeta de Pasteur;
o) Estocar em congelador ou geladeira por, no mnimo, 15 minutos;
p) Durante este tempo, realizar a preparao das lminas:
- Retir-las do lcool 70%;
- Coloc-las dispostas em cubetas, sob gua corrente da torneira, para remover o lcool;
- Remover toda a gua da torneira e preencher a cubeta com gua destilada.
a) Retirar as amostras da geladeira, centrifugar a 1.500 rpm por 7 minutos e desprezar o
sobrenadante;
b) Adicionar 5 mL de fixador e ressuspender;
c) Centrifugar a 1.500 rpm por 7 minutos e desprezar o sobrenadante;
Dica: se necessrio, realizar essas lavagens at a amostra obter aparncia lmpida, clara e
translcida.
a) Na ltima lavagem, ao desprezar o sobrenadante cuidar para manter aproximadamente 1
mL (2 dedos);
b) Ressuspender a amostra, contendo agora, apenas 1 mL.
Dica: esse material pode ficar estocado no freezer, desde que tampado com rolhas e
identificado.
COLORAO
a) As lminas devem ser retiradas das cubetas contendo gua destilada com pina, deixando
a parte superior molhada (barriguinha de tenso superficial);
b) Pingar na lmina 3 a 4 gotas do material na vertical, utilizando pipeta de Pasteur de
plstico;
c) Deixar secar em temperatura ambiente, sob papel absorvente;
d) Preparar a soluo de Giemsa a 20% em Tampo PBS;
e) Preencher toda a lmina com a soluo de Giemsa 20%;
f) Deixar agir por 5 min (mximo 7 min);
g) Desprezar o corante em gua corrente abundante;
h) Desprezar o excesso de gua batendo a lmina lateralmente em papel absorvente;
i) Deixar secar em temperatura ambiente;
j) Quando secas, observar, no microscpio, se as lminas esto boas para a anlise.

Biotecnologia

SUMRIO

126

ANLISE
Critrios para seleo das clulas
Analisar 1000 clulas binucleadas/lmina em aumento de 1000 vezes com as seguintes
caractersticas: ncleos intactos e tamanhos aproximadamente iguais, ncleos com o mesmo
padro de colorao e dentro do limite citoplasmtico, membrana celular intacta, clula claramente
distinguvel das clulas adjacentes.
Caractersticas do microncleo
Morfologia idntica dos ncleos principais; dimetro entre 1/16 at, no mximo de 1/3 dos
ncleos principais; mesma colorao dos ncleos; no estar ligado ou conectado a um dos ncleos
principais e nem sobreposto.
Parmetros considerados na anlise
- Nmero de clulas binucleadas;
- Distribuio de clulas binucleadas com 0, 1, 2, 3 ou mais MNs em 1000 clulas binucleadas;
- Nmero total de microncleos nas clulas binucleadas;
- Frequncia de MNs/1000 clulas binucleadas;
- Frequncia de clulas binucleadas/500 clulas viveis;
- ndice de Diviso nuclear (IDN)
IDN = [M1+ 2 (M2) + 3 (M3) + 4 (M4)] /N
M1- M4 = n de clulas com 1, 2, 3 e 4 ncleos.
N = n total de clulas viveis.
Teste de Microncleo clulas em adeso:
PRODUTOS UTILIZADOS
- Tripsina-EDTA;
- Soro Bovino Fetal;
- Formalina 1%;
- Citrato de Sdio 1%;
- Fixador Carnoy 3 metanol/1 cido actico;
- Citocalasina B (4 g/mL);
- Soluo de Giemsa (20% em PBS).
PREPARO DAS SOLUES
Meio DMEM + HAM F10: para linhagem CHO-K1
1000 mL gua Mili-Q autoclavada;
8,656 g DMEM + 4,9 g HAM F10
1,2 g NaHCO3 (bicarbonato de sdio)
0,1 g Penicilina
0,06 g Estreptomicina

Biotecnologia

SUMRIO

127

Ajustar o pH para 7,3 antes de filtrar o meio


Realizar a filtrao do meio com filtro 0,22 m
Soluo de Hanks
1000 mL gua Mili-Q autoclavada;
1 embalagem de Hanks em p;
1,8 g de NaHCO3 (bicarbonato de sdio)
Realizar a filtrao da soluo de Hanks com filtro 0,22 m
PREPARO DAS LMINAS
1. Utilizar sempre lminas novas, de preferncia com tarja fosca;
2. Lavar cada uma com detergente (para retirar a gordura);
3. Estocar em lcool 70% dentro da geladeira at o uso.
PROCESSAMENTO
DIA 0 Cultura das clulas
a) Fazer a contagem das clulas CHO-K1;
b) Transferir para frascos de cultura com meio de cultura (DMEM + HAM F-10);
Dica: podem ser utilizadas placas de cultura de 6 poos ao invs dos frascos.
c) Incubar overnight na estufa a 37 C com 5% CO2.
DIA 1
d) Tratar as amostras com o extrato e com o controle positivo (Etil-metanosulfonato EMS),
em concentraes pr-determinadas;
Concentrao final do EMS: 200 g/mL
Concentrao dos extratos Soluo estoque: 20.000 g/mL
Concentrao final dos extratos: 200, 100, 50, e 25 g/mL
(Usar seguinte frmula para os clculos das diluies: C1xV1 = C2xV2)
e) Incubar por 24 h na estufa a 37 C com 5% CO2
DIA 2
f) Retirar o meio de cultura das garrafas de cultura;
g) Lavar com 2 mL de soluo de Hanks (repetir esse processo 2 vezes);
h) Adicionar 1 mL de tripsina-EDTA no frasco de cultura;
i) Colocar a frasco de cultura por 3 minutos na estufa a 37 C para desprendimento das
clulas;
j) Preparar meio de cultura completo (10% SBF) em um tubo falcon;
k) Passados 3 minutos, verificar atravs de microscopia se as clulas esto soltas;
l) Certificado o desprendimento das clulas, injetar 3 mL de meio completo (DMEM+F10+SBF)
para inativar a tripsina;
m) Coletar as clulas e passar para tubos falcon;

Biotecnologia

SUMRIO

128

n) Centrifugar 1.000 rpm por 5 min;


o) Descartar o sobrenadante;
p) Ressuspender o pellet lentamente e delicadamente 10 vezes;
q) Adicionar 5 mL de Citrato de Sdio 1% gelado;
r) Ressuspender o material 10 vezes delicadamente com o citrato de Na+;
s) Aguardar 15 segundos;
t) Adicionar 5 mL de Fixador (3 metanol:1 cido actico) e 4 gotas de formaldedo;
u) Ressuspender 30 vezes delicadamente;
v) Centrifugar 1.000 rpm por 5 mim;
w) Descartar o sobrenadante;
x) Ressuspender 30 vezes;
y) Centrifugar a 1.000 rpm por 5 mim;
z) Repetir os passos t a x novamente, sem o formaldedo;
aa) Manter aproximadamente 1 mL do sobrenadante (2 dedos);
bb) Ressuspender a amostra, contendo agora, apenas 1 mL.
Dica: esse material pode ficar estocado no freezer, desde que tampado com rolhas e
identificado.
PREPARO DAS LMINAS
a) Retir-las do lcool 70%;
b) Coloc-las dispostas em cubetas, sob gua corrente da torneira, para remover o lcool;
c) Remover toda a gua da torneira e preencher a cubeta com gua destilada.
Obs.: aps este processo, segue-se o protocolo para teste de microncleo (clulas em
suspenso) a partir do item COLORAO.
Referncias:
FENECH, M. 2000. The in vitro micronucleus technique, Mutation Research, 455: 81-95.
OECD. OECD GUIDELINE FOR THE TESTING OF CHEMICALS.DRAFT PROPOSAL FOR A NEW
GUIDELINE 4: In Vitro Mammalian Cell Micronucleus Test, 487, 2009. Disponvel em: http://www.oecd.org/
dataoecd/45/51/43996258.pdf
SINGH,N.P.; Mccoy, M.T.; Tice, R.R.; Schneider, E.L. 1988. A simple technique for quantification of low levels of DNA
damage in individual cells, Experimental Cell Research, 175: 184191.

Biotecnologia

SUMRIO

129

4.14 ANLISE DE CITOTOXICIDADE POR ALAMAR BLUE


Os ensaios de citotoxicidade foram um dos primeiros bioensaiosin vitroutilizados para
prever toxicidade de substncias a vrios tecidos. Vrios mtodos in vitro, para avaliar a toxicidade
de diferentes amostras so padronizados utilizando-se culturas celulares. O ndice de citotoxicidade
(IC) pode ser avaliado por meio do alamar blue (AB) ou resazurina que um indicador de
oxirreduo e da funo mitocondrial, sendo reduzido apenas por clulas viveis a resorufina
(lils), conforme Al-Nasiry et al. (2007). O AB tem sido utilizado como ferramenta efetiva para
avaliar a atividade metablica e proliferao de linhagens celulares.
Para realizao do experimento, utilizar os seguintes materiais e reagentes:
* Controle positivo: Doxorubicina
* Clulas da linhagem CHO-K1 2,0 x 104 clulas/poo/200 L;
* 20L de alamar blue a 10% (ex: 180 L de meio + 20L de Alamar blue);
* Meio de cultura para clulas DMEM + HAM-F10 suplementados com SBF 10%;
* Leitor de placa com filtros para os comprimentos de onda 540 e 630 nm.
* DMSO
* Placa para cultura de clulas em poliestireno com 96 poos TPP
* TPP Frasco (garrafa) em poliestireno de alta transparncia
1. Cultivar as clulas CHO-K1 em frascos de cultivo celular, em meio DMEM+HAM-F10,
suplementado com 10% de soro bovino fetal (SBF), antibiticos estreptomicina (0,1 mg/mL),
penicilina (0,06 mg/mL), bicarbonato (1,8 mg/mL) e mantidas a 37 C e 5% de CO2 at atingir
confluncia de 80% - 90 %.
2. A cultura celular, aps adquirir semiconfluncia, dever ser lavada com a soluo tampo
Hanks ou PBS, tripsinizada e contadas em cmara de Neubauer, ajustando o nmero de clulas
para 2,0x104 clulas/poo/200 L em meio de cultura suplementado com SBF;
3. Realizar a semeadura das clulas em placas de 96 poos (triplicata) e incubar a 37 C e 5%
de CO2 por 4 horas;
4. Realizar a pesagem das amostras e prepar-las;
5. A amostra poder ser diluda em DMSO estril (soluo estoque) e as diluies consecutivas
sero realizadas em meio de cultura completo;
Dica: a concentrao final de DMSO no dever ultrapassar 1% devido toxicidade, e deve
ser constante em todas as amostras.
6. Concentrao da Doxorubicina no experimento: 100, 10, 1, 0.1, 0.01 M.
7. Retirar a placa da estufa e remover o meio de cultura;
8. As clulas devero ser novamente lavadas com 100 L de PBS;
9. Adicionar as amostras s clulas e incubar por 72 horas (tempo determinado sob condies
pr-determinadas) em estufa a 37 C e 5% CO2.
- Controle positivo: (clulas + Doxorubicina + DMSO)
- Controles negativos: (clulas em meio)
(clulas em meio + DMSO)
- Amostras (clulas em meio + amostra em diferentes concentraes + DMSO)
Retirar as substncias adicionadas s clulas e adicionar o reagente alamar blue a 10% em
meio de cultura incompleto (sem SBF), com volume final de 200 L;

Biotecnologia

SUMRIO

130

Dica: Proteger a placa com papel alumnio e incubar em estufa a 37oC


Aproximadamente, aps 4 a 5 horas verificar a reduo do Alamar Blue nos controles
negativos (colorao rsea);
Realizar a leitura nos comprimentos de onda de 540 nm (oxidado) e 630 nm (reduzido)
A porcentagem de azul de alamar reduzido calculada utilizando-se a equao:
% reduo = AO (AR x RO) x 100 onde:
AO = absorbncia do estado oxidado;
AR = absorbncia do estado reduzido;
RO = razo AOO /ARO;
AOO = absorbncia do meio sozinho subtrado do meio com alamar blue em 540 nm;
ARO = absorbncia do meio sozinho subtrado do meio com alamar blue em 630 nm;
Referncias:
AL-NASIRY, S.; Geusens, N.; Hanssens, M.; Luyten, C.; Pijnenborg, R. 2007. The use of Alamar Blue assay for
quantitative analysis of viability, migration and invasion of choriocarcinoma cells. Human Reproduction. 22(5):1304309.
FRESHNEY, R.I. Culture of Animal Cells, a Manual of Basic Technique, 5th Ed. Hoboken
NJ, John Wiley & Sons, 2005.
NAKASHIMA, T.; Tamura, T.; Kurachi, M.; Yamaguchi, K.; Oda, T. 2005. Apoptosis-Mediated Cytotoxicity of
Prodigiosin-Like Red Pigment Produced by -Proteobacterium and Its Multiple Bioactivities. Biol. Pharm. Bull. 28(12):
2289-295.

Biotecnologia

SUMRIO

131

4.15 AVALIAO DA PROLIFERAO CELULAR PELO MTT


A proliferao celular pode ser avaliada pela tcnica do MTT (dimettylthiazoldiphenyltetrazolium bromide) (Mosmann, 1983). O MTT um sal tetrazolium reduzido a formazan
pelo sistema mitocondrial succinato-tetrazolium redutase. A proliferao das clulas resulta em
um aumento da atividade do sistema mitocondrial que conduz a um aumento na quantidade de
formazan formado. A colorao produzida nessa reao medida por densidade ptica, sendo
diretamente proporcional ao nmero de clulas viveis na placa.
1. Preparar o reagente MTT na concentrao de 5 mg/mL de PBS (phosphate buffered saline)
pH 7,2.
Dica: utilizar o banho ultrassnico para diluir o MTT.
Preparo do PBS: Pesar 1,120 g de Na2HPO4 ou 1,63 g de Na2HPO47(H2O), 9 g de NaCl, 0,2 g
de KH2PO4 e 0,2 g de KCl. Dissolver os sais em parte da gua Milli-Q (500 mL) em agitador. Ajustar
o pH para 7,4 e completar o volume para 1 litro. Autoclavar.
2. Com as clulas cultivadas em placas de 24 poos com 500 L de meio de cultura por poo,
retirar 50 L do meio de cultura das placas e adicionar 50 L do MTT.
3. Incubar as clulas por 4 horas a 37oC.
4. Aspirar o meio de cultura das placas.
5. Adicionar 100 L de DMSO por poo.
6. Transferir o contedo para placa de 96 poos para fazer a leitura em ELISA no comprimento
de onda de 540 nm
Dica: fazer um grupo branco para a leitura (apenas com DMSO).
Referncia:
MOSMANN, T. (1983). Rapid colorimetric assay for cellular growth and survival: application to proliferation and
cytotoxicity assays. J Immunol Methods 65(1-2): 55-63.

Biotecnologia

SUMRIO

132

4.16 OXIDAO DE H2DCF-DA PARA AVALIAO DE ESPCIES


REATIVAS DE OXIGNIO INTRACELULARES
Este protocolo se baseia na deteco da molcula fluorescente DCF (2,7-diclorofluoresceina
fluorescente), a qual gerada como produto da clivagem e oxidao da molcula no fluorescente
H2DCF-DA (2,7-diclorodiidrofluorescena diacetato). O composto gerado (DCF) fica retido no
ambiente intracelular e emite fluorescncia verde, que pode ser mensurada por microscopia de
fluorescncia ou citmetro de fluxo. Assim, quanto maior a fluorescncia verde medida, maior a
quantidade de espcies reativas de oxignio (EROs) intracelular.
Mtodo de Keston et al. (1965)
Protocolo referente placa de 24 poos; os volumes podem ser ajustados de maneira
diretamente proporcional, conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
1. Retirar o meio de cultura e lavar as clulas com 300 mL de CMF 1x
Dica: CMF-BSS = Soluo Salina Fosfato-tamponada Livre de Clcio e Magnsio. uma
soluo salina muito semelhante ao PBS 1x, porm tamponada e livre de Ca2+ e Mg2+, o que facilita
a atividade da tripsina em soltar as clulas da placa de cultura.
Dica 2: CMF 10 x = Nacl 40 g; KCl 2 g; Na2HPO4 0,24 g; KH2PO4 0,75 g; Na2SO4 0,5 g; H20
destilada autoclavada - 500 mL q.s.p. Ajustar o pH para 7.4 e autoclavar. Diluir antes do uso.
2. Remover gentilmente o CMF e adicionar 150 L de tripsina aos poos, colocando a placa
na estufa a 37 C por 2-5 minutos
Dica: o tempo de tripsinizao varia de acordo com o tipo celular; clulas muito aderentes
requerem tempo maior de incubao (5 minutos). No aconselhvel exceder 5 minutos de
tripsinizao, sob pena de reduo de viabilidade celular.
3. Neutralizar a tripsina com 300 L de meio de cultura contendo Soro Fetal Bovino e
homogeneizar (up and down) aproximadamente 10 vezes, e passar o volume para um ependorfe
de 1,5 mL
Dica: Up and down fundamental para uma dissociao eficiente das clulas; citmetros
de fluxo que utilizam capilar como clula de leitura sofrem entupimento quando h a presena de
agregados celulares.
4. Centrifugar 5 minutos a 1.500 rpm, seguido da remoo do sobrenadante
Dica: pode-se descartar o sobrenadante tanto por meio do uso de pipeta quanto vertendo
diretamente o lquido, sem agitao.
5. Ressuspender o pellet celular com CMF 1x e centrifugar a 1.500 rpm por 5 minutos
6. Ressuspender o pellet celular com 300 L de CMF1x + DCFH 10 mM e incubar por 30
minutos a 37 C
Dica 1: DCFH 10 mM (soluo de trabalho) - 0,001 g de DCFH em 200 L de DMSO. Esta
soluo dever ser armazenada a -20 C, protegida da luz. A estabilidade mdia de 2 a 6 meses.
Dica 2: o ideal fazer um mix total (com o volume final a ser utilizado no experimento).
importante sempre calcular esse volume considerando n poos + 1. Por exemplo, para 24 poos
sero necessrios 7,5 mL de CMF 1x + 7,5 L de DCF 10 mM.
7. Centrifugar a 1.500 rpm por 5 minutos
8. Ressupender o pellet em 200 L de CMF 1x 37 C e realizar a leitura no citmetro de fluxo

Biotecnologia

SUMRIO

133

Dica: o volume de CMF no qual o pellet dever ser ressuspenso varia de acordo com o tipo
de citmetro a ser utilizado. Em citmetro com leitor de placa de 96 poos deve-se ressuspender em
150 - 200 L, enquanto para leitura em tubo deve-se ressuspender em volume de 200 - 400 L.
Referncias:
KESTON AS, Brandt R. (1965) The fluorometric analysis of ultramicro quantities of hydrogen peroxide. Anal.
Biochem. 11: 1-5.
MYHRE O, Andersen J, Aarnes H, Fonnum F (2003) Evaluation of the probes 2,7-dichlorofluorescin diacetate,
luminol, and lucigenin as indicators of reactive species formation. Biochem. Pharmacol. 65: 1575-1582.

Biotecnologia

SUMRIO

134

4.17 MARCAO COM IODETO DE PROPDEO PARA


DETERMINAO DA DISTRIBUIO DO CICLO CELULAR
O presente protocolo baseia-se na marcao estequiomtrica do DNA celular com Iodeto de
Propdeo (IP), o qual intercala na dupla fita de DNA e emite fluorescncia vermelha correspondente
quantidade de DNA presente na clula. Clulas em fase G2/M apresentam o dobro de
fluorescncia vermelha do que clulas em fase G1, enquanto clulas em fase S emitem fluorescncia
intermediria. Esta marcao tambm permite a determinao de clulas que sofreram perda de
DNA (em evento de morte celular apopttica, por exemplo), as quais emitem fluorescncia com
intensidade inferior s clulas de fase G1, sendo por isso denominadas como sub-G1, bem como
clulas hiperdiploides, que emitem nveis de fluorescncia superiores s clulas de fase G2/M.
Mtodo de Krishan et al. (1975)
Protocolo referente placa de 12 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 2x maiores;
placas de 24 poos = metade dos volumes).
1. Plaquear 4 x 103 clulas em placa de 12 poos e realizar o tratamento de interesse.
1x.

2. Retirar o meio de cultura para um ependorfe de 2 mL e lavar as clulas com 600 mL de PBS

Dica: PBS 10x - Nacl 80 g; KCl 2 g; NaHPO4 14,4 g; KH2PO4 2,4 g; H20 destilada autoclavada 1000 mL q.s.p. Ajustar o pH para 7,4 e autoclavar. Diluir antes do uso.
3. Remover gentilmente o PBS para dentro do mesmo eppendorf de 2 mL onde o meio de
cultura foi acondicionado e adicionar 250 L de tripsina aos poos, colocando a placa na estufa a 37
C por 2-5 minutos.
Dica: o tempo de tripsinizao varia de acordo com o tipo celular; clulas muito aderentes
requerem tempo maior de incubao (5 minutos). No aconselhvel exceder 5 minutos de
tripsinizao, sob pena de reduo de viabilidade celular.
4. Neutralizar a tripsina com 500 L de meio de cultura contendo Soro Fetal Bovino
e homogeneizar (up and down) aproximadamente 10 vezes, e passar o volume para o mesmo
ependorfe de 2 mL onde o meio de cultura e o PBS foram guardados.
Dica: Up and down fundamental para uma dissociao eficiente das clulas; citmetros
de fluxo que utilizam capilar como clula de leitura sofrem entupimento quando h a presena de
agregados celulares.
5. Centrifugar 5 minutos 1.500 rpm, seguido da remoo do sobrenadante.
Dica: pode-se descartar o sobrenadante tanto por meio do uso de pipeta quanto vertendo
diretamente o lquido, sem agitao.
6. Ressuspender o pellet celular com 1 mL de PBS 1x e centrifugar a 1.500 rpm por 5 minutos
7. Centrifugar 5 minutos a 1.500 rpm.
8. Fixar as clulas com 1 mL de etanol 70% (em PBS 1x) gelado, gotejando-o enquanto as
clulas so agitadas no vrtex.
Dica: deve-se deixar fixando por pelo menos 30 minutos a 4 C (ideal: aproximadamente
2 horas); pode-se parar aqui e guardar as clulas por at 3 meses a -20 C at que o ensaio seja
realizado.
9. Centrifugar por 6 minutos a 1.500 rpm.

Biotecnologia

SUMRIO

135

10. Suspender o pellet em 1 mL de PBS 1x e centrifugar por 6 minutos a 1.500 rpm.


11. Ressuspender o pellet celular em 200 L de PSSI incubar, no mnimo, por 15 minutos a
37 C ou 30 minutos a temperatura ambiente.
Dica 1: PSSI - 1,4 L de Triton X-100 1%; 20 L de RNAse (20 mg); 60 L de Iodeto de Propdeo
2 mg/mL; 10 mL q.s.p. de PBS 1x.
Dica 2: pode-se guardar no escuro por no mximo 1 semana.
12. Leitura no citmetro de fluxo.
Referncias:
KISHAN A (1975) Rapid flow cytofluorometric analysis of mammalian cell cycle by propidium iodide staining. J. Cell
Biol. 66: 188-193.
NUNEZ R (2001) DNA measurement andcell cycle analysisby flow cytometry. Curr. Issues Mol. Biol.3: 67-70.

Biotecnologia

SUMRIO

136

4.18 COMARCAO COM ANEXINA V-FITC / IODETO DE PROPDEO


PARA ANLISE DE MORTE CELULAR

Em clulas saudveis, o fosfolipdeo de membrana fosfatidilserina (FS) se localiza
exclusivamente na face citoplasmtica da membrana plasmtica. Durante o processo de apoptose,
porm, este fosfolipdeo sofre flip-flop e externalizado na membrana plasmtica. Este protocolo se
baseia na deteco da FS extracelular por meio da marcao especfica com anexina V conjugada
ao fluorforo verde fluorescente FITC, por meio de microscopia e/ou citometria de fluxo. Ainda,
feita a comarcao com Iodeto de Propdeo (IP), o qual permevel apenas em clulas que sofrem
alteraes na permeabilidade da membrana, sinal tpico de necrose celular.
Mtodo de Zhang et al. (1997)
Protocolo referente placa de 24 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
1. Plaquear 3 x 103 clulas em placa de 24 poos, seguido do tratamento de interesse.
2. Passar o meio de cultura para um ependorfe de 2 mL e lavar as clulas com 300 mL de PBS
1x. Recolher o PBS da lavagem para o mesmo ependorfe onde foi colocado o meio de cultura.
Dica: Recolhe-se o meio de cultura, pois clulas aderidas que sofrem apoptose soltam-se da
placa de cultura.
3. Adicionar 150 L de tripsina aos poos, colocando a placa na estufa a 37 C por 2-5 minutos.
Dica: o tempo de tripsinizao varia de acordo com o tipo celular; clulas muito aderentes
requerem tempo maior de incubao (5 minutos). No aconselhvel exceder 5 minutos de
tripsinizao, sob pena de reduo de viabilidade celular.
4. Neutralizar a tripsina com 300 L de meio de cultura contendo Soro Fetal Bovino
e homogeneizar (up and down) aproximadamente 10 vezes, e passar o volume para o mesmo
ependorfe onde foram acondicionados o meio de cultura e o PBS.
5. Centrifugar o ependorfe contendo meio de cultura + PBS + clulas recolhidas por 5 minutos
a 1.600 rpm.
6. Remover o sobrenadante e ressuspender o pellet celular em 100 L Anexin Binding Buffer.
Dica: o Annexin Binding Buffer um componente dos kits de anexina; basta realizar a diluio
deste tampo (usualmente 10x concentrado) para uma soluo final 1x concentrada.
7. Adicionar 50 L do mix de marcao contendo anexina e PI.
Dica: mix de marcao - por amostra, 50 L de Anexin Binding Buffer + 1 L de anexina V-FITC
+ 3 mM de Iodeto de Propdeo. O ideal fazer um mix total (com o volume final a ser utilizado no
experimento). importante sempre calcular esse volume considerando n poos + 1. Por exemplo,
para 24 poos sero necessrios 1250 mL de Anexin Binding Buffer + 12,5 L de anexin V-FITC + 1,25
L de IP 3 mM.
Dica 2: os kits de preparao de anexina usualmente sugerem uma quantidade muito elevada
de anexina (5 L por amostra); esta quantidade, porm, pode gerar falso-positivos em clulas que
marcam eficientemente, em funo da perda de especificidade. Por isso, aconselha-se a fazer um
teste piloto com uma curva de 0.5 - 5 L de tripsina previamente aos experimentos de fato.

Biotecnologia

SUMRIO

137

Referncias:
ZHANG G, Gurtu V, Kain SR, and Yan G (1997) Early detection of apoptosis using a fluorescent conjugate of Annexin
V. BioTechniques 23: 525-531.
VAN ENGELAND M, Nieland L, Ramaekers F, Schutte B, Reutelingsperger C (1998) Annexin V-affinity assay: a
review on an apoptosis detection system based on phosphatidylserine exposure. Cytometry 31: 1-9.

Biotecnologia

SUMRIO

138

4.19 MARCAO COM LARANJA DE ACRIDINA PARA AVALIAO


DA ETAPA FINAL DO MECANISMO DE AUTOFAGIA
O mecanismo de autofagia se baseia na formao do autofagossomo, o qual contm
contedos prprios da clula e fusiona-se com lisossomos, gerando os autolisossomos onde o
material degradado. A sonda laranja de acridina (AO) emite fluorescncia verde quando em meio
intracelular, mas sofre uma protonao em organelas vacuolares cidas (AVOs), como lisossomos
e autolissomos, e passa a emitir fluorescncia vermelha. Este protocolo se baseia na marcao de
clulas com AO e deteco da porcentagem de clulas marcadas positivamente com AO (ou seja,
clulas positivas para a marcao vermelha), bem como a intensidade de marcao, como uma
inferncia da quantidade de autolissomos formados na clula.
Mtodo de Traganos et al. (1995) e Stankiewicz et al. (1996)
Protocolo referente placa de 24 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
CITOMETRIA DE FLUXO
1. Plaquear 3 x 103 clulas em placa de 24 poos, seguido do tratamento de interesse.
2. Preparar a soluo de marcao contendo 300 L de meio de cultura e 1,5 g/mL de AO.
Dica 1: preparar 10 mL de soluo estoque de AO - 5 g de AO em 10 mL de gua destilada
(concentrao final: 500 g/mL).
Dica: o ideal fazer um mix total (com o volume final a ser utilizado no experimento).
importante sempre calcular esse volume considerando n poos + 1. Por exemplo, para 24 poos
sero necessrios 7,5 mL de CMF 1x + 22,8 L de AO 500 g/mL.
3. Retirar o meio de cultura e lavar as clulas com 300 mL de CMF 1x.
4. Remover gentilmente o CMF e adicionar 150 L de tripsina aos poos, colocando a placa
na estufa a 37 C por 2-5 minutos.
Dica: o tempo de tripsinizao varia de acordo com o tipo celular; clulas muito aderentes
requerem tempo maior de incubao (5 minutos). No aconselhvel exceder 5 minutos de
tripsinizao, sob pena de reduo de viabilidade celular.
5. Neutralizar a tripsina com 300 L de meio de cultura contendo AO (passo 1) e homogeneizar
(up and down) aproximadamente 10 vezes, e passar o volume para um eppendorf de 0,6 L.
6. Incubar as clulas por 15 minutos a temperatura ambiente e proceder a leitura em citmetro
de fluxo.
Dica: as amostras devem ser lidas em at 45 minutos aps a marcao. Por isso, em casos em
que h muitas amostras, o ideal dividir a leitura em duas etapas.
MICROSCOPIA
1. Plaquear 3 x 103 clulas em placa de 24 poos, seguido do tratamento de interesse.
2. Ao final do perodo de tratamento, adicionar 1 mg/mL AO ao meio de cultura diretamente
no poo.
3. Incubar no escuro por 15 minutos e, aps, fotografar nas fluorescncias verde e vermelha
utilizando objetiva de 40x.

Biotecnologia

SUMRIO

139

Referncias:
TRAGANOS F,DARZYNKIEWICZ Z (1994) Lysosomal proton pump activity: supravital cell staining with acridine
orange differentiates leukocyte subpopulations. Meth. Cell Biol.41: 185-194.
STANKIEWICZ M,Jonas W,Hadas E,Cabaj W,Douch PG (1996) Supravital staining of eosinophils. Int. J.
Parasitol.26: 445-446.

Biotecnologia

SUMRIO

140

4.20 ENSAIO DE AGREGAO DE GFP-LC3 PARA MENSURAO DA


ETAPA INICIAL DA AUTOFAGIA
LC3 uma protena especfica de autofagossomos e importante para a formao e fechamento
dos mesmos, sendo recrutada para o autofagossomos em formao e permitindo o recrutamento
de material a ser autofagocitado bem como o fechamento do mesmo. Este mtodo se baseia na
transfeco ou transduo de clulas com plasmdeo pEGFP-LC3, o qual contm a sequncia
da protena LC3 fusionada sequencia da Protena Verde Fluorescente (GFP), a qual marca os
autofagossomos como pontos verdes intracelulares, permitindo sua quantificao por meio de
microscopia de fluorescncia.
Mtodo de Kabeya et al. (2000)
A descrio abaixo inclui a etapa de transfeco. Em caso da utilizao de clulas transduzidas
com o plasmdeo contendo a sequencia da protena LC3-GFP deve-se proceder a partir do item 3 do
corrente protocolo. Protocolo descritivo para placa de 24 poos.
1. Plaquear 3 x 104 clulas/poo no dia anterior transfeco. No dia seguinte, realizar a
transfeco com o plasmdeo pEGFP-LC3.
Dica: os protocolos de transfeco so bastante variveis e dependem do tipo de mtodo e do
reagente que ser utilizado; de qualquer forma, todos eles possuem um protocolo de uso que deve
ser respeitado.
2. Trocar o meio das clulas no dia seguinte transfeco.
Dica: relativamente comum o processo de transfeco ser um pouco txico s clulas de
modo que debris celulares aparecem no dia seguinte transfeco.
3. Expor as clulas ao tratamento de interesse.
4. Fotografar as clulas utilizando objetiva de 20x ou 40x ao longo do experimento.
Dica: as clulas no devem ser mantidas por mais do que 30 minutos fora da estufa.
4. Ao final do perodo de tratamento, retirar o meio de cultura, lavar 3 x com PBS 1x e
adicionar paraformaldedo 2 % para fixao das clulas por 15 minutos a temperatura ambiente.
Dica: O paraformaldedo 4% deve ser preparado na capela de exausto, pois txico. Em 100
mL de PBS, pesar 4 g de PFA e aquecer de 58-63C (no mais do que isso); adicionar 100-150 L de
NaOH 1 N, at clarear a soluo (pH~7,4); manter agitando a 58-63C por 30 minutos, seguido da
filtrao da soluo em papel filtro. A soluo estoque deve ser armazenada a -20C.
5. Aps retirar o paraformaldedo, lavar 1x com PBS 1x e adicionar uma soluo contendo
400 nM de DAPI em PBS 1x por 30 minutos no escuro, a fim de contracorar o ncleo celular.
6. Contar o nmero de clulas que contm cinco ou mais pontos verdes no citoplasma entre
pelo menos 100 clulas verdes. A porcentagem de clulas autofgicas se d pela razo do nmero
de clulas contendo pelo menos cinco pontos verdes em funo do total de clulas contado.
Dica: experimentos de longo prazo (mais do que 7 dias) devem ser realizados com clulas
transduzidas, que apresentam expresso estvel da protena, e no transfectadas.
Referncias:
KABEYA Y, Mizushima N, Ueno T, Yamamoto A, Kirisako T, Noda T, Kominami E, Ohsumi Y, Yoshimori T (2000)
LC3, a mammalian homologue of yeast Apg8p, is localized in autophagosome membranes after processing. EMBO J.
19: 5720-5728.
MIZUSHIMA N, Yoshimori T, Levine B (2010) Methods in mammalian autophagy research. Cell 140: 313-326.

Biotecnologia

SUMRIO

141

4.21 AVALIAO DO NDICE MITTICO PARA INFERNCIA DE


PROLIFERAO CELULAR
Este protocolo se baseia na marcao de DNA celular in situ com uma molcula fluorescente
(DAPI ou Iodeto de Propdeo) e determinao da porcentagem de figuras mitticas em uma
determinada condio por meio de observao direta em microscopia de fluorescncia.
Mtodo de Tarnowski et al. (1993)
Protocolo referente placa de 24 poos. Os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
1. Plaquear 2 x 104 clulas em placa de 24 poos, e realizar o tratamento de interesse.
Dica: deve-se evitar uma confluncia acima de 70% ao final do experimento, principalmente
no controle, pois isso dificulta a contagem das figuras mitticas. Em funo disso, pode-se alterar o
nmero inicial de clulas, dependendo do desenho experimental e da proliferao celular.
2. Retirar o meio e lavar os poos 3x com PBS 1x.
Dica: adicionar e retirar o PBS vagarosamente, para no soltar as clulas aderidas.
3. Incubar as clulas com 100 L paraformaldeido 4% a temperatura ambiente por 15 minutos.
4. Retirar o paraformaldedo e lavar 3x com PBS/CMF.
Dica 1: Pode-se deixar at cinco dias as clulas em PBS 1x at proceder a marcao.
Dica 2: a realizao deste protocolo em ambiente estril (fluxo laminar) mantm as clulas
ntegras e ajuda a manter a morfometria celular.
5. Marcar as clulas com 300 L de PBS 1x + 0,5 L de Triton X-100 0,1% + 300 nM de DAPI
por 30 minutos.
Dica: DAPI um corante fluorescente que se liga ao DNA. Este protocolo pode ser realizado
substituindo-se o DAPI por Iodeto de Propdeo 6 mM.
Dica: a marcao pode ser feita com Iodeto de Propdeo.
6. Retirar a soluo de marcao contendo DAPI e adicionar 500 L de PBS 1x / poo.
Dica: a marcao permanece relativamente estvel por 10 dias no escuro.
7. Fotografar os poos de interesse para o visvel e fluorescncia utilizando objetiva de 20x.
8. Conta-se o nmero de figuras mitticas em pelo menos 100 clulas de cada condio.
Dica: a escolha do campo a ser fotografado deve ser feita de maneira cega, na luz visvel.
Referncia:
TAMOWSKI BI,Sens DA,Nicholson JH,Hazen-Martin DJ,Garvin AJ,Sens MA (1993) Automatic quantitation of cell
growth and determination of mitotic index using DAPInuclearstaining. Pediatr. Pathol.13: 249-265.

Biotecnologia

SUMRIO

142

4.22 ATIVIDADE DE BETA-GALACTOSIDASE CIDA ASSOCIADA


SENESCNCIA (SA--GAL)
Clulas senescentes apresentam aumento da expresso e atividade da protena betagalactosidase cida lisossomal. Este protocolo se baseia na determinao da atividade desta enzima
por meio da incubao das clulas in vitro com o substrato cromognico x-gal, o qual convertido a
um produto azul que se acumula intracelularmente, marcando as clulas senescentes.
Mtodo de Dimri et al. (1995)
Protocolo referente placa de 24 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
1. Plaquear 1 x 104 clulas em placa de 24 poos e realizar o tratamento de interesse.
Dica: deve-ser atentar para que o controle no atinja mxima confluncia antes do final do
experimento. Pode-se alterar o nmero inicial de clulas dependendo do desenho experimental.
2. Retirar o meio e lavar os poos 3x com PBS 1x.
Dica: adicionar e retirar o PBS vagarosamente, para no soltar as clulas aderidas.
3. Incubar as clulas com 100 L paraformaldeido 4% a temperatura ambiente por 15 minutos.
4. Retirar o paraformaldedo e lavar 3x com PBS/CMF.
Dica 1: Pode-se deixar at 5 dias as clulas em PBS 1x at proceder a marcao.
Dica 2: a realizao deste protocolo em ambiente estril (fluxo laminar) mantm as clulas
ntegras e ajuda a manter a morfometria celular.
5. Incubar as clulas com 300 L da soluo de marcao contendo o substrato X-gal por 6-14
horas a 37 C em estufa sem CO2.
Dica 1: deve-se preparar um mix de soluo de marcao referente ao total de poos de
interesse, calculando o volume para n poos + 1 (por exemplo, para placa de 24 poos, deve-se
preparar volume para 7,5 mL de soluo de marcao, com base na tabela abaixo).
Soluo
X-gal 20 mg/mL
TF 200 mM / c. Ctrico 80 mM
NaCl 500 mM
MgCl 500 mM
K3FeCN6 50 mM
K4FeCN6 100 mM

1 mL
50 L
500 L
300 L
4 L
100 L
50 L

2 mL
100 L
1 mL
600 L
8 L
200 L
100 L

3 mL
150 L
1,5 mL
900 L
12 L
300 L
150 L

4 mL
200 L
2 mL
1,2 mL
16 L
400 L
200 L

5 mL
250 L
2,5 mL
1,5 mL
20 L
500 L
250 L

6 mL
300 L
3 mL
1,8 mL
24 L
600 L
300 L

12 mL
600 L
6 mL
3,6 mL
48 L
1,2 mL
600 L

Dica 2: o tempo de incubao com o substrato bastante varivel dependendo do tipo celular.
Deve-se padronizar esse perodo em experimento piloto com diferentes tempos de marcao, a fim
de evitar marcao falso-positiva ou falso-negativa.
6. Retirar a soluo de marcao e contracorar os ncleos celulares, por meio da incubao
com 300 L de PBS 1x + 300 nM de DAPI por 30 minutos no escuro.
Dica: DAPI um corante fluorescente que se liga ao DNA.
Dica 1: esta marcao nuclear tem como objetivo dirigir a contagem posterior do nmero de
clulas positivamente marcadas para X-gal.
7. Retirar a soluo de marcao contendo DAPI e adicionar 500 L de PBS 1x / poo.

Biotecnologia

SUMRIO

143

Dica: a marcao permanece relativamente estvel por dez dias no escuro.


8. Fotografar os poos de interesse para o visvel (X-gal) e fluorescncia (DAPI) utilizando
objetiva de 20x.
9. Conta-se o nmero de clulas azuis (marcadas para o substrato X-gal) em pelo menos 100
clulas de cada condio.
Dica: a escolha do campo a ser fotografado deve ser feita de maneira cega, inicialmente pela
luz fluorescncia azul referente marcao com DAPI.
Referncia:
DIMRIi GP, Lee X, Basile G, et al. (1995) A biomarker that identifies senescent human cells in culture and in aging skin
in vivo. Proc. Natl. Acad. Sci. USA 92: 9363-9367.

Biotecnologia

SUMRIO

144

4.23 ENSAIO CLONOGNICO PARA MENSURAO DA CAPACIDADE


PROLIFERATIVA DE CLULAS NICAS
Este protocolo se baseia na mensurao da capacidade proliferativa de clulas nicas (clones).
Clulas so expostas a diferentes condies/tratamentos, plaqueadas em baixas densidades
e crescidas de modo a permitir a formao de colnias, que so posteriormente contadas a olho
nu e/ou observadas em microscopia. Quanto maior o nmero de colnias, maior a capacidade
clonognica das clulas em questo.
Mtodo de Franken et al. (2009)
Para o ensaio clonognico no necessrio um nmero grande de clulas. Assim, pode-se
preparar uma placa de 24 poos com 2 x 103 clulas/poo e proceder o tratamento de interesse. A
partir das clulas tratadas que se inicia o protocolo do ensaio clonogenico.
1. Uma vez encerrado o tempo de tratamento de interesse, retirar o meio de cultura, tripsinizar
as clulas e acondicionar as mesmas em tubo falcon ou eppendorf.
2. Contar as clulas (em hemocitmetro ou citmetro de fluxo) e determinar o volume
necessrio para obter 100 clulas para cada poo de placa de cultura de 6 poos.
Dica: o ideal que o ensaio seja feito, no mnimo, em duplicatas. Assim, deve-se fazer um
mix total contendo 200 clulas e 4 mL de volume final de meio de cultura, para plaqueamento de 2
mL por poo contendo 100 clulas em cada.
Dica 2: aconselhvel que seja feita uma diluio do nmero de clulas para que o volume a
ser pipetado contendo as 100 clulas no seja inferior a 10 L.
3. Plaquear as clulas em placa de 6 poos (100 clulas em 2 mL de meio por poo) e deixar
estas clulas proliferarem clonalmente por 10-15 dias, com uma troca do meio de cultura no 7 dia
aps o plaqueamento.
Dica: o tempo de crescimento de cada tipo celular varia; algumas clulas j mostram colnias
com sete dias de crescimento, enquanto outras levam em torno de 15 dias para isso.
Dica 2: alguns tipos celulares no apresentam capacidade de proliferao clonognica,
inviabilizando o ensaio.
4. Aps o perodo de proliferao celular, fixar as clulas adicionando lentamente 1 mL de
metanol 100% gelado por 5 minutos a temperatura ambiente.
5. Remover o metanol e adicionar 1 mL de cristal violeta 0,1% (0,1 g em 100 mL de H2O
destilada) por 1 minuto.
6. Retirar o cristal violeta e lavar com gua destilada at que a colorao violeta de fundo seja
removida e apenas as colnias permaneam coloridas
7. Contar o nmero de colnias com pelo menos 50 clulas formadas em cada tratamento.
Referncia:
FRANKEN, Rodermond H, Stap J, Haveman J, van Bree C (2006) Clonogenic assay of cells in vitro. Nature Protocols
1: 2315-2319.

Biotecnologia

SUMRIO

145

4.24 MARCAO DE BROMODEOXIURIDINA (BrdU) PARA


AVALIAO DA PROLIFERAO CELULAR
Este protocolo baseia-se na incubao de clulas em cultura durante um perodo que varia de
30 minutos a 3 horas com o nucleotdeo alterado Bromodeoxiuridina (BrdU), o qual incorporado
ao DNA celular de clulas em proliferao (que progridem pela fase S do ciclo celular). Aps a
incubao com BrdU, este detectado por meio da marcao com anticorpo fluorescente especfico,
e a porcentagem de clulas positivas determinada por citometria de fluxo.
Mtodo de Dolbeare et al. (1983)
Protocolo referente placa de 12 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 2x maiores;
placas de 24 poos = metade dos volumes).
1. Plaquear 5 x 104 clulas em placa de 12 poos e realizar o tratamento de interesse no dia
seguinte
2. Incubar as clulas com 10 M de BrdU (diretamente no meio de cultura) por 1-3 horas
Dica: o tempo de incubao varia de acordo com o tipo celular - clulas que proliferam com
ndice elevado requerem tempo menor (1 hora) de incubao com o BrdU.
3. Remover o meio de cultura e lavar as clulas com PBS 1x; adicionar 250 L de tripsina aos
poos, colocando a placa na estufa a 37 C por 2-5 minutos
Dica: o tempo de tripsinizao varia de acordo com o tipo celular; clulas muito aderentes
requerem tempo maior de incubao (5 minutos). No aconselhvel exceder 5 minutos de
tripsinizao, sob pena de reduo de viabilidade celular.
4. Neutralizar a tripsina com 500 L de meio de cultura contendo Soro Fetal Bovino e
homogeneizar (up and down) aproximadamente 10 vezes, e passar o volume para um eppendorf de
1,5 mL
Dica: Up and down fundamental para uma dissociao eficiente das clulas; citmetros
de fluxo, que utilizam capilar como clula de leitura, sofrem entupimento quando h a presena de
agregados celulares.
5. Centrifugar 5 minutos a 1.500 rpm, seguido da remoo do sobrenadante
Dica: pode-se descartar o sobrenadante tanto por meio do uso de pipeta quanto vertendo
diretamente o lquido, sem agitao.
6. Ressuspender o pellet celular com 1 mL de PBS 1x e centrifugar a 1.500 rpm por 5 minutos.
7. Centrifugar 5 minutos a 1.500 rpm.
8. Fixar as clulas com 1 mL de etanol 70% (em PBS 1x) gelado, gotejando-o enquanto as
clulas so agitadas no vrtex
Dica: deve-se deixar fixando por pelo menos 30 minutos a 4 C (ideal: aproximadamente 2
horas).
9. Centrifugar por 6 minutos a 1.500 rpm.
10. Suspender o pellet em 1 mL de PBS 1x e centrifugar por 6 minutos a 1.500 rpm.
11. Ressuspender o pellet celular em 500 L de HCl 2 N por 30 minutos a temperatura
ambiente.

Biotecnologia

SUMRIO

146

12. Centrifugar a 1.500 rpm por 6 minutos; ressuspender o pellet celular em 1 mL de PBS 1x e
centrifugar novamente a 1.500 rpm por 6 minutos.
13. Ressuspender o pellet celular em 380 L de PBS-T e adicionar 20 L de anticorpo antiBrdU conjugado a FITC por 1 hora no escuro sob agitao.
Dica: PBS-T = preparar 50 mL (50 mL PBS 1x + 500 L BSA 1 mg/mL + 250 L Tween 20).
14. Centrifugar a 1.500 rpm por 6 minutos e, aps, adicionar 1 mL de PBS 1x ao pellet celular,
seguido de centrifugao a 1.500 rpm por 6 minutos
15. Ressuspender o pellet celular em 200 L de PSSI incubar, no mnimo, 15 minutos a 37 C
ou 30 minutos a temperatura ambiente
Dica 1: PSSI - 1,4 L de Triton X-100 1%; 20 L de RNAse (20 mg); 60 L de Iodeto de Propdeo
2 mg/mL; 10 mL q.s.p. de PBS 1x.
16. Proceder a leitura em citmetro de fluxo.
Referncia:
DOLBEARE F, Gratznert H, Pallavicini M, Gray JW (1983) Flow cytometric measurement of total DNA content and
incorporated bromodeoxyuridine. Proc. Natl. Acad. Sci. USA 80: 5573-5577.

Biotecnologia

SUMRIO

147

4.25 ANLISE MORFOMTRICA NUCLEAR (NMA) PARA INFERNCIA


DE APOPTOSE, SENESCNCIA E IRREGULARIDADES NUCLEARES
Este protocolo baseia-se na mensurao de tamanho e forma de ncleos de clulas eucariticas
in vitro. Por meio da morfometria nuclear possvel inferir mecanismos de senescncia, apoptose e
catstrofe mittica. O mtodo se baseia em trs etapas: 1) Aquisio das imagens; 2) Obteno dos
dados morfomtricos; 3) Anlise dos dados no Excel.
Mtodo de Filippi-Chiela et al. (2012)
Protocolo referente placa de 24 poos; os volumes podem ser ajustados de maneira
diretamente proporcional conforme o tipo de placa (Ex.: placa de 6 poos = volumes 4x maiores;
placas de 12 poos = volumes 2x maiores).
ETAPA 1: Aquisio das imagens
1. Plaquear 2 x 104 clulas em placa de 24 poos. No dia seguinte, realizar o tratamento de
interesse.
Dica: deve-se evitar uma confluncia acima de 70% ao final do experimento, principalmente
no controle, pois isso dificulta a contagem das figuras mitticas. Em funo disso pode-se alterar o
nmero inicial de clulas, dependendo do desenho experimental e da proliferao celular.
2. Aps o perodo do tratamento, remover o meio de cultura e lavar os poos 3x com PBS 1x.
Dica: adicionar e retirar o PBS vagarosamente, para no soltar as clulas aderidas.
3. Incubar as clulas com 100 L para formaldedo 4% a temperatura ambiente por 15
minutos.
4. Retirar o paraformaldedo e lavar 3x com PBS/CMF.
Dica 1: Pode-se deixar at cinco dias as clulas em PBS 1x at proceder a marcao.
Dica 2: a realizao deste protocolo em ambiente estril (fluxo laminar) mantm as clulas
integras e ajuda a manter a morfometria celular.
5. Marcar as clulas com 300 L de PBS 1x + 0,5 L de Triton X-100 0,1% + 300 nM de DAPI
por 30 minutos.
Dica: DAPI um corante fluorescente que se liga ao DNA.
6. Retirar a soluo de marcao contendo DAPI e adicionar 500 mL de PBS 1x por poo.
Dica: a marcao permanece relativamente estvel por 10 dias no escuro.
7. Fotografar os poos de interesse para o visvel e fluorescncia utilizando objetiva de 20x.
ETAPA 2: Obteno dos dados morfomtricos
1. Abrir o arquivo da primeira imagem a ser analisada no software Image Pro Plus (IPP).
2. Clicar em Irregular AOI e clicar seguidamente no primeiro ncleo a ser analisado, at
que este adquira o contorno vermelho em conformidade com sua morfometria.
Dica: preciso ter cuidado durante a marcao dos ncleos - marcao alm da rea nuclear
ou inferior a mesma gera dados incorretos. Exemplos de marcaes corretas ou incorretas podem
ser encontrados na referncia abaixo.
3. Ao trmino da seleo correta do primeiro ncleo, manter a tecla Ctrl pressionada e
clicar sobre o prximo ncleo a ser marcado, e assim sucessivamente.

Biotecnologia

SUMRIO

148

4. Quando todos os ncleos a serem considerados estiverem marcados, selecionar: Count >
Measure Objects > Measure > Select measures > Aspect, Area/Box, Radius Ratio e Roundness.
5. Na sequncia, selecionar Edit > Convert AOI(s) to Objects e, finalmente, File > Data to
Clipboard.
6. Colar os dados diretamente no Excel.
ETAPA 3: Anlise dos dados no Excel
1. Abrir a planilha do Excel para o NMA (http://www.ufrgs.br/labsinal/NMA).
2. Selecionar ncleos regulares / normais e copiar os dados destes ncleos. Colar na tabela
Normal Nuclei and Settings (tabela laranja esquerda) para fazer a setagem dos ncleos.
Dica: a anlise de NMA semelhante citometria de fluxo - inicialmente feita uma setagem
(aba Normal Nuclei and Settings) para, na sequncia, ser feita a anlise das diferentes.
3. Ajustar o tamanho da elipse normal para que fique representativa da populao controle
/ normal.
Dica: exemplos de elipses normais corretas ou incorretas podem ser encontradas na referncia
abaixo.
4. Copiar e colar TODOS os dados obtidos na rea Treated Nuclei da aba Normal Nuclei and
Settings (tabela laranja direita).
5. Ajustar os limiares que dividem as populaes, alterando o nmero de desvios padro nas
clulas S4, S6, S8 e S10.
6. Para a anlise propriamente dita, duplicar a planilha Condition 1 at o nmero necessrio
correspondente ao nmero de tratamentos de interesse.
7. Colar os dados das variveis obtidas no IPP dos ncleos de cada tratamento no espao
amarelo de cada planilha referente aos tratamentos.
8. Apagar os X da coluna I onde no houver dados.
Dica: diferentes experimentos devem ser colocados na ordem indicada na coluna A.
9. A porcentagem de clulas em cada condio dada na coluna AH. Os grficos representam
rea nuclear versus ndice de Irregularidade Nuclear (NII), esquerda, e a porcentagem de cada
mecanismo celular ( direita).
Referncia:
FILIPPI-CHIELA EC, Oliveira MM, Jurkovski B, Callegari-Jacques SM, da Silva VD,LenzG (2012)
Nuclearmorphometricanalysis(NMA): screening of senescence, apoptosis andnuclear irregularities. PLoS One 7:
e42522.

Biotecnologia

SUMRIO

149

CAPTULO 5
ANLISE DE EXPRESSO GNICA EM
NVEL DE RNA
Adriane Pozzobon, Andressa Dametto, dina Aparecida dos Reis Blasi, Giseli Buffon,
Raul Antonio Sperotto, Ronize Zeni da Silva, Vinicius de Abreu Waldow

Biotecnologia

SUMRIO

150

5.1 TRATAMENTO DAS AMOSTRAS DE RNA COM DNASE I E DNASE


TURBO
O tratamento das amostras de RNA com DNase utilizado para eliminar qualquer
contaminao com DNA genmico que, durante o processo de extrao de RNA, possa ter sido
extrado.
DNase I
1.

Pipetar em cada tubo:


(Manter no gelo)

10x DNAse I Reaction Buffer


1 L
DNAse I
1 L
1 g de RNA Total
H2O Milli-Q
q.s.p.
TOTAL
10 L
Deixar 15 minutos sob temperatura ambiente.
Pipetar em cada tubo 1 L de EDTA 25 mM.
Manter a 65 C por 10 minutos. A enzima inativada por calor e EDTA.
Guardar no ultrafreezer.

2.
3.
4.
5.

DNAse Turbo
1.

Pipetar em cada tubo:


(Manter no gelo)

2.
3.
4.
5.

Biotecnologia

H2O Milli-Q
10x DNAse Reaction Buffer
DNAse Turbo
1 g de RNA Total
TOTAL
No termociclador, manter a 37 C por 30 minutos.
Pipetar em cada tubo 1 L de EDTA 25 mM.
Manter a 75 C por 10 minutos.
Guardar no ultrafreezer.

q.s.p
1 L
1 L
10 L

SUMRIO

151

5.2 SNTESE DE PRIMEIRA FITA DE CDNA UTILIZANDO A


TRANSCRIPTASE REVERSA M-MLV
A enzima transcriptase reversa M-MLV (Moloney Murine Leukemia Virus) utilizada para
sintetizar uma fita de DNA complementar fita de RNA, chamada de primeira fita de cDNA. A
converso do RNA em cDNA possvel, pois utiliza-se um primer oligo (dT) que anela na cauda
poliA dos mRNAs, permitindo a anlise da expresso de genes especficos em uma amostra
biolgica.
1.

Pipetar em cada tubo:

Primer oligo (dT)


dNTPs Mix 10 mM
1 g de RNA total tratado
com DNase
H2O Milli-Q
TOTAL

2.
3.

Pipetar em cada tubo:

4.

Manter a 65 C por 5 minutos.


5X First-Strand Buffer
DTT 0,1 M

1 L
1 L

q.s.p.
13 L
4 L
2 L

Manter a 37 C por 2 minutos.


Pipetar em cada tubo:

5.
6.
7.
8.

Biotecnologia

1L de M-MLV (200 U/ l)
Manter a 37 C por 50 minutos.
Manter a 70 C por 15 minutos para inativao da enzima.
Guardar na geladeira.

SUMRIO

152

5.3 SNTESE DE PRIMEIRA FITA DE cDNA UTILIZANDO A


TRANSCRIPTASE REVERSA SUPERSCRIPT II
A sntese de cDNA (DNA complementar) feita por transcrio reversa a partir do RNA
total, utilizando oligonucleotdeos (primers) complementares cauda poli-A caracterstica do
mRNA (RNA mensageiro), produzindo um cDNA mais puro, exclusivamente a partir do mRNA.
Considerando que a frao do mRNA corresponde a aproximadamente 3-4% do RNA total, estimase que 1 g de RNA total fornece 20 ng de cDNA. O cDNA posteriormente utilizado para a
amplificao de genes de interesse pela PCR. A tcnica de RT-PCR pode ser usada para comparar
os nveis de mRNA e caracterizar seus padres de expresso (Wang & Brown, 1999).
Protocolo baseado no Kit SuperScript II Reverse Transcriptase (Invitrogen)
1. Aps a quantificao do RNA, construir uma tabela com os volumes correspondentes para
x g de RNA/l de soluo;
Amostra de
RNA

mg/L de RNA

p/ 1g de RNA/l

H2O Completar para 10 uL

2. Preparar a MIX (sempre para o nmero de tubos + 1 extra).


Mix
10X PCR Buffer
25 mM MgCl2
0,1 M DTT
RNAse OUT

cada reao
2 L
4 L
2 L
1 L

p/n tubos + 1 (ex.: 8)


18 L
36 L
18 L
9 L

Dica: sempre centrifugar brevemente (spin) os reagentes antes de usar. Descongelar e manter
todos os reagentes (e principalmente o RNA) no gelo.
3. Pipetar o volume respectivo de H2O com DEPC (do Kit) em cada tubo;
4. Pipetar o volume correspondente de RNA e manter a amostra sempre no gelo.
5. Adicionar 1 L de dNTP mix em cada tubo.
6. Adicionar 1 L de primer OligodT (10 mM) a cada tubo.
7. Incubar 65oC por 5 minutos.
8. Adicionar 9 L da Mix a cada tubo.
9. Incubar 42 oC por 2 minutos.
10. Adicionar 1 L da enzima transcriptase reversa, Superscript II (Invitrogen) por tubo.
Dica: tirar a enzima do freezer somente na hora de pipetar e misturar com a ponteira aps
adicionar no tubo.
11. Incubar 42oC por 50 minutos.
12. Terminar a reao 70oC por 15 minutos.
13. Colocar no gelo.
14. Coletar a reao por breve centrifugao.
15. Adicionar 1 L de RNAse H em cada tubo.
Dica: retirar a enzima do freezer somente na hora de pipetar.
16. Incubar por 20 minutos 37oC antes de proceder a amplificao por PCR.
Referncia:
WANG, T. and M. J. Brown (1999). mRNA quantification by real time TaqMan polymerase chain reaction: validation
and comparison with RNase protection Anal Biochem 269(1): 198-201.

Biotecnologia

SUMRIO

153

5.4 ANLISE DA EXPRESSO GNICA POR RT-PCR SEMIQUANTITATIVO


A Reao em Cadeia da Polimerase (PCR, polimerase chain reaction) uma tcnica que
permite a amplificao de uma sequncia de DNA especfica. Durante a PCR, a desnaturao do
DNA realizada atravs de altas temperaturas e permitindo que os primers se liguem sequncia
complementar no DNA e delimitem a regio alvo. Alm disso, a enzima termoestvel Taq DNA
Polimerase adiciona os nucleotdeos produzindo cpias do trecho de interesse. A RT-PCR (Reverse
Transcriptase - Polymerase Chain Reaction) usa o cDNA (DNA complementar) ao invs do DNA
genmico, e permite que sejam analisados padres de expresso gnica.
1. Amplificao por PCR semiquantitiva (gene da b-microglobulina humana)
2. Preparar tubos eppendorfs (0,2 mL) numerados segundo as amostras.
3. Colocar as amostras no gelo e os componentes da Mix Inicial e Ps Hot-Start
4. Preparar a Mix Inicial e a Ps Hot-Start.
Dica: no adicionar na Ps Hot-Start enzima Taq DNA polimerase, deixar para acrescentar
apenas no final para impedir a formao de dmeros de primers. Preparar a Mix e a Ps sempre
para uma reao a mais. Ex.: 14 amostras + 1:
Exemplo:
Mix inicial

Ps Hot-Start

gua DEPC

32,8 x 15 = 492 L

6,4 x 15 = 103,5 L

PCR Buffer 10X

4,0 x 15 = 60 L

1,0 x 15 = 15 L

MgCl2 50 mM

1,2 x 15 = 18 L

0,3 x 15 = 4,5 L

DNTP Mix 10 mM

1,0 x 15 = 15 L

Primer Sense

0,5 x 15 = 4,5 L

Primer Antisense

0,5 x 15 = 4,5 L


cDNA 2,0
Taq DNA Polimerase

0,3 x 15 = 3,0 L

TOTAL 40 L 10 L

5. Adicionar a cada tubo 38 L da Mix Inicial.


6. Adicionar 2 L de cDNA de cada amostra no seu respectivo tubo.
7. Colocar no termociclador.
8. Aps 2 minutos (01:59) dar Pausa no programa.
9. Retirar os tubos da mquina, dar um spin e colocar no gelo.
10. Adicionar a enzima Taq DNA Polimerase na soluo Ps Hot-Start.
11. Adicionar 10 L da Ps Hot-Start em cada tubo.
12. Recolocar os tubos no termociclador e apertar Pause para continuar o programa.
13. Sequncia analisada: sense 5 CTATCCAGCGTACTCCAAAG 3e e antisense:
5ACAAGTCTGAATGCTCCACT 3.
Programa para amplificar a -microglobulina:
1. 94C por 2 minutos
2. 94C por 30 segundos

Biotecnologia

SUMRIO

154

3. 55C por 30 segundos


4. 72 C por 30 segundos
5. Repetir os passos 2, 3 e 4: 29 vezes
6. 72 C por 5 minutos
END
Para a anlise dos produtos da PCR, deve-se realizar a eletroforese em gel de agarose. O
tamanho e a concentrao do gel dependem do fragmento que se quer analisar. Neste caso, utilizase 1,5 %, pois o gene analisado possui 165 pares de bases.
Exemplos de clculo:
Gel Mdio (1,5 %)

80 mL TBE 1X

1,2 g Agarose
1L Brometo de Etdeo
1. Pesar agarose de acordo com o volume de TBE 1X a ser utilizado.
2. Mistur-la ao TBE 1X em um becker.
3. Fazer uma marca no menisco da soluo para completar o volume aps a fervura.
4. Tapar o recipiente com plstico-filme de polietileno.
Dica: fazer alguns pequenos furos com a ponta da tesoura.
5. Preparar o suporte do gel e acoplar o pente.
6. Ferver a mistura em micro-ondas at dissolver completamente a agarose.
7. Completar o volume evaporado com o TBE 1X.
8. Aguardar o resfriamento parcial e acrescentar o Brometo de Etdeo.
Dica: toda a manipulao com o Brometo de Etdeo deve ser feita com luvas apropriadas.
9. Homogeneizar e verter a mistura no suporte com cuidado para no formar bolhas.
Dica: agitar delicadamente o erlenmeyer para misturar bem o brometo de etdeo e evitar a
formao de bolhas. Se formar bolhas prximas ao pente, estas podem ser removidas com o auxlio
de uma ponteira.
10. Aguardar a polimerizao (em torno de 30 minutos) para desenformar o gel.
11. Posteriormente ao preparo do gel, proceder a pipetagem das amostras no gel.
12. Cortar um pedao de parafilm e pipetar 5 L de tampo de corrida conforme o nmero
de amostras.
13. Pipetar 7 L de amostra em cada bolinha de tampo de corrida.
14. Aspirar a mistura e pipetar a amostra no poo do gel.
Dica: sempre reservar o primeiro poo para o marcador de peso molecular. Pipetar entre
1 e 2 L. Pipetar lentamente, cuidando para no furar o gel e verificando se o tampo da cuba de
eletroforese cobre todo o gel, principalmente os poos.
15. Fechar a cuba, conectar os eletrodos e ligar a fonte a 100 mV, 300 mA por aproximadamente
1 hora (o tempo depende do fragmento a ser analisado e da concentrao do gel de agarose).
16. Visualizar a amplificao no transluminador (luz UV).

Biotecnologia

SUMRIO

155

Observaes:
Preparo do tampo TBE 10X
Para 1 litro:
Pesar: 55 g de cido brico, 108 g de TRIS e 9,25 g de EDTA. Dissolver os sais em parte da
gua Milli-Q (aproximadamente 600 mL). Aps dissolver, acrescentar o restante da gua (400 mL).
Verificar o pH (deve estar entre 8 e 9). Distribuir em duas garrafas de meio litro e autoclavar.
Dica: se o pH no estiver entre 8 e 9, desprezar o tampo e refazer, pois o pH no deve ser
ajustado.
Para preparar a soluo TBE 1X, diluir 100 mL de TBE 10X em 900 mL de gua Milli-Q
autoclavada.
Preparo do tampo de corrida: Tampo Type III
Para 5 mL: Pesar 0,0125 g de xylene cyanol e 0,0125 g de azul de bromofenol. Misturar em
um becker 1,5 mL de glicerol, 3,5 mL de gua Milli-Q e os corantes. Agitar at dissolver. Distribuir
em cinco tubos eppendorfs e armazenar na geladeira.
Referncia
WATSON, James D. et al.2006. Biologia Molecular do Gene. 5 ed. Porto Alegre: Artmed.

Biotecnologia

SUMRIO

156

5.5 PREPARAO DE UMA PLACA DE RT-qPCR (PCR EM TEMPO


REAL) DE 48 POOS
O PCR em Tempo Real utilizado para analisar a expresso de genes especficos de maneira
precisa e altamente reprodutvel, por meio de um mecanismo de deteco e quantificao por
fluorescncia. A tcnica tambm pode ser aplicada para quantificao de carga viral, genotipagem,
deteco de agentes infecciosos, testes de eficincia teraputica e todas as aplicaes da PCR
convencional.
Protocolo para anlise de expresso gnica de 4 genes (3 genes testes + 1 gene controle):
Dicas: As amostras devem ser testadas sempre em triplicatas biolgicas e quadruplicatas
tcnicas. Todo o procedimento deve ser realizado no gelo.
1. Identificar 4 tubos eppendorf de 1,5 mL com os nomes dos respectivos genes.
2. Pipetar os seguintes itens em cada eppendorf identificado (mix para de placa - 12 poos):
H2O 49,7 L
Tampo 10X 10X 26,5 L
MgCl2 (50 mM)

15,9 L

dNTPs Mix (10 mM)

2,7 L

Primer F (10 mM)

5,3 L

Primer R (10 mM)

5,3 L

SYBR Green diludo*

26,5 L

Platinum Taq DNA Polimerase

0,7 L

*Diluio do SYBR Green: 1,1 L SYBR Green + 108,9 L H2O


3. Misturar bem o mix com auxlio de uma pipeta.
4. Colocar a placa de 48 poos sobre uma estante de microtubos.
5. Colocar trs eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e adicionar 45 L
do mix do gene 1 em cada um deles.
6. Com a pipeta multicanal, transferir 10 L do mix do gene 1 em cada pocinho da coluna 1,
2, 3 e 4 das linhas A, B e C.
7. Descartar os eppendorfs auxiliares.
8. Colocar trs novos eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e adicionar
45 L do mix do gene 2 em cada um deles.
9. Com a pipeta multicanal, transferir 10 L do mix do gene 2 em cada pocinho da coluna 5,
6, 7 e 8 das linha A, B e C.
10. Descartar os eppendorfs auxiliares.
11. Colocar trs novos eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e adicionar
45 L do mix do gene 3 em cada um deles.
12. Com auxlio da pipeta multicanal, transferir 10 L do mix do gene 3 em cada pocinho da
coluna 1, 2, 3 e 4 das linhas D, E e F.
13. Descartar os eppendorfs auxiliares.
14. Colocar mais trs novos eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e
adicionar 45 L do mix do gene 4 em cada um deles.

Biotecnologia

SUMRIO

157

15. Com o auxlio da pipeta multicanal, transferir 10 L do mix do gene 4 em cada pocinho
da coluna 5, 6, 7 e 8 das linhas D, E e F.
16. Adicionar 10 L de cDNA (diludo 100X) em cada pocinho correspondente a cada amostra.
17. Os pocinhos C4, C8, F4 e F8 sero os controles negativos dos respectivos genes 1, 2, 3 e 4.
Nestes poos adicionar 10 L de H2O, ao invs do cDNA.
Dica: Caso se formem algumas bolhas na parede dos pocinhos, as mesmas devero ser
empurradas para baixo com o auxlio de uma ponteira, ou com uma centrfuga de placas. Cuidar
para no contaminar os poos vizinhos.
18. Colocar o adesivo na placa.
Dica: O adesivo deve estar bem fixado para evitar a evaporao dos reagentes.
19. Colocar a placa dentro do equipamento de RT-qPCR para anlise da expresso gnica.
20. Criar ou editar um template e salv-lo com um nome apropriado.
21. Iniciar a reao.
22. Salvar o arquivo e calcular os valores de expresso.
Protocolo para anlise de expresso gnica de 2 genes (1 gene teste + 1 gene controle):
1. Identificar 2 eppendorfs de 1,5 mL com os nomes dos respectivos genes.
2. Pipetar os seguintes itens em cada eppendorf identificado (mix para meia placa - 24 poos):
H2O 99,4 L
Tampo 10X 53 L
MgCl2 (50 mM)

31,8 L

dNTPs Mix (10 mM)

5,3 L

Primer F (10 mM)

10,6 L

Primer R (10 mM)

10,6 L

SYBR Green diludo*

53 L

Platinum Taq DNA Polimerase

1,4 L

*Diluio do SYBR Green: 1,1 L SYBR Green + 108,9 L H2O


3. Misturar bem o mix com auxlio de uma pipeta.
4. Colocar a placa de 48 poos sobre uma estante de microtubos.
5. Colocar 6 eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e adicionar 45 L do
mix do gene 1 em cada um deles.
6. Com a pipeta multicanal, transferir 10 L do mix do gene 1 em cada pocinho da coluna 1,
2, 3 e 4 das linhas A, B, C, D, E e F.
7. Descartar os eppendorfs auxiliares.
8. Colocar 6 novos eppendorfs de 0,2 mL alinhados na estante (ao lado da placa) e adicionar 45
L do mix do gene 2 em cada um deles.
9. Com a pipeta multicanal, transferir 10 L do mix do gene 2 em cada pocinho da coluna 5,
6, 7 e 8 das linha A, B, C, D, E e F.
10. Descartar os eppendorfs auxiliares.
11. Adicionar 10 L de cDNA (diludo 100X) em cada pocinho correspondente a cada amostra.
11. Os pocinhos F4 e F8 sero os controles negativos dos respectivos genes 1 e 2. Nestes,
adicionar 10 L de H2O, ao invs do cDNA.

Biotecnologia

SUMRIO

158

Dica: Caso se formem algumas bolhas na parede dos pocinhos, as mesmas devero ser
empurradas para baixo com o auxlio de uma ponteira, ou com uma centrfuga de placas. Cuidar
para no contaminar os poos vizinhos.
12. Colocar o adesivo na placa.
Dica: O adesivo deve estar bem fixado para evitar a evaporao dos reagentes.
13. Colocar a placa dentro do equipamento de RT-qPCR para anlise da expresso gnica.
14. Criar ou editar um template e salv-lo com um nome apropriado.
15. Iniciar a reao.
16. Salvar o arquivo e calcular os valores de expresso.

Biotecnologia

SUMRIO

159

5.6 CONFIGURAO DO EQUIPAMENTO STEPONE (APPLIED


BIOSYSTEMS) PARA ANLISES DE EXPRESSO GNICA
Anlises de expresso gnica permitem a identificao de quais genes esto sendo expressos
em determinado tecido em uma determinada situao, alm de permitir a quantificao dos nveis
de expresso.
1. Abrir o programa StepOne (Applied Biosystems).
2. Clicar na janela Setup, aps Run Method e programar a reao:
Etapa inicial de desnaturao 95oC por 5 minutos
(Holding Stage)
40 ciclos

95o C por 30 segundos

(Cycling Stage) 60o C por 30 segundos


72o C por 30 segundos
Curva dissociao 95 C por 15 minutos
(Melt Curve Stage)

60 C por 1 minuto

Dica: na curva de dissociao ocorre um aumento gradual da temperatura (de 0,3 em 0,3 C
por segundo) at chegar aos 95 C. Quando atinge esta temperatura, permanece por 15 min. Aps
permanece 1 min a 60 C.
3. Clicar na janela Setup, aps Plate Setup e, por ltimo, Define Targets and Samples.
Definir os nomes dos genes e das amostras a serem avaliados nos respectivos campos.
4. Clicar na janela Assign Targets and Samples e organizar o layout da placa (distribuio dos
genes e amostras de cada poo, lembrando-se de identificar os controles negativos).
5. Colocar a placa preparada no aparelho.
6. Clicar em Start Run para iniciar o procedimento.

Biotecnologia

SUMRIO

160

CAPTULO 6
ANLISE DE EXPRESSO GNICA EM NVEL DE
PROTENA
ngela Maria Schorr-Lenz, Ivan Cunha Bustamante Filho, Jorge Almeida Guimares, Luclia Santi,
Markus Berger Oliveira, Pmela Maria Seibel, Walter Orlando Beys da Silva

Biotecnologia

SUMRIO

161

6.1 ELETROFORESE DE PROTENAS EM CONDIO DESNATURANTE


EM GEL DE POLIACRILAMIDA SDS PAGE
Protocolo de SDS-PAGE:
A separao de protenas pelo mtodo SDS-PAGE consiste na migrao de protenas em
uma matriz em gel de poliacrilamida, induzida por diferena de potencial eltrico. Esse processo
permite a separao de vrias protenas da amostra por massa molecular, sendo que as menores
ficaro retidas na parte inferior do gel e as maiores, na parte superior. Este protocolo baseia-se no
sitema Mini Protean Tetra da Bio-Rad.
SDS-PAGE preparo das solues:
1. Tampo de corrida concentrado 10X (Running Buffer) pH 8,3:
1 L
Glicina

144 g do produto

SDS 10 g do produto
Tris 30,3 g do produto
Dica: dissolver em 1 L de gua destilada. gua ultrapura pode ser utilizada para evitar o
crescimento de fungos na soluo estoque. No ajustar o pH com cidos ou bases, pois altera as
caractersticas inicas do tampo. Armazenar a 4C. Se ocorrer precipitao, aquea a temperatura
ambiente antes do uso.
2. Tampo de corrida 1X (Running Buffer) Soluo de uso:
Diluir o Running Buffer 10X 1:10 em gua destilada. Por exemplo, 50 mL de soluo
concentrada em 450 mL de gua destilada. Guardar na geladeira e utilizar gelado.
Dica: pode ser utilizado pelo menos 3 x.
3. Soluo de Acrilamida 40% (39:1):
100 ml
Acrilamida (39%)

39 g do produto

Bisacrilamida (1%)

1 g do produto

Homogeneizar os reagentes em um bquer com o auxlio de um basto de vidro e ajustar


o volume. Filtrar. A soluo deve ser armazenada a 4C em um frasco mbar, coberto de papel
alumnio e sob refrigerao.
4. Tampo Tris 1,5 M pH 8,8:
150 ml
Tris 27,23 g do produto
gua ultrapura

80 mL

Ajustar o pH a 8,8 com HCl 6N. Adicionar gua ultrapura para obter o volume final de 150
mL. Armazenar a 4C.
5. Tampo Tris 0,5 M pH 6,8:
100 ml
Tris 6 g do produto
gua ultrapura

Biotecnologia

60 mL

SUMRIO

162

Ajustar o pH a 6,8 com HCl 6N. Adicionar gua ultrapura para obter o volume final de 100
mL. Armazenar a 4C.
6. Soluo de SDS 1%:
Para 100 mL, pesar 1 g de SDS. Homogeneizar gentilmente em 90 mL de gua ultrapura com
barra magntica para evitar bolhas em excesso. Ajustar para 100 mL e armazenar a temperatura
ambiente.
7. Soluo de Persulfato de Amnio (APS) 10%:
Para 100 mL de soluo, pesar 10 mg de APS. Em um bquer, dissolver o APS em 80 mL de
gua ultrapura. Aps completa dissoluo, ajustar em balo volumtrico para 100 mL. Aliquotar
em microtubos de 0,5 a 1 mL e armazenar a -20C.
Dica: o reagente APS higroscpico. Mant-lo em um frasco fechado com slica para evitar a
degradao do mesmo.
SDS-PAGE preparo do gel de poliacrilamida:
1. Preparar os suportes e placas de vidro para polimerizar o gel;
Dica: os suportes que prendem as placas de vidro devem ser montados primeiro e aps,
fixados no suporte maior. Encaixar e nivelar as placas de vidro em superfcie plana, para evitar o
vazamento do gel.
2. Preparar o gel de separao de poliacrilamida em um bquer;
Para cada gel de 0,75 mm, preparar as solues abaixo:
Soluo de gel de separao (Resolving gel) 10%
Acrilamida (40%)

1270 L do produto

Tris 1,5 M

850 L do produto

SDS 1%

350 L do produto

Glicerol

280 L do produto

gua ultrapura

2190 L do produto

Dica: colocar as solues na ordem descrita e homogeneizar aps cada uma. Para acrescentar
o Glicerol, deve-se cortar a ponteira, para facilitar a pipetagem.
3. Acrescentar 35 L de Persulfato de Amnio 10% e 3 L de Temed no bquer e homogeneizar;
4. Transferir imediatamente a soluo do gel de separao de poliacrilamida entre as duas
placas de vidro, at quase 1,5 cm do final da placa menor, aguardar para ver se no h vazamentos
e pipetar lcool etlico absoluto at o topo da placa;
Dica: marcar a placa de vidro com uma caneta at o ponto onde a soluo do gel de acrilamida
foi pipetada. O lcool etlico isola o gel de separao do ar, permitindo uma borda de gel lisa. SDS
0,1% tambm pode ser usado.
5. Aguardar a polimerizao 30 minutos;
Dica: nos minutos finais, prepara-se a soluo do gel de entrada de poliacrilamida (prximo
passo).

Biotecnologia

SUMRIO

163

6. Preparar a soluo do gel de entrada de poliacrilamida;


Soluo de gel de entrada (Stacking gel) 4,5%
Acrilamida (40%)

300 L do produto

Tris 0,5 M

690 L do produto

SDS 1%

270 L do produto

gua ultrapura

1400 L do produto

7. Descartar, por inverso e com o auxlio de um papel absorvente, o lcool etlico das placas
contendo o gel de separao polimerizado;
Dica: no desmontar os suportes, apenas descartar o lcool por inverso dos mesmos. Retirar
o excesso com papel filtro.
8. Acrescentar 2,5 L de Persulfato de Amnia 10% e 27 L de Temed no bquer;
9. Transferir a soluo do gel de entrada de poliacrilamida em cima do gel de separao
polimerizado, at o final da placa;
10. Inserir o pente de plstico, que dar o formato dos poos do gel de entrada;
Dica: proteja seus olhos durante esse procedimento, pois h possibilidade de respingos no
momento da insero do pente.
11. Aguardar a polimerizao 30 minutos;
12. Retirar o pente de plstico e utilizar o gel;
Dica: caso no utilize o gel imediatamente, guarde o mesmo na geladeira, envolto por papel
umedecido com gua destilada e plstico filme, dentro de um recipiente com tampa. O gel pode ser
utilizado em at trs dias.
SDS-PAGE preparo das amostras:
1. Descongelar e manter as amostras no gelo;
2. Para cada amostra a ser pipeta no gel, preparar um microtubo e identific-lo com o nome
ou nmero da amostra;
3. Preparar o Tampo de amostra (Stock Sample Buffer) conforme abaixo:
Tris 0,5 M (pH 6,8)

1,25 mL do produto

SDS 10% (p/v)

2 mL do produto

Glicerol

2,5 mL do produto

gua ultrapura

3,55 mL do produto

Azul de Bromofenol 0,5% (p/v) 0,2 mL


Este tampo pode ser estocado em um tubo de 15 mL a temperatura ambiente. No dia do uso,
a quantidade necessria deve ser aliquotada em microtubo e adicionada de 5% de -mercaptoetanol,
sendo esta a soluo de uso.
4. Para preparar a amostra para aplicar no gel, deve-se determinar a quantidade de protena
total a ser carregada no poo. Isto deve ser definido experimentalmente. Para gis corados com
Coomassie Blue, 20 g so geralmente suficientes. Para Western blot, este valor pode chegar a 80 g.

Biotecnologia

SUMRIO

164

Ex. Se uma amostra tem 10 g/L, deve ser pipetado:


2 L de amostra (total de 20 g)
4 L de tampo de amostra com -mercaptoetanol
10 L de agua ultrapura (qsp para 16 L)
5. Colocar os microtubos em banho com gua fervente por 5 minutos para promover a
desnaturao das protenas. Homogeneizar os tubos em vrtex e centrifugar a baixa rotao antes
de aplicar no gel.
SDS-PAGE:
1. Preparar a cuba de eletroforese: encaixar as placas de vidro com o gel no suporte com
eletrodos e preencher as cisternas interna e externa com o tampo de corrida 1X gelado;
Dica: verificar se as placas esto encaixadas corretamente, pois pode ocasionar a interrupo
do processo posteriormente. Encher primeiro a cisterna interna para verificar se ocorre algum
vazamento. Se sim, remonte o sistema.
2. Apos encaixar a guia de pipetagem amarela, pipetar gentilmente as amostras nos poos,
evitando a mistura e derramamento para os poos vizinhos;
Dica: encaixar a pipeta exatamente entre as duas placas de vidro, acima do poo a ser
pipetado, inclinando-a suavemente.
3. Pipetar o marcador de massa molecular;
Dica: pode-se aquecer um pouco o marcador antes de pipet-lo, para torn-lo mais
homogneo.
4. Cobrir com o restante do tampo de corrida os suportes e as placas de vidro, at a marcao
da cuba (para 2 ou 4 gis);
5. Encaixar a tampa da cuba, ajustar a voltagem (60-120V) ou amperagem e iniciar a corrida;
Dica: usar uma voltagem menor (60-80V) enquanto as protenas estiverem no gel de entrada.
Quando estas entrarem no gel de separao, pode-se aumentar a voltagem (90-120V). A tampa deve
ser encaixada corretamente, levando-se em conta a disposio dos eletrodos e os polos (negativo/
positivo). O final da corrida depende do tipo de protena que se pretende visualizar (alto ou baixo
peso molecular). Nos gis de 10%, a frente de corrida (linha azul) deve sair do gel. Em gis de 12 ou
14% o gel deve correr 10 a 20 minutos a mais aps a sada da frente de corrida. O uso de marcadores
de massa molecular pr-corados auxilia no acompanhamento da corrida.
6. Aps o trmino da corrida, proceder com o Western Blotting ou colorao com Coomassie;
Referncias:
AUSUBEL FM, Brent R, Kingston RE, Moore DD, Seidman JG, Smith JA, Struhl K (eds.) Current Protocols in
Molecular Biology, John Wiley & Sons, 2003.
LAEMMLI UK, Cleavage of structural proteins during the assembly of the head of bacteriophage. Nature, 227,
680685 (1970).

Biotecnologia

SUMRIO

165

6.2 MTODOS DE COLORAO DE GIS SDS-PAGE


Diversos mtodos de colorao de gel SDS-PAGE podem ser utilizados. O mais comum o
Comassie Blue (coloidal ou no), capaz de detectar, no mnimo, 5 mg de protena. Para quantidades
menores de protena pode-se utilizar a colorao de prata (10 ng). A colorao do gel um passo
importante, visto que desta forma pode-se visualizar as protenas separadas pela eletroforese.
1. Comassie Blue
1.1 Aps a eletroforese, remover cuidadosamente o gel das placas de vidro e colocar em um
recipiente com dimenso que comporte a imerso do mesmo.
1.2 Adicionar o corante Comassie Blue at cobrir inteiramente o gel.
1.3 Homogeneizar gentilmente de 2 a 16 horas no homogeneizador automtico.
1.4 Para descorar, utilizar soluo descorante.
Dica: se deseja acelerar o processo, pode-se adicionar gua e levar ao micro-ondas algumas
vezes, por 2 minutos (trocar a gua e entre as fervuras).
Comassie Blue #1
0,1%
50%

Comassie Blue R250


Metanol*

*abrir em capela de exausto

Comassie Blue #2
2g
100 mL
475 mL
425 mL

Comassie Blue R250


cido actico
Etanol
H2O destilada

Soluo descorante #1
100 mL
450 mL
450 mL

cido actico
Metanol
H2O destilada

Soluo descorante #2
80 mL
210 mL
510 mL

cido actico
Etanol
H2O destilada

2. Comassie coloidal
2.1 mais sensvel que o Comassie Blue.
2.2 Da mesma forma que o anterior, aps a eletroforese, remover cuidadosamente o gel das
placas e acondicionar em um recipiente especfico.
2.3 Adicionar o corante Comassie Blue at cobrir inteiramente o gel.
leve.

2.4 Homogeneizar gentilmente de 2 a 16 horas no homogeneizador automtico com agitao


2.5 Para descolorar, remover a soluo e adicionar gua destilada.

Biotecnologia

SUMRIO

166

Comassie coloidal
0,05%
10%
20%
2%

Comassie Blue G*
Sulfato de amnio
Metanol
cido fosfrico

*deve ser adicionado por ltimo e no ser agitado pode-se mexer levemente com um basto de vidro. Manter protegido da luz a
temperatura ambiente.

3. Colorao de prata (Blum et al. 1987)


3.1 uma colorao muito sensvel e o gel deve ser manipulado o mnimo possvel.
3.2 Aps a eletroforese, remover o gel cuidadosamente e colocar em um recipiente com
dimenso que comporte a imerso do mesmo.
3.3 Cobrir o gel com 50 mL metanol / 12 mL cido actico / 50 L formaldedo / 38 mL gua
e deixar por 1 hora a temperatura ambiente.
3.4 Lavar o gel com etanol 50%, 3 x por 20 minutos.
3.5 Adicionar 0,02% de soluo de tiossulfato de sdio (0,01 g em 50 mL gua) e aguardar 1
minuto.
Dica: separar 1 mL para cada gel a ser corado.
3.6 Lavar com gua 3 x por 20 segundos.
3.7 Adicionar 100 mL de soluo de colorao fresca e manter por 20 minutos no escuro.
3.8 Lavar com gua 2 x por 20 segundos.
3.9 Adicionar soluo de revelao at surgirem as bandas.
3.10 Parar a revelao com cido actico 1% (1 mL em 99 mL gua).
Soluo de colorao*
0,1 g
38 mL
50 mL

Nitrato de prata
Formaldedo 37%
H2O destilada

*utilizar luvas para manipular a prata.

Soluo de revelao
3g
25 L
1 mL
49 mL

Carbonato de sdio
Formaldedo 37%
Tiossulfato de sdio 0,02%
H2O destilada

Biotecnologia

SUMRIO

167

6.3 IMUNOIDENTIFICAO DE PROTENAS POR WESTERN


BLOTTING
A tcnica de Western Blotting baseia-se na transferncia de protenas separadas previamente
por eletroforese em gel de poliacrilamida, por induo de carga eltrica, para uma matriz no porosa,
tipicamente membranas de nitrocelulose ou PVDF (polyvinylidene difluoride). Nesta matriz, as
protenas so marcadas por anticorpos contra a protena de interesse, podendo ser quantificada
por quimiluminescncia ou reao cromognica. O presente protocolo est otimizado para uso do
TransBlot Turbo da Bio-Rad.
Western Blotting preparo de solues:
Antes de iniciar o experimento, preparar as seguintes solues:
1. Soluo de Tampo de transferncia (Towbin), pH 8,3
1 L
Tris 0,025 M

3,0285 g do produto

Glicina 0,192 M

14,4134 g do produto

20% de Metanol

200 mL do produto

Em um bquer, homogeneizar o Tris e a Glicina com agitador magntico em 700 mL de gua


destilada. Ajustar o pH e avolumar com gua destilada para 800 mL. Aps, adicionar 200 mL de
Metanol. Armazenar em frasco mbar, sob refrigerao.
2. Soluo de PBS concentrado 10X pH 7,4
1 L
NaCl 80 g do produto
KCl 2 g do produto
Na2HPO4

14,4 g do produto

KH2PO4

2,4 g do produto

gua ultrapura

800 mL do produto

Em um bquer, homogeneizar todos os reagentes com agitador magntico. Ajustar o pH e


avolumar com gua ultrapura.
3. Soluo de PBS 1X pH 7,4
Para preparar 1 L, adicionar em proveta graduada 100 mL de PBS 10X, e 900 mL de gua
ultrapura. Para prevenir uma possvel contaminao, transferir a soluo da proveta para um frasco
autoclavado.
4. Soluo de T-PBS (PBS + Tween 20 0,05%)
Em 250 mL de PBS, adicionar 125 L de Tween. Homogeneizar gentilmente (para evitar a
formao de espuma). Armazenar 4C.
5. Soluo de M-T-PBS (PBS + Tween 20 0,05% acrescido de 5% de leite em p desnatado).
Em 20 mL de T-PBS, adicionar 1 g de leite em p desnatado. Homogeneizar com barra
magntica. Utilizar para bloqueio a membrana de nitrocelulose/PVDF ou para diluir anticorpos.
Dica: pode ser armazenado congelado para posterior utilizao. Ateno: alguns anticorpos
no podem ser diludos em M-T-PBS, assim, recomenda-se a substituio do leite em p desnatado
na soluo de bloqueio por albumina srica bovina (BSA), em concentraes de 0,1 a 1%.

Biotecnologia

SUMRIO

168

Western Blotting:
1. Preparar um recipiente e adicionar o Towbin a uma quantidade suficiente para cobrir toda
a membrana.
Dica: o recipiente deve ter tampa e dimenses ideais para abrigar a membrana.
2. Apos o trmino da eletroforese SDS-PAGE, retirar o gel reserva-lo no recipiente com
Towbin por 10 minutos.
Dica: o gel pode ser cortado na regio de interesse, isto resulta em menos rea de membrana a
ser utilizada e, consequentemente, economia de membrana e anticorpos. O gel deve ser cortado em
cima da placa de vidro que o abriga, e observando-se a marcao do marcador de peso molecular.
O enxgue pode durar at dez minutos, tempo suficiente para preparar o cassete do equipamento
de Western Blotting.
3. Colocar o papel filtro no cassete do equipamento de Western Blotting, e umedecer
generosamente com Towbin;
4. Cortar a membrana de nitrocelulose no tamanho exato do gel e coloc-la no centro do
cassete, com o lado mais brilhante para cima;
5. Colocar o gel exatamente em cima da membrana de nitrocelulose;
Dica: cuidar para no ficar nenhuma bolha entre a membrana de nitrocelulose e o gel, pois
pode atrapalhar na transferncia das protenas.
6. Colocar gentilmente outro papel filtro umedecido generosamente com Towbin por cima do
gel no cassete do equipamento.
7. Remover o excesso de bolhas passando o rolo plstico por cima do papel filtro;
8. Fechar o cassete e encaix-lo no equipamento TransBlot Turbo;
9. Iniciar a transferncia de protenas, selecionando a amperagem/voltagem e o tempo.
O equipamento possui diversos programas que podem ser padronizados para cada tipo de
amostra ou massa molecular da protena de interesse. Para o protocolo padro de um minigel no
cassete A, acesse os seguintes comandos:
List > Bio-Rad > 1 mini gel > StandardSD > Run > A:Run
10. Encerrada a transferncia, retirar o cassete do equipamento e abri-lo com cuidado.
Descartar tudo, menos a membrana de nitrocelulose;
Dica: use marcador pr-corado para confirmar se a transferncia ocorreu corretamente.
Alternativamente, pode-se corar a membrana de nitrocelulose com uma soluo de Ponceau S 0,1%.
100 mL de Ponceau 0,1%
Ponceau S

0,1 g do produto

cido Actico

5 mL do produto

Na2HPO4

14,4 g do produto

KH2PO4

2,4 g do produto

gua ultrapura

80 mL do produto

Ajustar para 100 mL com gua ultrapura. Armazenar 4C, no congelar. A soluo pode ser
reutilizada para corar membranas at 10 vezes.
11. Proceder com o bloqueio da membrana: colocar a membrana de nitrocelulose em um
recipiente com MTPBS, tendo o cuidado de cobrir ela totalmente. Incubar em agitador orbital por
1h a 4C.
Dica: cortar um das pontas da membrana para identificar a posio do marcador e o sentido
da pipetagem.

Biotecnologia

SUMRIO

169

12. Descartar o MTPBS;


13. Incubar a membrana com o anticorpo primrio (6 a 16 horas), homogeneizando sob
refrigerao;
Dica: certificar-se de que a membrana est totalmente submersa, para ocorrer a ligao dos
anticorpos s protenas.
14. Aps a incubao, retirar o anticorpo primrio e guard-lo no respectivo tubo e congello. Anotar o nmero de utilizaes.
vezes;

15. Cobrir a membrana com TPBS. Agitar por 5 minutos e descartar. Repetir essa lavagem 5

16. Descartar o TPBS da ltima lavagem e incubar a membrana com o anticorpo secundrio.
Agitar sob refrigerao por 2 horas;
17. Ao final da incubao, retirar o anticorpo secundrio e guard-lo no respectivo tubo e
congel-lo. Anotar o nmero de utilizaes.
18. Cobrir a membrana com TPBS. Homogeneizar por 5 minutos e descartar. Repetir essa
lavagem 5 vezes;
19. Preparar o e-cran, colocando a membrana entre o plstico dobrado;
Dica: fazer uma marcao no plstico das dimenses da membrana para facilitar a visualizao
na sala de escura. Esta marcao importante tambm para a identificao dos marcadores de
massa molecular.
20. Preparar o reativo ECL: para uma membrana inteira, recomenda-se o uso de 200 uL de
reagente ECL. Para prepar-lo, homogeneizar em vortex propores iguais dos dois reagentes em
um microtubo, ou seja, 100 uL de cada.
Dica: a preparao do reativo deve ser feita ao abrigo de luz e o mesmo deve ser pipetado
imediatamente sobre a membrana. Este procedimento est adaptado para o Western Lightnin PlusECL da PerkinElmer. Caso outros reagentes forem utilizados, o protocolo deve ser adaptado de
acordo com as recomendaes do fabricante.
21. Pipetar o reativo ECL em cima da membrana de nitrocelulose, distribuindo uniformemente;
22. Fechar o e-cran, aguardar 5 minutos e iniciar a revelao na sala escura;
23. Cortar um pedao do filme radiogrfico e posicion-lo em cima da membrana. Fechar o
e-cran e aguardar alguns minutos.
Dica: o tempo de exposio da revelao depender da intensidade da luminosidade
produzida na membrana. Deve ser padronizado para cada filme.
24. Retirar o pedao de filme e mergulhar na soluo de revelao, at aparecerem as bandas.
Aps, mergulhar na soluo de cido actico 10% e, por fim, na soluo fixadora.
Dica: os tempos de exposio do filme membrana e de imerso na soluo reveladora
devem ser ajustados conforme o resultado das primeiras revelaes.
25. Aps imerso na soluo fixadora por, no mnimo, 3 minutos, lavar com gua corrente e
aguardar a secagem;
26. Finalizada a exposio, os filmes so escaneados a 300 pdi em formato TIFF para
quantificao das bandas;
Referncias:
AUSUBEL FM, Brent R, Kingston RE, Moore DD, Seidman JG, Smith JA, Struhl K (eds.) Current Protocols in
Molecular Biology. John Wiley & Sons, 2003.
BIO-RAD. Trans-Blot Turbo Blotting System Instruction manual. Bio-Rad Laboratories, 2010.

Biotecnologia

SUMRIO

170

CAPTULO 7
PRODUO E ANLISE DE BIOPRODUTOS
ngela Gerhardt, Anglica Vincenzi, Brbara Parraga da Silva, Claucia Fernanda Volken de Souza,
Christina Venzke Simes de Lima, Eduardo Miranda Ethur, Greici Raquel Wildner, Luclia Hoehne,
Mariano Rodrigues, Mnica Jachetti Maciel

A anlise de alimentos desempenha importante papel avaliador da qualidade e segurana


dos alimentos. Devido complexidade da sua constituio orgnica, os alimentos muitas vezes so
considerados matrizes difceis de serem manipuladas; o analista dever estar devidamente treinado,
e somente a experincia ao longo dos anos poder fornecer segurana analtica (INSTITUTO
ADOLFO LUTZ, 2005).
Na literatura cientfica encontram-se inmeros mtodos para detectar e quantificar nveis
de contaminantes qumicos e avaliar a autenticidade de alimentos. H necessidade da disposio
de mtodos alternativos de anlises, quando possvel, que estejam ao alcance da maioria dos
laboratrios. Nem sempre o mtodo que faz uso do equipamento sofisticado e dispendioso o
mais adequado; s vezes, dependendo do analito e da sua concentrao em um dado alimento,
a utilizao de metodologia tradicional e de baixo custo torna-se, tambm, muito eficiente.
(INSTITUTO ADOLFO LUTZ, 2005).
Referncias:
Instituto Adolfo Lutz. Normas analticas do Instituto Adolfo Lutz. Mtodos fsico-qumicos para anlise de alimentos.
4. ed. Braslia: Ministrio da Sade, Agncia Nacional de Vigilncia Sanitria, 2005. 1018 p. (Srie A Normas e
Manuais Tcnicos).

Biotecnologia

SUMRIO

171

7.1 MANUTENO DAS CULTURAS


Os microrganismos empregados periodicamente em experimentos de cultivo devem
ser mantidos em meio de cultura slido especfico em temperatura de aproximadamente 4 C.
Periodicamente, devem ser realizados repiques para a manuteno das cepas.
Uma cultura estoque em 20% de glicerol deve ser armazenada em freezer.

7.2 PREPARAO DO INCULO


Esta etapa consiste na ativao e quantificao de clulas microbianas empregadas em
experimentos de cultivo de microrganismos e produo de bioprodutos.
1. Preparar o meio de cultura para a ativao microbiana e os materiais estreis necessrios;
2. Inocular uma colnia isolada da placa de petry em meio de cultura lquido;
3. Colocar o caldo de cultura inoculado em incubadora com agitao orbital (shaker),
overnight, em temperatura adequada para crescimento do microrganismo, normalmente entre 30 37 C;
Dica: nessa fase, ocorre a ativao e o crescimento das clulas microbianas.
4. Aps, padronizar o nmero de clulas do inculo por meio da leitura da densidade tica
(DO) no espectrofotmetro no comprimento de onda de 600 nm at DO600 = 1,0. Caso o inculo
fique mais concentrado necessrio adicionar caldo nutriente especfico;
Dica: o valor da absorbncia deve ficar sempre o mais prximo de 1.
5. Transferir de 5 a 10% (v/v) de inculo padronizado com DO600 = 1,0 para o frasco contendo
o meio de cultura no qual ser conduzido o processo de cultivo do microrganismo e produo do
bioproduto;
6. Iniciar o cultivo em condies adequadas de temperatura e agitao e periodicamente
retirar alquotas para anlises diversas.

7.3 DETERMINAO DE BIOMASSA


Este teste tem o propsito de quantificar a massa de microrganismos ao longo dos processos
de cultivo.
Mtodo do peso seco
1. Acondicionar em estufa (60 C) pelo perodo de 24 horas os tubos Falcon previamente
identificados e desprovidos de tampa;
Dica: essa etapa consiste em eliminar qualquer interferente que possa influenciar na
quantificao da biomassa.
2. Antes de pesar, deixar os tubos Falcon em dessecador at atingirem a temperatura
ambiente;
Dica: manusear os tubos Falcon com luvas, pois a gordura da mo pode influenciar o peso
dos tubos.
3. Pesar os tubos Falcon e anotar as respectivas pesagens conforme identificao prvia;

Biotecnologia

SUMRIO

172

4. Colocar 10 mL do meio de cultivo em um tubo Falcon e centrifugar a 3.500 rpm por 15


minutos 4 C;
5. Retirar o sobrenadante e analisar conforme as metodologias abaixo descritas;
6. Adicionar 10 mL de gua destilada gelada ao tubo Falcon, homogeneizar as amostras com
o auxlio do vrtex e centrifugar a 3.500 rpm por 15 minutos a 4 C;
Dica: as lavagens da biomassa so realizadas com o intuito de eliminar qualquer interferente.
7. Eliminar o sobrenadante;
8. Repetir os itens 6 e 7 por mais duas vezes;
9. Colocar o tubo Falcon com a biomassa em estufa (60 C) at atingir o peso constante;
Dica: o peso constante deve ser atingido aps a permanncia do tubo em 24 horas na estufa.
10. Ao finalizar o tempo de permanncia na estufa, colocar o tubo Falcon com a biomassa em
dessecador at atingir a temperatura ambiente;
11. Realizar a pesagem do tubo Falcon com a biomassa e anotar conforme prvia identificao;
12. Fazer o clculo: (peso final do tubo Falcon com a biomassa) (peso inicial do tubo Falcon
vazio). O resultado ser a quantidade de biomassa formada para uma alquota de 10 mL durante o
cultivo do microrganismo.

7.4 DETERMINAO DA ACIDEZ TITULVEL


Esse mtodo empregado na determinao da acidez titulvel de amostras de alimentos
obtidos por meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados.
Consiste na titulao de uma quantidade conhecida de amostra com uma soluo alcalina,
normalmente de NaOH, de concentrao exata e conhecida (ou seja, padronizada), utilizando como
indicador a fenolftalena.
Mtodo de BRASIL (1981):
Equipamentos:
Balana analtica.
Vidrarias, utenslios e outros:
Basto de vidro;
Erlenmeyer de 125 mL;
Bureta de 25 mL.
Reagentes:
Soluo de hidrxido de sdio (NaOH) 0,1 N;
Soluo alcolica de fenolftalena (C20H14O4) a 1 % (m/v).
1. Preparao conforme tipo de amostra:
1.1. Leite fermentado: Pesar 10 g da amostra, adicionar 10 mL de gua isenta de gs carbnico
e homogeneizar.
1.2. Queijo: Pesar 10 g da amostra, acrescentar cerca de 50 mL de gua morna isenta de gs
carbnico (40 C) e agitar com basto de vidro at dissoluo possvel. Transferir quantitativamente
para balo volumtrico de 100 mL, esfriar em gua corrente e completar o volume. Transferir uma
alquota de 50 mL para um erlenmeyer.

Biotecnologia

SUMRIO

173

1.3. Manteiga: Fundir uma determinada quantidade da amostra em estufa a 40 - 50 C em


bquer. Deixar que ocorra a separao de fase e filtrar a fase lipdica em papel de filtro, recebendo
em outro bquer. Pesar uma alquota de 5 g da gordura filtrada, em bquer de 250 mL, acrescentar
cerca de 40 mL de soluo lcool etlico e ter etlico (1+2) neutralizada.
Dica: gua isenta de gs carbnico: gua fervida e resfriada ou gua recm-destilada.
2. Adicionar s amostras previamente preparadas, conforme 1.1 e 1.2, 10 gotas do indicador soluo alcolica de fenolftalena (C20H14O4) a 1 % (m/v) e 4 a 5 gotas do indicador para amostras
preparadas conforme 1.3.
3. Titular com a soluo de hidrxido de sdio (NaOH) 0,1 N at aparecimento de colorao
rsea persistente por aproximadamente 30 segundos.
4. Clculos:
% em cido ltico = (V x f x 0,9) / m
Onde:
V = volume da soluo de hidrxido de sdio 0,1 N gasto na titulao, em mL;
0,1)

f = fator de correo da soluo de hidrxido de sdio 0,1 N (normalidade real dividida por
0,9 = fator de converso do cido ltico;
m = massa da amostra na alquota, em gramas ou em mL.
Clculo para manteiga:
Soluo alcalina normal (SAN) % = V x f x 100 / m
Onde:
V = volume da soluo de hidrxido de sdio 0,1 N gasto na titulao, em mL;
f = fator de correo da soluo de hidrxido de sdio 0,1 N;
m = massa da gordura, em gramas.

Dica: algumas das amostras no apresentam colorao rsea ntida no fim da titulao,
devido as suas caractersticas prprias de cor opaca ou escura, por isso aconselhvel trabalhar
em ambiente claro e colocar um papel branco embaixo da bureta durante a titulao, dessa forma
facilitando a visualizao da viragem.
Referncias:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos
fsicos e qumicos. Braslia, DF, 1981. v. II, cap. 18, p. 2. cap.15, p. 4-5. cap. 21, p., p. 4-5. cap. 17, p. 5.
MERCK. Reactivos, diagnstica, productos qumicos 1992/93. Darmstadt, 1993. 1584 p.
RICHARDSON,G.H. Dairy products. In: HELRICH, K. (Ed.) Official methods of analysis of the Association of
Official Analytical Chemists: food composition: additives: natural contaminants. 15th ed. Arlington: Association of
Official Analytical Chemists, 1990. v. 2, cap. 33, p. 805.
WOOLLEN, H.(Ed). Food Industries Manual, 20 th ed.New Iork1: Chemical Publishing, 1970.

Biotecnologia

SUMRIO

174

7.5 DETERMINAO DO pH
Esse mtodo empregado na determinao do pH de amostras de alimentos obtidos por
meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados. Fundamentase na medida da concentrao de ons hidrognio na amostra.
Mtodo de BRASIL (1981):
1. Preparao conforme tipo de amostra:
1.1. Produtos lquidos: medir o pH colocando cerca de 50 mL de amostra em um bquer;
1.2. Queijos: adicionar cerca de 20 mL de gua em um bquer de 50 mL. Acrescentar
quantidade suficiente de amostra previamente preparada, misturando com basto de vidro de
modo a obter uma pasta homognea;
1.3. Produtos em p: reconstituir a amostra pesando uma quantidade conhecida de
aproximadamente 10 g e diluir com 100 mL de gua.
2. Realizar a leitura do pH em aparelho pHmetro calibrado.
Referncia:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos fsicos e
qumicos. Braslia, DF, 1981. v. II, cap. 17, p. 5 -6.

Biotecnologia

SUMRIO

175

7.6 DETERMINAO DA MATRIA MINERAL (CINZAS)


Esse mtodo empregado na determinao da matria mineral de amostras de alimentos
obtidos por meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados.
Fundamenta-se na eliminao da matria orgnica a temperatura de 550 C. O produto obtido
denominado de resduo mineral fixo.
Mtodo de BRASIL (1981):
Equipamentos:
Balana analtica;
Mufla;
Chapa aquecedora ou estufa.
Vidrarias, utenslios e outros:
Cadinhos de porcelana;
Dessecador;
Tenaz metlico.
Procedimento:
1. Numerar os cadinhos com lpis de escrever;
Dica: utilizar, preferencialmente, lpis 6B.
2. Calcinar cadinhos para eliminao de possveis interferentes, colocando-os na mufla 550
C por 1 hora;
3. Aguardar os cadinhos atingirem temperatura inferior 300 C;
Dica: deixar a mufla levemente aberta agiliza o processo.
4. Transferir os cadinhos para o dessecador at atingirem temperatura ambiente;
5. Pesar os cadinhos em balana analtica e anotar as massas (peso inicial);
6. Pesar 5 g de amostra;
7. Colocar os cadinhos com a amostra previamente pesada em estufa 105 C ou chapa
aquecedora at que a amostra evapore (amostra lquida) e queime (demais amostras);
Dica: cuidar para que a amostra no respingue e no ferva.
8. Calcinar as amostras na mufla 550 C por 3 horas ou pelo tempo necessrio para estarem
com colorao branco/acinzentada;
Dica: se a amostra ao sair da mufla apresentar colorao enegrecida colocar 2 a 3 gotas de
perxido de hidrognio (H2O2) 3% e retornar a mufla por tempo necessrio para ficarem branco/
acinzentada.
9. Aguardar os cadinhos atingirem temperatura inferior 300 C;
Dica: deixar a mufla levemente aberta.
10. Transferir os cadinhos para o dessecador at atingirem temperatura ambiente;
11. Pesar os cadinhos em balana analtica e anotar as massas (peso final).
Dica: cuidar ao abrir o dessecador, soltar o ar levemente para as cinzas no voarem.
12. Clculo:
Matria Mineral (%) = (Peso final Peso inicial) / massa da amostra x 100

Biotecnologia

SUMRIO

176

Onde:
Peso inicial: Peso do cadinho vazio (g)
Peso final: Peso do cadinho com amostra aps ser retirado da mufla (g)
Referncias:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos
fsicos e qumicos. Braslia, DF, 1981. v. II, cap. 2, p. 3.
MERCK. Reactivos, diagnstica, productos qumicos 1992/93. Darmstadt, 1993. 1584 p.

Biotecnologia

SUMRIO

177

7.7 DETERMINAO DA UMIDADE, VOLTEIS E SLIDOS TOTAIS


Esse mtodo empregado na determinao da umidade de amostras de alimentos obtidos por
meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados. A umidade
determinada pela perda de massa, em condies em que gua e substncias volteis so removidas.
O resduo obtido aps evaporao representa os slidos totais da amostra.
Mtodo de BRASIL (1981):
Equipamentos:
Balana analtica;
Estufa.
Vidraria, utenslios e outros:
Dessecador;
Esptula;
Prolas de vidro com 3 mm de dimetro;
Cpsula de alumnio, ao inox, porcelana ou nquel;
Tenaz metlico.
Procedimento:
1. Colocar a cpsula, em estufa 102 + 2 C, durante uma hora;
2. Esfriar em dessecador e pesar (massa da cpsula vazia);
3. Pesar a amostra preparada e homogeneizada e levar estufa 102 + 2 C, por trs horas;
4. Esfriar em dessecador e pesar;
5. Repetir as duas ltimas etapas anteriores at massa constante;
Dica: diferena de 0,0005 g para cada 1 g de amostra pesada. Ou seja, se pesar 5 g de amostra,
para dizer que a massa est constante a diferena entre uma pesagem e outra deve ser no mximo
de 0,0025 g. As operaes de pesagem devem ser feitas o mais rpido possvel e a secagem deve ser
conduzida sem que haja escurecimento da amostra.
Pesagem conforme tipo de amostra:
Leite em p e soro de leite em p:
Massa da amostra: 5 g;
Temperatura da estufa: 85 + 2 C;
Tempo at a primeira pesagem: 2 horas;
Tempo, na estufa, entre pesagens at massa constante: 30 minutos.
Doce de leite e leite condensado:
Massa da amostra 3 g;
Temperatura da estufa: 85 + 2 C;
Tempo at a primeira pesagem: 6 horas;
Tempo, na estufa, entre pesagens at massa constante: 1 hora.
Creme de leite:
Massa da amostra: 5 g em cpsula com prolas de vidro;
Temperatura da estufa: 102 + 2 C;

Biotecnologia

SUMRIO

178

Tempo at a primeira pesagem: 2 horas;


Tempo, na estufa, entre pesagens at massa constante: 30 minutos.
Queijo:
Massa da amostra: 5 g;
Temperatura da estufa: 102 + 2 C;
Tempo at a primeira pesagem: 3 horas;
Tempo, na estufa, entre pesagens at massa constante: 1 hora.
Manteiga e Margarina:
Massa da amostra: 5 g;
Temperatura da estufa: 102 + 2 C;
Tempo at a primeira pesagem: 3 horas;
Tempo, na estufa, entre pesagens at massa constante: 30 minutos.
Leite fermentado:
Massa da amostra: 5 g em cpsula contendo prolas de vidro;
Temperatura da estufa 102 + 2 C;
Tempo at a primeira pesagem: 4 horas;
Tempo, na estufa, entre pesagens at massa constante: 1 hora.
6. Clculos:
% umidade e volteis = (massa da cpsula vazia + massa da amostra) (peso constante
final) x 100 / massa da amostra
% slidos totais = 100 - % umidade e volteis
Referncias:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos
fsicos e qumicos. Braslia, DF, 1981. v. II, cap. 15, p. 1.

Biotecnologia

SUMRIO

179

7.8 DETERMINAO DE LIPDIOS


Esse mtodo empregado na determinao do teor de lipdios em amostras de alimentos
obtidos por meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados.
Consiste no tratamento da amostra com cido sulfrico e lcool isoamlico. O cido digere as
protenas que se encontram ligadas gordura, diminuindo a viscosidade do meio, aumentando a
densidade da fase aquosa e fundindo a gordura, devido liberao do calor proveniente da reao,
o que favorece a separao da gordura pelo extrator (lcool isoamlico). A leitura feita na escala
graduada do butirmetro, aps centrifugao e imerso em banho-maria.
Mtodo de BRASIL (1981):
Equipamentos:
Banho-maria;
Centrfuga de Gerber.
Vidraria, utenslios e outros:
Butirmetro de Gerber para leite com rolhas;
Pipetadores automticos de 1 e 10 mL;
Reagentes:
cido sulfrico: Para esta anlise o cido sulfrico precisa ter densidade de 1,820 a 1,825.
Colocar 125 mL de gua deionizada em um bquer de vidro. Adicionar 925 mL de cido sulfrico
p.a. lenta e cuidadosamente, em banho de gelo.
lcool isoamlico (C5H12O) Utilizar o p.a. com densidade de 0,81 a 20 C.
Procedimento:
1. Adicionar a um butirmetro, 10 mL da soluo de cido sulfrico;
2. Transferir 11 mL de amostra homogeneizada, para o butirmetro lentamente e pela parede
deste, para evitar sua mistura com o cido;
3. Acrescentar 1 mL de lcool isoamlico;
4. Limpar as bordas do butirmetro com papel de filtro e fechar com rolha apropriada;
5. Envolver o butirmetro em um pano, colocando o bulbo maior na palma da mo, de forma
tal que o dedo polegar exera presso sobre a tampa, impedindo sua projeo;
6. Agitar o butirmetro, de modo a promover a mistura completa dos lquidos no interior do
aparelho, tomando precaues para evitar acidentes e mantendo o polegar sobre a tampa;
7. Centrifugar durante 5 minutos de 1.000 a 1.200 rpm com a rolha para baixo;
8. Transferir para banho-maria a 65 C por 5 minutos com a rolha para baixo;
9. Repetir as operaes de centrifugao e de incubao.
10. Ler a porcentagem de gordura diretamente na escala do aparelho e na base do menisco
formado pela camada de gordura, imediatamente aps retirar o aparelho do banho-maria. Se a
coluna no estiver bem delineada, misturar novamente o contedo do aparelho e repetir os
procedimentos de centrifugao e aquecimento.
Referncias:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos
fsicos e qumicos. Braslia, DF, 1981. v. II, cap. 14, p. 4-5.
MERCK. Reactivos, diagnstica, productos qumicos 1992/93. Darmstadt, 1993. 1584 p.

Biotecnologia

SUMRIO

180

7.9 DETERMINAO DO NITROGNIO TOTAL


Esse mtodo empregado na determinao do teor de protenas de amostras de alimentos
obtidos por meio de processos de cultivo de microrganismos, ou seja, de alimentos fermentados.
O procedimento do mtodo baseia-se no aquecimento da amostra com cido sulfrico para a
digesto, at que o carbono e o hidrognio sejam oxidados. O nitrognio da protena reduzido e
transformado em sulfato de amnia. Adiciona-se hidrxido de sdio concentrado e aquece-se para
a liberao da amnia dentro de um volume conhecido de uma soluo de cido brico, formando
borato de amnia. O borato de amnia formado dosado com uma soluo cida padronizada.
Mtodo de BRASIL (1981):
Equipamentos:
Balana analtica;
Bloco digestor;
Destilador de nitrognio.
Vidrarias, utenslios e outros:
Esptula;
Proveta de 50 mL;
Erlenmeyer de 250 mL;
Bureta;
Pina de Castaloy.
Reagentes:
cido Sulfrico (H2SO4) p.a.
Mistura cataltica:
a) Sulfato de potssio (K2SO4) p.a.;
b) Sulfato de cobre pentahidratado (CuSO4.5H2O) p.a.;
c) Misturar (a) e (b) na proporo de (10+1), triturando at obter um p fino.
Indicador Misto: Pesar 0,132 g de vermelho de metila (C15H15N3O2) e 0,06 g de verde de
bromocresol (C21H14Br4O5S).
Dissolver em 200 mL de soluo de lcool etlico a 70 % (v/v).
Filtrar, se necessrio, e guardar em frasco mbar.
cido brico (H3BO3) a 4 % (m/v): Pesar 4 g de cido brico p.a., transferir para um bquer de
250 mL, adicionar 80 mL de gua, e aquecer sob agitao branda at dissoluo. Resfriar, transferir
para balo volumtrico de 100 mL e completar com gua.
cido sulfrico 0,1 N:
Na capela, adicionar 3 mL do cido sulfrico p.a. em um balo volumtrico de 1 L contendo
500 mL de gua. Avolumar e inverter. Padronizar.
cido clordrico 0,1 M:
Na capela, adicionar 8,3 mL do cido clordrico p.a. em um balo volumtrico de 1 L contendo
500 mL de gua. Avolumar, inverter. Padronizar.
Hidrxido de sdio NaOH 40% (m/v): Pesar 40 g de NaOH p.a.

Biotecnologia

SUMRIO

181

Aos poucos ir adicionando as 40 g de NaOH em 100 mL de gua, em banho de gelo. Agitar


at dissolver. Avolumar para 100 mL.
Procedimento:
Parte 1: Preparo inicial
1. Pesagem de amostra: Pesar 5 g para leite fludo e bebida lctea; 3 g para creme de leite; 0,5
g para leite desidratado, soro desidratado, queijo e doce de leite. Para produtos muito gordurosos,
digerir a amostra com adio de um antiespumante. Preparar junto com as amostras uma prova em
branco;
Dica: quando a balana analtica no suportar o peso do tubo de protena e no for possvel
pesar diretamente no tubo, pode-se pesar em papel filtro e algodo. Aps, transferir o mesmo para
o tubo cuidando para no haver perda de amostra.
2. Colocar 2,5 g de mistura cataltica;
3. Em capela de exausto, colocar 15 mL de cido sulfrico P.A. lentamente.
Dica: a quantidade de cido sulfrico adicionada pode variar entre uma amostra e outra
devido s caractersticas do produto. Algumas dicas importantes: 1 g de gordura consome 18 g
de cido; 1 g de protena consome 9 g de cido; 1 g de carboidrato consome 7 g de cido; 1 g de
sacarose consome 7 g de cido.
Parte 2: Digerir amostra no bloco digestor
4. Fechar a abertura do tubo com papel alumnio, deixando uma pequena abertura acima de
cada tubo para sada do vapor;
5. Colocar as amostras no bloco digestor e deixar at que no reste nada da colorao escura,
ficar de outra cor, verde ou um tom azulado quando estiver pronto. A temperatura dever ser
elevada gradativamente at 400 C conforme sugesto abaixo ou de acordo com as instrues do
equipamento.
Curva de aquecimento no bloco digestor:
- 100 C por 20 min
- 200 C por 30 min
- 250 C por 30 min
- 300 C por 30 min
- 400 C at que digerir a amostra.
O processo demora em mdia 2h50min.
Dica: se a amostra no digerir corretamente, ou seja, restar algum resqucio de colorao
escura, adicionar um pouco mais de cido sulfrico p.a. e retorn-las ao bloco digestor com escala
direta.
6. Quando as amostras estiverem digeridas, retir-las e deixar esfriar. Adicionar
aproximadamente 10 mL de gua deionizada.
Parte 3: Destilar amostra
7. Adaptar o tubo de Kjeldahl ao destilador e adicionar a soluo de hidrxido de sdio a 40
% at que a mesma se torne negra (cerca de 20 mL);
8. Proceder a destilao coletando cerca de 100 mL do destilado. A soluo receptora deve
ser mantida fria durante a destilao.
Preparao da soluo receptora para recolher o destilado: Pingar 5 gotas de indicador
misto. Adicionar 50 mL de gua deionizada/destilada + 20 mL de cido brico 4%.

Biotecnologia

SUMRIO

182

Dica: ao pingar as gotas de indicador misto, observar. Se essas ficarem verdes, porque o
erlenmeyer est contaminado.
Parte 4: Titulao
9. Titular com soluo de cido sulfrico 0,1 N ou soluo de cido clordrico 0,1 M at a
viragem do indicador.
Clculo:
Protena Bruta % = (Va-Vb) x M x 6,38 x 0,014 x 100/ m
Onde:
Va= Volume de HCl 0,1 M ou H2SO4 0,1 N gasto na titulao
Vb= Volume de HCl 0,1 M ou H2SO4 0,1 N gasto na prova em branco
N= Normalidade real do cido utilizado para a titulao
6,38= Fator de transformao do nitrognio em protena, especfico para derivados lcteos
0,014= Miliequivalente grama do nitrognio
m= massa da amostra em gramas
Referncia:
BRASIL. Ministrio da Agricultura. Secretaria Nacional de Defesa Agropecuria. Laboratrio Nacional de Referncia
Animal. Mtodos analticos oficiais para controle de produtos de origem animal e seus ingredientes: mtodos
fsicos e qumicos. Braslia, DF, 1981. v. II, cap. 2, p. 3-6.

Biotecnologia

SUMRIO

183

7.10 DETERMINAO DE PROTENA SOLVEL


Diversos estudos determinaram a quantidade de protenas solveis pelo mtodo de Lowry,
que um mtodo colorimtrico para a dosagem de concentrao de protenas. Este mtodo baseiase numa mistura contendo molibdato, tungstato e cido fosfrico (reagente Folin-Ciocalteau), que
sofre uma reduo quando reage com protenas na presena de Cu (II), reduzindo o composto com
absoro mxima em 750 nm .
Esta tcnica muito utilizada para determinar protenas em alimento e no tecido animal;
porm, apesar de ser bastante sensvel, pode estar sujeita ao de diversos interferentes. Estes
interferentes podem aumentar o valor de absorvncia do branco ou a formao de algum tipo de
precipitado. O uso de tricloroactico, para provocar a precipitao das protenas, elimina a maior
parte de interferentes deste mtodo.
Mtodo LOWRY (1951):
Equipamentos:
Balana analtica
Espectrofotmetro
Vidrarias, utenslios e outros:
Bequer 50 e 100 mL
Tubos de ensaio
Basto de vidro
Proveta de 100 mL
Esptula
Pipeta
Reagentes:
Sulfato de Cobre Pentahidratado
Citrato de Sdio
Carbonato de Sdio
Hidrxido de Sdio
Folin Ciocaltens 2N
Albumina Bovina
Procedimento:
a) Fazer os reagentes A, B, C e D
Reagente A: Dissolver 0,5 g de sulfato de cobre pentahidratado e 1 g de citrato de sdio em
100 mL de gua destilada.
Reagente B: Dissolver 1 g de carbonato de sdio e 0,2 g de hidrxido de sdio em 50 mL de
gua destilada.
Reagente C: juntar uma parte do reagente A + 50 partes do reagente B. Preparar no momento
da anlise.
Reagente D: Partes iguais de reagente de Folin Ciocaltens 2 N e gua (proporo 1:1). Pode
ser estocada j sob a forma diluda.
b) Para fazer o padro de Albumina Bovina (BSA: Bovine Serum Albumine):

Biotecnologia

SUMRIO

184

Fazer uma soluo de 5 mg/mL, pesando 0,5 g de albumina bovina em 100 mL de gua
destilada.
c) Primeiramente, faz-se a curva para a albumina. O preparo pode ser em tubos de ensaio ou
em frascos plsticos.
Concentrao

Volume da soluo

Volume de gua

Ponto da curva

Protena

de BSA

destilada

Tubo A
Tubo B
Tubo C
Tubo D
Tubo E
Tubo F

(mg/mL)
0
0,1
0,2
0,3
0,4
0,5

(0,5 mg/mL) em L
0
40
80
120
160
200

L
2000
1960
1920
1880
1840
1800

d) Retirar 500 L de cada tubo da curva anterior e transferir para novos tubos de ensaio (ou
outros frascos de plstico). Fazer em triplicatas, ou seja:
Para a construo da curva para a leitura no espectrofotmetro:
Tubo 1: 500 L do tubo A da tabela anterior + 2,5 mL de reagente C
Tubo 2: 500 L do tubo B da tabela anterior + 2,5 mL de reagente C
Tubo 3: 500 L do tubo C da tabela anterior + 2,5 mL de reagente C
Tubo 4: 500 L do tubo D da tabela anterior + 2,5 mL de reagente C
Tubo 5: 500 L do tubo E da tabela anterior + 2,5 mL de reagente C
Tubos 6 , 7 e 8: 500 L da amostra + 2,5 mL de reagente C
Deixar todos os tubos a temperatura ambiente por 10 min.
e) Adicionar em todos os tubos 250 L do reagente D (Reagente de folin-Ciocaltens e gua
1:1) e aguardar por 30 min.
f) Ler no espectrofotmetro a 750 nm.
g) Construir a curva e fazer o grfico concentrao (mg/mL) x absorbncia. Verificar a
equao da reta.
Observao: a amostra deve ser diluda de forma que sua concentrao fique dentro da
amplitude da curva de calibrao.
Referncias:
LOWRY, O. H et al. Protein measurement with the folin phenol reagent. Journal Biol. Chem., p. 265-275, 1951.

Biotecnologia

SUMRIO

185

7.11 ANLISE DAS PROPRIEDADES FUNCIONAIS E NUTRICIONAIS


DE PROTENAS
As propriedades funcionais so definidas como as propriedades fsico-qumicas que afetam
o comportamento do alimento ou de um dos seus componentes, influenciando nas propriedades
sensoriais. As protenas nos alimentos podem ser influenciadas pela composio e sequncia de
aminocidos, estruturas em que se encontram, bem como a polaridade. As principais propriedades
funcionais das protenas em alimentos so: emulsificao, reteno ao leo e capacidade
emulsificante.
As propriedades funcionais das protenas dependem das suas propriedades fsico-qumicas,
expressando o comportamento das protenas em um sistema alimentcio. J as propriedades
funcionais de um determinado alimento depende tanto das protenas, como dos outros componentes
da sua composio. As propriedades funcionais podem ser avaliadas quanto a sua afinidade pela
gua, pela sua capacidade das molculas se unirem e formarem uma pelcula, da habilidade em
formar ligaes cruzadas e tambm as que se manifestam pelos sentidos.
7.11.1 Capacidade emulsificante (CE)
A emulso consiste em um lquido imiscvel, sendo assim uma mistura heterognea, na
forma de gotculas com dimetro superior a 0,1 mcron. Para se fazer uma emulso necessrio:
gua, leo, emulsificante e energia mecnica. Quando as gotculas de leo esto imersas na fase
aquosa a emulso classificada como leo/gua; j quando as gotculas de gua esto dispersas na
fase oleosa a mesma classificada como emulso gua/leo .
Qualquer substncia capaz de formar uma mistura homognea, anteriormente imiscvel
chamada de agente emulsificante. Devem ser entendidos como molculas que se aderem s
superfcies das gotculas, formando uma membrana protetora que evita a agregao. As protenas
podem apresentar esta propriedade, pois migram para o interior da emulso leo/gua, tornando
a mistura homognea. A principal funo destes agentes, que possuem grupos hidroflicos e
lipoflicos, promover a formao e estabilidade das emulses.
Adaptado do Mtodo SCHMIDT (2008)
Equipamentos:
Balana analtica
Liquidificador domstico
Centrfuga
Aparelho de banho maria digital
Vidrarias, utenslios e outros:
Bquer 50 e 100 mL
Esptula
Pipeta graduada
Proveta 100 mL
Bureta
Tubos de centrfuga
Proveta graduada
Reagentes:

Biotecnologia

SUMRIO

186

NaCl 3%
leo vegetal
Procedimento:
Prepara-se uma suspenso contendo 1 g de protena com 34 mL de soluo de NaCl 3%,
em liquidificador domstico por 30 segundos em velocidade baixa. Com auxlio de uma bureta
adiciona-se 30 mL de leo vegetal de soja a uma vazo de 10 mL/min sob agitao. A emulso
formada deve ser transferida para tubos de centrfuga e levados a um banho de gua a 85 C por 15
minutos. A seguir, as amostras devem ser centrifugadas a 3000xg por 40 minutos.
Aps a centrifugao, o volume de leo separado em cada amostra deve ser transferido para
uma proveta graduada e efetuada a leitura. A diferena entre a quantidade de leo medido e a
quantidade de leo adicionado expressa como a quantidade de leo emulsificado por grama de
protena contida na amostra e deve ser calculada da seguinte forma:
CE = quantidade de leo emulsificado (mL)

massa de protena (g)

7.11.2 Capacidade de reteno de leo (CRO)


A capacidade de reteno do leo determinada a partir da quantidade que a amostra tem a
capacidade de absorver certa quantidade de leo. O mecanismo de reteno de absoro de leo
atribudo ligao fsica do leo. Observa-se que, quanto maior for a densidade da protena, maior
ser a absoro do leo, devido ao carter hidrfobo da protena.
Equipamentos:
Balana analtica
Chapa com agitao magntica
Barra magntica
Centrfuga
Vidrarias, utenslios e outros:
Proveta 50 mL
Tubos de centrfuga
Becker 50 mL
Proveta
Reagentes:
leo vegetal
Procedimento:
Pesa-se 1 g de protena e mistura-se com 20 mL de leo vegetal de soja e agita-se por 10
minutos em agitador magntico. A seguir, a mistura deve ser centrifugada a 9000xg por 15 min
em centrfuga, e o volume de leo no absorvido medido em proveta graduada. A quantidade de
leo absorvido foi obtida pela diferena entre a quantidade de leo inicial e a quantidade de leo
no absorvida. A capacidade de reteno de leo expressa como a quantidade de leo retido por
grama de protena, e calculada da seguinte forma:
CRO = quantidade de leo absorvido (mL) x 100

Biotecnologia

peso da amostra (g)

SUMRIO

187

7.11.3 Capacidade espumante (CFE)


As espumas consistem de uma fase aquosa e uma gasosa, sendo que as minsculas partculas
de ar dispersas provocam as propriedades sensoriais em produtos com essa propriedade. As
protenas so os agentes ativos que ajudam na formao na formao e na estabilizao da fase
gasosa. Normalmente a formao de bolhas ou simplesmente o fato de agitar uma soluo proteica
criam espumas estabilizadas por protenas.
Podem-se utilizar protenas em alguns tipos de alimentos para estabilizar ou formar espuma.
As protenas formam pelculas, estabilizando-se, ao redor da espuma. A adsoro e unio das
protenas (carter hidrofbico) reduzem a tenso superficial da gua, facilitando a formao de
maior quantidade de espuma, ate que ocorra a estabilidade. Quanto mais facilmente a protenas for
desnaturada, maior ser o seu poder espumante .
A capacidade de formao de espuma, por uma protena, refere-se expanso de volume
com o acrscimo de ar, por batimento, agitao ou aerao. Depende da natureza da protena, da
solubilidade e do estado de desnaturao da protena, da presena de sais e de outros aditivos
utilizados no processamento dos alimentos.
Pode-se medir a capacidade de formao de espuma a partir do aumento do volume de
uma disperso proteica, que pode ser provocada por agitao. Para que as mesmas tenham boa
capacidade de formar espuma, as protenas devem formar uma membrana em torno das bolhas de
ar passando por certo grau de desnaturao que parece ser crtico para a estabilizao das espumas
e de sua estrutura tridimensional.
Geralmente o poder espumante aumenta com a concentrao proteica, at um valor mximo.
A formao de espuma pode ser influenciada pelo pH, sais, acares, lipdios e a concentrao
proteica.
Equipamentos:
Liquidificador
Vidrarias, utenslios e outros:
Proveta graduada
Balana analtica
Esptula
Bquer
Procedimento:
Prepara-se uma suspenso proteica de 5 g de amostra com 100 mL de gua. A suspenso deve
ser agitada em liquidificador domstico por 5 minutos sob agitao mdia, em seguida transfere a
disperso para uma proveta graduada de 250 mL, sendo que a capacidade de formao de espuma
calculada da seguinte forma:
CFE = (B A) x 100
A
Onde: A = volume antes da agitao (mL);

B = volume aps a agitao (mL).

7.11.4 Digestibilidade in vitro


A digestibilidade um fator extremamente importante na determinao do valor nutritivo de
uma protena. As protenas de origem animal apresentam digestibilidade acima de 90%, enquanto
que as de origem vegetal abaixo de 80%; sendo que quando as protenas so isoladas de sua forma

Biotecnologia

SUMRIO

188

natural (com bastantes cuidados) e que sofreram desnaturao, podem apresentar maior grau
de digestibilidade. No entanto, desnaturaes com a ao do calor tendem a diminuir o grau de
digestibilidade.
A digestibilidade de uma protena representa a parte da protena que pode ser hidrolisada
pelas enzimas digestivas; estas protenas seriam ento quebradas em aminocidos, estando
disponveis ao organismo humano. Nestes ensaios, procura-se imitar as condies de acidez do
estmago, sendo por isso chamada in vitro. Consiste numa propriedade importante pois representa
o valor nutritivo de uma protena.
Equipamentos:
Balana analtica
Aparelho de banho Maria digital
pHmetro
Centrfuga
Vidrarias, utenslios e outros:
Esptula
Proveta graduada
Pipeta graduada
Bquer
Tubos de ensaio
Esptula
Bquer 50 mL
Tubos de centrfuga
Pipeta de pasteur
Reagentes:
Pepsina
HCl 0,1 N
Merthiolate incolor
NaOH 0,2 N
Pancretana
Tampo de fosfato
cido tricloro actico 5%
Procedimento:
Inicialmente, pesa-se uma quantidade de amostra que corresponda ao equivalente a 0,5 g
de protena. Prepara-se uma soluo de 1,5 mg de pepsina por mL de HCl 0,1 N, e adiciona-se
15 mL desta soluo amostra. A seguir, adiciona-se 0,5 mL de soluo de merthiolate incolor.
Homogeneiza-se bem e leva-se a banho-maria a 37 C por 3 horas, com agitao peridica. Decorrido
este tempo, os tubos contendo as amostras devem ser resfriados e a soluo ajustada a pH 8,0 com
uma soluo de NaOH 0,2 N, utilizando um pHmetro .
Prepara-se, tambm, uma soluo de 0,5 mg de pancreatina por mL de tampo fosfato pH
8,0. Adiciona-se 10 mL da soluo de pancreatina ao produto hidrolisado pela pepsina e leva-se
novamente ao banho-maria a 37 C, porm por 24 horas com agitao peridica. Aps o tempo de
hidrlise, adiciona-se 5 mL de uma soluo de tricloro actico 5% amostra e centrifuga-se por 15

Biotecnologia

SUMRIO

189

minutos a 5000 xg para separao do material insolvel, sendo o filtrado recolhido para posterior
determinao do nitrognio digerido, pelo mtodo de Kjeldhal.
A digestibilidade in vitro expressa como a porcentagem de nitrognio digerido em relao
ao nitrognio total na amostra inicial, sendo calculada da seguinte forma:
Digestibilidade (%) = Nitrognio digerido x 100

Nitrognio total

Referncias:
A.O.A.C. Official Methods of Analysis. Association of Official Analytical Chemists., 18a edition, v. 1-2, USA. 2005.
ARAJO, J. M. Qumica de alimentos: teoria e prtica. 4 ed. Viosa: UFV, 2008. 596 p.
BALTI, R. et al. Comparative study on biochemical properties and antioxidative activity of cuttlefish (Sepia officinalis)
protein hydrolysates produced by alcalase and bacillus licheniformis NH1 proteases. Journal of amino acides. V. 2,
2011. 11 p.
BELITZ, H. D.; Grosch, W. Qumica de los alimentos. 2a edio. Editora: Acribia, S.A. Zarogoza. Espanha. 1997.
DAMODARAN, S.; Parkin, K.L; Fennema, O.R. Qumica de alimentos de fennema. Traduo Adriano Brabdelli et al.
4 ed. Porto Alegre: Artmed, 2010. 900 p.
KRISTINSSON, H. G.; Rasco, B. A. Fish protein hydrolysates: production, biochemical, and functional properties.
Critical reviews in food science and nutrition. v. 40, p. 43. 2000.
LOWRY, O. H et al. Protein measurement with the folin phenol reagent. Journal Biol.Chem., p. 265-275, 1951.
SCHMIDT, C. G. Hidrlise enzimtica das protenas de carne de frango. Dissertao de Mestrado. Fundao
Universidade Federal do Rio Grande (FURG), Rio Grande: FURG, 2008, 130 p.
SGARBIERI, V.C. Protenas em alimentos proticos: propriedades, degradaes, modificaes. 1. Ed. So Paulo:
Varela, 1996. 517 p.
ZAIA et al. Determinao de protenas totais vias epectrofotometria: Vantagens e desvantagens dos mtodos
existentes. So Paulo: Qumica Nova, n.1, v.6. 1998. p 787-793.

Biotecnologia

SUMRIO

190

7.12 DETERMINAO DA ATIVIDADE ANTIOXIDANTE


A oxidao dos lipdios consiste num processo que acarreta a deteriorao de muitos
alimentos, levando os mesmos perda da qualidade e de valor nutricional, podendo, inclusive,
ocasionar a formao de produtos txicos. A oxidao ocasiona a formao de radicais livres, os
quais podem acarretar muitos problemas de sade. A oxidao nos alimentos afeta a cor, flavor,
vitaminas, minerais, carboidratos, lipdios e protenas, sendo necessrio adicionar antioxidantes
aos alimentos.
O efeito antioxidante consiste na inativao dos radicais livres, na complexao dos ons
metlicos ou na reduo de hiperxidos. A escolha de um antioxidante segundo o mesmo deve
estar baseada no seu conhecimento qumico, seu modo de ao, sendo que a estrutura do mesmo
influi nas diferenas de atividades antioxidantes.
Mtodo Adaptado de Mensor et al. (2001)
Equipamentos:
Balana analtica
Espectrofotmetro
Vidrarias, utenslios e outros:
Balo volumtrico de 50 e 100 mL
Esptula
Bquer de 50 e 100 mL
Pipeta automtica
Cubetas de quartzo
Reagentes:
2,2 Difenil-1-Picril-Hidrazila (DPPH) a 0,004%
lcool metlico
cido Ascrbico
Procedimento:
Parte 1:
Preparo da soluo de DPPH a 0,004%
Dissolver 0,004 g de DPPH em lcool metlico e completar o volume para 100 mL em um balo
volumtrico com lcool metlico, homogeinizar e transferir para um frasco mbar, devidamente
etiquetado, ou proteger o balo volumtrico com a soluo de DPPH com papel alumnio. Preparar
e usar no dia da anlise.
Parte 2:
Curva padro cido ascrbico (ou rutina)
Curva padro Controle positivo
A partir de uma soluo estoque do acido ascrbico de 1 mg/ml, diluindo nas concentraes
de 50, 30, 15, 10, 8, 4, 2, 1 e 0,5 g/mL, em metanol (fazer em triplicata).
Obs. Amostra: Incubar, a temperatura ambiente, 2,0 mL da soluo de DPPH e 1 mL das
solues metanlicas de extrato e ou cido ascrbico durante 30 min. (Aconselha-se cronometrar o
tempo exato de cada tubo, para evitar leituras muito heterogneas entre as triplicatas 40 segundos
entre os tubos).

Biotecnologia

SUMRIO

191

Decorrido o tempo de incubao realizar a leitura das amostras em espectrofotmetro em


comprimento de onda de 517 nm.
Preparar um branco da amostra, incubando por 30 min, 2,0 mL de metanol e 1 mL das
solues do extrato. Ler em 517 nm, zerando o aparelho com o metanol.
Preparar um controle (negativo), incubando por 30 min, 2,0 mL de DPPH e 1 mL de metanol.
Ler em 517 nm, e zerando novamente o aparelho com o metanol.
Este controle negativo pode tambm ser utilizado para zerar o aparelho e, em seguida, efetuar
a leitura das amostras de extrato ou cido ascrbico incubadas com a soluo metanlica de DPPH.
Observaes:
Aconselha-se realizar o ensaio por etapas: em uma manh realizar a curva do cido
ascrbico. tarde ou no outro dia realizar o ensaio das solues metanlicas do extrato e, assim,
sucessivamente;
necessrio fazer um controle negativo e o branco das amostras especficos para cada etapa;
3. Sempre preparar uma nova soluo de DPPH. Nunca armazenar o restante para ser
utilizado outro dia ou perodo.
4. O ideal que as luzes prximas ao local onde o ensaio ser realizado permaneam
apagadas, evitando-se a interferncia da mesma nas anlises. Aconselha-se deixar ligadas apenas
as luzes distante do local ou ainda trabalhar com a luz ambiente.
Amostras
Leitura das medidas de absorbncia das amostras
Partir de uma soluo estoque do extrato bruto de 1 mg/mL, diluindo nas concentraes
de 250, 200, 150, 100, 50, 25 e 5 g mL-1, em metanol (fazer em triplicata). Em ambiente escuro,
transferir uma alquota de 1 mL de cada diluio do extrato para tubos de ensaio ou falcon com
2 mL do radical DPPH (0,1 mM ou 100 M ou 0,004%) e homogeinizar em agitador de tubos. As
absorbncias so lidas em espectrofotmetro a 517 nm, no 1, 5 e 10 min at (de 10 em 10 min
realizar a leitura) onde observada a reduo da absorbncia at a sua estabilizao. Ou faz-se a
leitura em 30 min. se estabilizar neste tempo, como o cido ascrbico.
Utilizar como:
lcool metlico, como branco para calibrar o espectrofotmetro! AUTO ZERO!
BRANCO ( Abs. Branco): 2 mL de metanol com 1 mL das solues do extrato;
CONTROLE NEGATIVO (Abs. controle): 1 mL da soluo metanol com 2 mL do radical
DPPH e homogeinizar.
CONTROLE POSITIVO (Abs. Amostra): 1 mL do cido ascrbico/amostra com 2 mL do
radical DPPH e homogeinizar.
%AA= 100 - (Absamostra-Absbranco * 100)
Abscontrole
Referncias:
A.O.A.C. Official Methods of Analysis. Association of Official Analytical Chemists., 18a edition, v. 1-2, USA. 2005.
ARAJO, J. M. Qumica de alimentos: teoria e prtica. 4 ed. Viosa: UFV, 2008. 596 p.
BALTI, R. et al. Comparative study on biochemical properties and antioxidative activity of cuttlefish (Sepia officinalis)
protein hydrolysates produced by alcalase and bacillus licheniformis NH1 proteases. Journal of amino acides. V. 2,
2011. 11 p.
BELITZ, H. D.; Grosch, W. Qumica de los alimentos. 2a edio. Editora: Acribia, S.A. Zarogoza. Espanha. 1997.

Biotecnologia

SUMRIO

192

DAMODARAN, S.; Parkin, K.L; Fennema, O.R. Qumica de alimentos de fennema. Traduo Adriano Brabdelli et al.
4 ed. Porto Alegre: Artmed, 2010. 900 p.
KRISTINSSON, H. G.; RASCO, B. A. Fish protein hydrolysates: production, biochemical, and functional properties.
Critical reviews in food science and nutrition. v. 40, p. 43. 2000.
MENSOR, L.L et al. Screnning of brazilian plant extracts for antioxidant activity by the use of the DPPH free radical
method.Phytotheraphy Research., v.15,n.2, 2001, pag 127-130.

Biotecnologia

SUMRIO

193

7.13 DETERMINAO DA DEMANDA QUMICA DE OXIGNIO (DQO)


Esse mtodo empregado na determinao da DQO dos resduos gerados aps o processo
de cultivo de microrganismos. O mtodo de refluxo aberto uma medida equivalente em oxignio,
da poro de matria orgnica na amostra suscetvel oxidao por um oxidante qumico forte.
O teste consiste em oxidar a amostra com excesso de dicromato, em meio fortemente cido e sob
refluxo, e determinar a quantidade de dicromato remanescente, por titulao com sulfato ferroso
amoniacal.
Mtodo de STANDARD (2012):
Equipamentos:
Chapa aquecedora.
Vidrarias, utenslios e outros:
Erlenmeyer de fundo chato e boca esmerilhada;
Condensadores;
Mangueiras para conectar condensadores;
Rolo de fita veda rosca;
Garras/suporte para condensadores (1 por erlenmeyer);
Bquer 100 mL;
Bureta de 50 mL;
Proveta 50 mL;
Proveta 250 mL.
Reagentes:
Sulfato de mercrio p.a.;
cido Sulfrico p.a.;
KOH 6%.
cido Sulfrico/Sulfato de prata:
Pesar 10 g de sulfato de prata;
Transferir o contedo para um bquer de 1 L;
Na capela, adicionar 600 mL de cido sulfrico para dissolver o sulfato
Transferir para o balo de 1 L e completar com cido sulfrico p.a.
Dicromato de potssio 0,25 N (Para amostras com DQO > 50 mg/L)
Dica: para amostras com DQO <50 mg/L, utilizar dicromato de potssio com concentrao
de 0,025 N.
Pesar 15 g de dicromato de potssio (K2Cr2O7) em uma cpsula;
Deixar secar por 2 h a 105 C em estufa;
Colocar no dessecador at esfriar;
Em balana analtica pesar 12,259 g de dicromato seco;
Dissolver com gua;
Transferir para balo de 1 L e avolumar.
Sulfato ferroso amoniacal Fe(NH4)(SO4)2

Biotecnologia

SUMRIO

194

Pesar 98 g de sulfato ferroso amoniacal hexahidratado p.a. e dissolver em gua;


Adicionar 20 mL de cido sulfrico p.a.;
Transferir para balo de 1 L e avolumar.
Indicador ferrona
Dissolva 1,485 g de 1-10 fenantrolina monohidratada (C12H8N2.H2O) juntamente com 0,695 g
de sulfato ferroso P.A. (FeSO4.7H2O) em gua destilada e dilua a 100 mL.
Preparo da vidraria
Lavar primeiramente com gua da torneira e sabo;
Passar um pouco de KOH 6%;
Lavar novamente com gua da torneira;
Enxaguar com gua deionizada.
Dica: tomar cuidado porque a vidraria fica lisa!
Procedimento:
1. Pipetar 50 mL da amostra para erlenmeyer de fundo chato de 500 mL.
Dica: para amostras com DQO > 900 mg/L necessrio fazer diluio.
Exemplos de diluio:
Soro de queijo: 1:500
1 mL da amostra em 500 mL de gua (avolumar em balo volumtrico)
Soro de ricota: 1:200
1 mL da amostra em 200 mL de gua (avolumar em balo volumtrico)
2. Adicionar 1 g de sulfato de mercrio e prolas ao mesmo erlenmeyer;
3. Adicionar 5 mL de cido sulfrico/sulfato de prata gelado para o Erlenmeyer,
homogeneizando bem. Esfriar enquanto estiver agitando para evitar a perda de material voltil;
4. Adicionar 25 mL de dicromato de potssio 0,25 N;
5. Conectar erlenmeyers de fundo chato e abrir a gua;
6. Adicionar mais 70 mL de cido sulfrico/sulfato de prata gelado aos erlenmeyers sob
agitao. Antes de ser aquecida, a amostra deve estar bem homogeneizada.
7. Ligar o aquecimento da chapa em 150 C;
8. Deixar por 2 horas no aquecimento (contar a partir do momento em que comea a borbulhar
ou corre pelas paredes).
9. Aps 2 horas no refluxo, desligar a chapa e deixar esfriar. Lavar o condensador com gua
at diluir cerca de duas vezes o volume inicial da amostra. Agitar e deixar at ficar em temperatura
ambiente.
10. Adicionar 2 a 3 gotas de indicador ferrona em cada erlenmeyer.
Titulao:
Titular com sulfato ferroso amoniacal at virar a cor para marrom avermelhado.
Clculos:
DQO (mg/L) = (B - A) x N x 8000
Volume de amostra (mL)
Onde:
B= volume da soluo de sulfato ferroso amoniacal gasto para titulao do branco (mL)

Biotecnologia

SUMRIO

195

A= volume da soluo sulfato ferroso amoniacal gasto para titulao do amostra (mL)
N= Normalidade da soluo de sulfato ferroso amoniacal
8000= equivalente-grama de oxignio para 1 L de gua.
Se for utilizada diluio, multiplicar pelo fator de diluio utilizado.
Referncia:
Standard Methods for the Examination of Water and Wastewater, 22 st edition. Mtodo 5220 B, pg 5-17, 2012.

Biotecnologia

SUMRIO

196

7.14 DETERMINAO DE POLIFENIS TOTAIS


Protocolo para Quantificao de Polifenis Totais em Extratos Secos pelo Mtodo de FolinCiocalteu:
Compostos fenlicos compreendem um dos mais importantes grupos de metablitos
secundrios em plantas, podendo ser divididos em diversas categorias, como fenis simples, cidos
fenlicos, cumarinas, flavonoides, taninos condensados e hidrolisveis, lignanas e ligninas. Podem
atuar na defesa da planta contra agresses do ambiente, bem como agir como antioxidantes devido
a sua habilidade em doar hidrognio ou eltrons gerando radicais intermedirios estveis que
impedem a oxidao de vrios ingredientes em alimentos, em particular da peroxidao lipdica.
Adaptado de Singleton & Rossi (1965) e Souza et al. (2007):
1. Material necessrio:
a. 8 Bales volumtrico de 10 mL
b. 1 Balo volumtrico de 50 mL
c. 4 Becker
d. Tetina
e. 8 Pipeta Pasteur
f. 1 Pipeta automtica de 100-1000 L
g. Cubetas de vidro
h. 2 Tubos de ensaio
i. 1 Espectrofotmetro
j. 1 Balana analtica
k. 1 Banho-maria
l. 1 Vrtex
m. Cronmetro
2. Solventes/ Solues
a. gua destilada
b. Metanol
c. Folin-Ciocalteu 1 N
d. Soluo de carbonato de sdio
- 75g de carbonato de sdio anidro em 400 mL de gua. Ferver a soluo e aps resfriar.
Adicionar cristais de carbonato de sdio, aps 24 horas, filtrar e completar o volume com gua a
550 mL.
e. Soluo de cido Glico
f. Extrato Vegetal seco
3. Cuidados aplicveis:
a. Cuidar com a identificao das Plantas, bem como no misturar duas plantas diferentes no
mesmo processo ao mesmo tempo.
b. Este experimento deve ser realizado com a menos luminosidade possvel.
c. Recomenda-se realizar este experimento sempre em triplicata.

Biotecnologia

SUMRIO

197

4. Procedimento:
- A determinao de fenis totais quantificada por meio de espectrofotometria UV/Vis.
a. Inicialmente, realiza-se a curva padro, utilizando para isso uma Soluo de cido Glico.
b. Para realizar a curva de cido glico, dilui-se em um balo volumtrico de 10 mL, 50 mg
de cido Glico em Metanol.
c. Partindo desta soluo, realizam-se sucessivas diluies em metanol, conforme figura
abaixo, obtendo-se as seguintes concentraes: 500mg/L, 250mg/L, 150mg/L, 100mg/L e
50mg/L.
d. Para o branco foi utilizado apenas o metanol. A Figura 1 mostra o procedimento da
diluio dos padres.
Figura 1: procedimento para a diluio de padres para a determinao de fenis totais

Fonte: dos autores.

e. Em cada tubo de ensaio, acrescenta-se: 40L da soluo; 3,16mL de gua destilada; 200L
de reagente Folin-Ciocalteu 1N e 600L de soluo de Na2CO3saturada previamente preparada.
f. Realiza-se leitura aps 30 minutos em espectrofotmetro em um comprimento de onda de
765 nm.
g. Os dados obtidos so calculados segundo equao da reta, formando uma curva onde R2
deve ser o mais prximo possvel de 1.
h. Ao trmino da construo da curva, procede-se com a pesagem das amostras do Material
Vegetal seco.
i. A concentrao da soluo deve ser de 1mg/mL.
j. Em tubo de ensaio, acrescenta-se: 40L da soluo do extrato; 3,16mL de gua destilada;
200L de reagente Folin-Ciocalteu 1N e 600L de soluo de Na2CO3 saturada previamente
preparada.
40C,

k. Agita-se por 15 segundos em Vrtex, e aps aguardar por 30 minutos em banho-maria a


l. Procede-se com a leitura em espectrofotmetro a 765nm.

m. Para a realizao do branco da amostra, procede-se da mesma forma que na amostra, mas
adicionou-se metanol ao invs da soluo de extrato.
n. Os valores obtidos so comparados com a curva de cido Glico, obtendo assim o valor
em equivalentes de cido Glico (mg de EAG/g de extrato EtOH DP).

Biotecnologia

SUMRIO

198

Referncias:
SINGLETON, V. L.; Rossi, J. A. Colorimetry of Total Phenolics with Phosphomolybdic Phosphotungstic Acid
Reagents. American Journal of Enology and Viticulture. 16:144-158, 1965.
SOUSA, C. M de M. et al. Fenis totais e atividade antioxidante de cinco plantas medicinais. Qumica Nova. 30: 351355, 2007.

Biotecnologia

SUMRIO

199

7.15 AVALIAO QUALITATIVA DE METABLITOS SECUNDRIOS


DE PLANTAS
A pesquisa fitoqumica tem por objetivos conhecer os principais constituintes qumicos de
espcies vegetais ou avaliar sua presena. Classicamente, em anlises preliminares (sem o objetivo
de isolamento de substncias qumicas), a caracterizao dos principais grupos de substncias
vegetais de interesse tem sido conseguida pela realizao de reaes qumicas que resultam
no desenvolvimento de colorao e/ou precipitado caracterstico. Esses ensaios caracterizam
qualitativamente as principais classes desses metabolites, servindo como uma indicao para
possveis propriedades qumicas ou biolgicas.
Adaptado de Brasil (2005), Harbore (1998) e Simes (2004)
Material necessrio:
- 8 Becker 25 mL
- 5 Provetas
- 7 Funis pequeno de vidro
- 7 Papeis filtro
- 1 Tesoura
- 13 Tubos de ensaio
- 5 Tubos de ensaio grande
- Pipeta Pasteur
- Tetina
- 5 Esptulas
- 1 Balana
- 1 Banho Maria
- 4 Grade para tubo de ensaio
- 1 Rgua
- 1 Cronmetro
- 1 Papel alumnio
- 4 Vidros de relgio
- 1 Cadinho (cpsula de porcelana)
- Atilho
- Planta seca e moda
Solventes/ Solues
- gua
- Soluo aquosa de cloreto frrico 1%
- Soluo aquosa de hidrxido de potssio 3%
- Soluo aquosa de gelatina 1%
- Soluo aquosa de cloreto frrico 1%
- N-butanol
- Metanol

Biotecnologia

SUMRIO

200

- cido clordrico concentrado


- 0,1 g de magnsio metlico
- Soluo metanlica de hidrxido de potssio 5%
- Hidrxido de potssio 5%
- cido actico
- Tolueno
- Soluo de hidrxido de potssio 3%.
- cido clordrico 10%
- Reagente de borntrger.
- cido clordrico 10%
- Metanol.
- cido clordrico 10%.
- Reagentes de : mayer, dragendorff, wagner e bertrand.
- Acetona
Cuidados aplicveis:
Cuidar com a identificao das Plantas, bem como no misturar duas plantas diferentes no
mesmo processo ao mesmo tempo.
Este Screening Fitoqumico adaptado das referncias citadas, para utilizar-se como Material
Vegetal o extrato seco da planta, anteriormente preparado.
Procedimento:
Compostos fenlicos
- Pesa-se cerca de 0,5 g dos extratos vegetais;
- Adicionam-se 20 mL de gua destilada e aquece-se em banho-maria fervente durante 30
minutos;
- Aps resfriamento, filtra-se o contedo;
- O contedo deve ser dividido em trs tubos de ensaio (A, B e C);
- No tubo A, adicionam-se algumas gotas de uma soluo aquosa de cloreto frrico 1%.
O desenvolvimento de colorao verde ou azul escura indicativo da presena de compostos
fenlicos;
- No tubo B, adicionam-se algumas gotas de uma soluo aquosa de hidrxido de potssio
3%. O aparecimento ou intensificao da cor amarela ou laranja indicativo da presena destes
compostos;
- O tubo C utilizado como controle para verificao da colorao inicial do extrato.
Taninos
- Pesa-se cerca de 0,1 g dos extratos vegetais;
- Aquece-se em 20 mL de gua destilada por 30 minutos;
- Aps resfriamento, filtra-se e divide-se em trs tubos de ensaio (A, B, C);
A tcnica de deteco baseia-se na propriedade dos taninos de precipitar a gelatina.
- Ao tubo A, adiciona-se 1 mL da soluo aquosa de gelatina 1%, preparada anteriormente.
- Na presena de taninos, haver a formao de turvao ou precipitado.

Biotecnologia

SUMRIO

201

- Este teste no especfico, j que alguns fenis apresentam reao positiva, quando esto
em altas concentraes.
- Para a tcnica de caracterizao, uma reao geral para substncias fenlicas onde a
complexao de hidroxilas com o on Fe2+ leva ao desenvolvimento de substncias de colorao
azulada ou esverdeada, conforme estrutura da molcula.
- Adicionam-se trs gotas da soluo aquosa de cloreto frrico 1%, preparadas anteriormente,
ao tubos B, contendo os extratos.
- Na presena de taninos hidrolisveis ocorre o desenvolvimento de colorao azulada e na
presena de taninos condensados a colorao verde.
- O tubo C ser utilizado como controle para verificao da colorao inicial do extrato.
Flavonoides
- Pesam-se cerca de 0,2 g de extrato,
- Adicionam-se aproximadamente 50 mL de gua em banho-maria fervente por 30 minutos.
- Esfria-se, filtra-se, e extrai-se duas vezes em funil de separao utilizando 10 mL de
n-butanol.
- Evapora-se a frao butanlica secura em cpsula de porcelana, e retoma-se o extrato em
metanol (cerca de 10 mL).
- Transfere-se para 2 tubos de ensaio (A e B).
- No tubo A adicionam-se 0,5 mL de cido clordrico concentrado e aps 0,1 g de magnsio
metlico.
- O desenvolvimento da colorao laranja indica a presena de flavonas, a colorao violcea
indica flavanonas e a cor vermelha a presena de flavonis.
- O tubo B ser utilizado como controle para a verificao da colorao inicial do extrato.
Cumarinas
- Aquece-se em tubo de ensaio, cerca de 0,1 g dos extratos em banho-maria fervente.
- Deve-se tampar o tubo de ensaio com papel filtro previamente impregnado e seco com uma
soluo metanlica de hidrxido de potssio 5%.
- Aps 10 minutos, o papel ser exposto luz ultra violeta (UV) de 365 nm.
- O desenvolvimento da fluorescncia azul e amarela indica a presena de cumarinas volteis.
Sugere-se utilizar como padro sementes de flavatonca, ricas em cumarinas volteis.
Quinonas
- Pesam-se 0,2 g dos extratos vegetais e extrair em banho-maria fervente durante 10 minutos,
com 5 mL de hidrxido de potssio 5%.
- Resfria-se, filtra-se o extrato e acidifica-o com cido actico.
- Em seguida, extrai-se com 5 mL de tolueno em funil de separao.
- Separa-se em um bquer a fase orgnica e adicionam-se 2 mL de soluo de hidrxido de
potssio 3%.
- O desenvolvimento de colorao vermelha indica a presena de antraquinonas, a colorao
violcea indica a presena de naftoquinoides e o surgimento de colorao azul indica a presena de
benzoquinoides.
- Para verificar a presena de quinonas glicosdicas, ferve-se em banho-maria cerca de 0,1 g
dos extratos vegetais com 10 mL de cido clordrico 10% durante 15 minutos.
- Resfria-se, filtra-se e adicionam-se 5 mL de tolueno ao extrato.

Biotecnologia

SUMRIO

202

- Separaram-se as fases. Na fase orgnica, adicionam-se 2 mL do reagente de Borntrger.


- O aparecimento da colorao vermelha na fase aquosa indica a presena de quinonas
glicosdicas.
Saponinas
Esta anlise ser baseada na propriedade das saponinas de formar espuma aps agitao
enrgica.
- Pesa-se cerca de 0,1 g dos extratos vegetais e adicionam-se 20 mL de gua em banho-maria
fervente por 15 minutos.
- Resfria-se, filtra-se e coloca-se em um tudo de ensaio.
- O tubo deve ser agitado vigorosamente durante 15 segundos, e a altura da coluna de
espuma formada, medida com o auxlio de uma rgua.
- O desenvolvimento de espuma com altura superior a 1 cm e persistncia da mesma, aps
repouso de 15 minutos e adio de cido clordrico 10%, indica a presena de saponinas.
Alcaloides
- Dilui-se aproximadamente 0,1 g dos extratos vegetais em 20 mL de metanol.
- Aps, esta soluo dividida igualmente em trs tubos de ensaio. Na sequncia, sero
adicionados a cada tubo, 5 mL de cido clordrico 10%.
- Aquece-se em banho-maria (40 C) durante 30 minutos.
- Aps o resfriamento, filtra-se e transfere-se uma parte deste para um vidro de relgio, onde
so adicionados gota a gota os seguintes reagentes de deteco: Mayer, Dragendorff, Wagner e
reagente de Bertrand.
- O aparecimento de um precipitado indica a presena de alcalides.
Referncias:
BRASIL, Farmacopia Brasileira. 4. ed. So Paulo: Atheneu, 1988-2005.
HARBORE, J.B. Phytochemial methods: a guide to modern techniques of plan analysis. Chapman and Hall. 3.ed.
1998.
SIMES, C.M.O.; SCHENKEL, E.P.; GOSMANN, G.; MELLO J.C.P.; MENTZ, L.A.; PETROVICK, P.R. Farmacognosia:
da planta ao medicamento. 5. ed. Porto Alegre 2004.

Biotecnologia

SUMRIO

203

Anexo 1 Ficha de avaliao para o screening fitoqumico.


Screening fitoqumico
Planta: ________________________________________________ Data: _________
Responsvel:________________________________________________________
Caracterstica confirmatrias
Compostos
fenlicos

Positivo

Negativo

Aparecimento ou intensificao da cor amarela ou laranja.

Taninos hidrolisveis desenvolvimento de colorao azulada


Taninos
Taninos condensados desenvolvimento de colorao verde

Flavonas desenvolvimento de colorao laranja

Flavonides

Flavanonas desenvolvimento de colorao violcea

Flavonis desenvolvimento de cor vermelha

Cumarinas

Cumarinas volteis fluorescncia azul e amarela

Antraquinonas desenvolvimento de colorao vermelha

Naftoquinoides desenvolvimento de colorao violcea


Quinonas
Benzoquinoides desenvolvimento de colorao azul

Quinonas glicosdicas desenvolvimento de colorao vermelha na


fase aquosa

Saponinas

Desenvolvimento de espuma com altura superior a 1 cm e


persistncia da mesma aps repouso de 15 minutos e adio de cido
clordrico 10%

Alcaloides

Aparecimento de um precipitado

Biotecnologia

SUMRIO

204

CAPTULO 8
CULTURA DE CLULAS ANIMAIS
Adriane Pozzobon, Bruna Caye, Dalana Faleiro, Dbora Mara Kich, Marcia Ines Goettert

Biotecnologia

SUMRIO

205

8.1 CULTURA E MANIPULAO DE LINHAGENS CELULARES


Linhagens celulares podem ser conservadas por criopreservao para posterior manipulao
e aplicao. As clulas devem ser mantidas assepticamente em condies bastante estritas de
temperatura (35-37C), pH (7.3-7.5), umidade, 5 - 10% CO2 e em meio de cultura nutritivo. Os
protocolos descritos neste captulo so destinados para a manuteno e manipulao de clulas
aderentes, s quais se multiplicam na superfcie de um suporte inerte (vidro ou plstico), formando
uma monocamada. Entretanto, outras clulas como os linfcitos, podem crescer livremente em
suspenso.
Manuteno das clulas (troca de meio)
Materiais: meio de cultura nutritivo, soro fetal bovino (SBF), detergente Hanks ou PBS,
pipetas, ponteiras, frasco para descarte, lcool 70%, algodo ou papel descartvel, EPIs (luvas,
mscara e jaleco).
realizada sempre que o meio apresenta ter sido consumido (cor alaranjada).
1. Retirar meio de cultura, o detergente Hanks e soro fetal bovino do refrigerador para
atingirem a temperatura ambiente;
Dica: uma possibilidade colocar o soro e o meio de cultura na estufa anteriormente;
2. Ligar o fluxo;
3. Disponibilizar todos os EPIs necessrios, realizar a limpeza da cabine de fluxo laminar
com lcool 70% e colocar todo a material que ir ser utilizado, passando lcool 70% em todos os
utenslios antes de inserir na cabine;
4. Com a cabine limpa e com todos os materiais dentro, exceto material biolgico (clulas,
soro fetal bovino), ligar a lmpada germicida por 15 min (NO SE EXPONHA LUZ);
5. Ligar a luz fluorescente e o fluxo de ar;
6. Sempre limpar as mos e qualquer utenslio com lcool 70% ao inseri-los no fluxo;
7. Retirar o frasco com clulas da estufa e verificar a condio das mesma ao microscpio
invertido;
8. Dentro do fluxo, abrir o frasco de cultura sempre com a tampa para cima, evitando
contaminaes;
9. Desprezar o meio de cultura consumido;
10. Colocar detergente Hanks ou PBS (usar 2 mL em frasco de cultura pequeno e 4 mL para
frascos grandes), movimentar lentamente para lavar, descart-lo. Repetir esse processo duas vezes;
11. Preparar o meio de cultura suplementado com 10% de SBF (5 mL para frasco de cultura
pequeno e 10 mL para frasco grande);
Dica: pipetar o meio sempre de um tubo falcon para evitar contaminaes;
12. Verificar a condio das clulas ao microscpio novamente;
13. Retornar os frascos de cultura na estufa;
14. Realizar a limpeza do fluxo novamente com lcool 70% e ligar a luz germicida por mais
15 minutos, para evitar contaminao cruzada caso for trabalhar com outra linhagem celular.
Meio de cultura para manuteno de linhagens celulares (ex:CHO-K1):
DMEM + HAM F 10
1000 mL gua Milli-Q autoclavada

Biotecnologia

SUMRIO

206

8,65 g DMEM + 4,9 g HAM F10


1,2 g NaHCO3
0,1 g Estreptomicina
0,06 g Penicilina
Dica: ajustar o pH para 7.2 antes de realizar a esterilizao por filtrao. Aps a filtrao, o
pH eleva-se para 7.3 7-4.
Usar filtros de 0,22 m.
PBS 10x (1L)
90 g NaCl
2 g KCl
11,2 g Na2HPO4
2 g KH2PO4
1000 mL gua Milli-Q
Ajustar o pH para 7.4 e autoclavar.
Repique/Passagem de clulas e viabilidade celular:
Materiais: Meio de cultura nutritivo, tripsina-EDTA, soro bovino fetal (SBF), antibitico de
escolha, PBS, descarte, lcool 70%, azul de tripan, pipetas, pipetador, garrafas estreis ou frascos de
cultura, cmera de Neubauer (hemocitmetro), ponteiras, tubos eppendorf e tubos falcon.
Quando as clulas atingem confluncia de 80-90%, necessrio sujeit-las subcultura
evitando-se, deste modo, a morte celular.
1. Trazer o meio de cultura, tripsina, SBF e PBS a temperatura ambiente;
2. Ligar o fluxo;
3. Limpar os materiais com lcool 70% e coloc-los no fluxo, ligar a lmpada germicida por
15 minutos;
4. Inicia-se o processo pela lavagem das garrafas;
Dica: ao abrir os frascos sempre deixar a tampa virada para cima (evitando contaminaes)
5. Desprezar o meio consumido;
6. Colocar 2 mL de PBS para lavar (em frascos pequenos) e 4 mL em frascos grandes;
7. Desprezar o PBS;
8. Colocar 1 mL de tripsina no frasco de cultura;
9. Incubar 2-3 minutos na estufa a 37C para desprendimento das clulas;
Dica: no manter por mais de 3 minutos. Degradao celular!!!
10. Preparar meio completo suplementado com 10% soro bovino fetal;
11. Passados 3 minutos na estufa, verificar por meio de microscopia o desprendimento das
clulas;
12. Certificado o desprendimento das clulas, injetar aproximadamente 3 mL de meio (retirar
do tubo falcon para evitar contaminaes);
13. Transferir a soluo do frasco de cultura para um novo tubo falcon;
14. Centrifugar as clulas tripsinizadas por 10 minutos a 2000 rpm;

Biotecnologia

SUMRIO

207

15. Aproveitar o tempo de centrifugao para limpar a cmera de Neubauer com lcool 70%;
16. Terminado o processo de centrifugao, descartar a tripsina;
17. Ressuspender as clulas com 1 mL de meio completo;
18. Homogeneizar a clula com uma pipeta lentamente;
19. Colocar a lamnula de vidro sobre a cmara de Neubauer;
20. Pipetar 90 l da soluo azul de tripan no tubo eppendorf para diluio das clulas (1:10);
21. Adicionar 10 l da suspenso de clulas ao tubo eppendorf;
22. Pipetar 10 l soluo corada na lamnula da cmara de Neubauer;
23. Realizar a contagem de clulas por microscopia;
24. Aps a contagem, lavar a lamnula e cmara com gua corrente e secar;
25. Colocar 7 mL de meio nutritivo completo no frasco de cultura e transferir as clulas
ressupendidas (ou a quantidade desejada) para uma nova garrafa;
26. Identificar o frasco de cultura:
- Usurio
- Nmero de passagem
- Linhagem celular
- Data
27. Visualizar as clulas novamente ao microscpio;
28. Armazen-la na estufa.
Congelamento de clulas
Materiais: Meio de cultura nutritivo, soro bovino fetal (SBF), lcool 70%, azul de tripan,
frascos de cultura, cmera de Neubauer, criotubos, DMSO e tubos falcon.
Simulao:
1 quadrante: 33
2 quadrante: 43
3 quadrante: 28
4 quadrante: 30
1. Realizar a contagem celular;
2. Ajustar o clculo para a quantidade de clulas desejadas conforme exemplo acima;
3. Retirar a quantidade necessria de clulas da suspenso e o restante transferir para o frasco
de cultura, adicionar a quantidade necessria de meio de cultura nutritivo completo e armazenar
na estufa;
4. Centrifugar a suspenso celular;
5. Desprezar o sobrenadante;
6. Acrescentar soluo de congelamento (5-10% DMSO ou Glicerol + SBF) conforme o clculo;
7. Identificar os criotubos (linhagem, quantidade de clulas, passagem, data, nome);
8. Pipetar 1 mL da soluo em cada criotubo (processo realizado sobre gelo);
9. Armazenar os criotubos em refrigerador 4 C por aproximadamente 1h;
10. Transferir os criotubos para o freezer (-20 C) por 1-2h;

Biotecnologia

SUMRIO

208

11. Acondicionar os criotubos a -80 C por aproximadamente 12 horas;


12. Armazenar os criotubos em nitrognio lquido;
13. Limpar o fluxo com lcool 70% e ligar a lmpada UV por 15 minutos.
Descongelamento de clulas
1. O meio de cultura e o SBF devem estar a temperatura ambiente;
2. Limpar o fluxo com lcool 70% e transferir os materiais necessrios para a realizao do
descongelamento e limp-los com lcool 70%;
3. Ligar a lmpada germicida por 15 minutos;
4. Transferir 5 mL de meio de cultura com 20% de soro fetal bovino;
5. O criotubo deve ser retirado do nitrognio lquido e descongelado rapidamente, em
banho-maria a 36C ou por frico com as mos;
6. Aps o total descongelamento, o contedo deve ser transferido com uma pipeta para o
frasco de cultura, observando as clulas ao microscpio;
7. Armazenar na estufa de CO2 a 37C.
Referncias:
FRESHNEY, R.I. Culture of Animal Cells, a Manual of Basic Technique, 5th Ed. Hoboken NJ, John Wiley & Sons, 2005.
MALAJOVICH, M.A.- Biotecnologia 2011. Rio de Janeiro, Edies da Biblioteca Max Feller do Instituto de Tecnologia
ORT, 2012.
ANIMAL Cell Culture Protocols & Applications. Disponvel: <http://www.qiagen.com/knowledge-and-support/
spotlight/protocols-and-applications-guide/animal-cell-culture/> Acesso em: 14.02.2014

Biotecnologia

SUMRIO

209

8.2 CULTURA PRIMRIA DE CLULAS FOLICULARES DE TIREOIDE


HUMANA
O mtodo de cultura primria utilizado para ensaios in vitro. Essas clulas possuem as
caractersticas do tecido de origem, podem crescer em cultura por um determinado perodo de
tempo.
Uma cultura primria estabelecida a partir do crescimento de clulas oriundas de um
fragmento de tecido obtido por dissociao mecnica ou enzimtica. As clulas que conseguirem
sobreviver ao processo de dissociao e aderirem placa formaro a primeira monocamada de
clulas daquele tecido.
Mtodo Adaptado de Spritzer et al (1995):
Coleta do material nos centros cirrgicos.
Dica: o tecido no pode estar formalizado, deve ser coletado a fresco ou colocado em meio de
transporte (Soluo de Hanks + antibitico). Trazer o material imediatamente ao laboratrio para
a realizao da lavagem.
Aps a esterilizao da capela, colocar o seguinte material: um Becker grande, ou frasco para
desprezar o meio de transporte; quatro Beckers pequenos para a lavagem do material; um frasco
previamente pesado para futuro armazenamento do tecido; um estojo com tesoura e pina; uma
placa de Petry.
Desprezar o meio de transporte segurando o tecido com uma pipeta Pasteur;
Dica: se o material for grande, cort-lo na placa de Petry retirando as partes queimadas e
pintadas bem como fragmentos da cpsula e cogulos sanguneos;
Lavar os pedaos, passando-os pelos quatro Beckers com soluo de Hanks + antibitico.
Dica: durante a lavagem do material, a soluo utilizada dever permanecer o mais resfriada
possvel, objetivando manter o meio livre da ao bacteriana. Isto , com a baixa temperatura
estaremos oferecendo condies desfavorveis proliferao bacteriana ao mesmo tempo em que
so favorveis conservao do tecido.
Colocar o material no frasco pesado previamente e pesar o material, descontando o peso do
frasco. Posteriormente, acrescentar a soluo de Hanks + Kana e armazenar na geladeira.
Colocar na capela: um frasco pequeno com tampa preta; uma seringa 10 mL; um filtro
Millex; um Erlenmeyer grande; uma barrinha magntica; soluo de Hanks + antibitico (deve
permanecer no banho-maria).
Calcular a quantidade de colagenase a ser usada a partir do peso do tecido, tarar um Becker
pequeno e, pesar a colagenase (7,5 mg/g de Tecido).
Calcular a quantidade de Hanks + antibitico necessria para a diluio da colagenase, a
partir do volume de tecido, na proporo de 2,5 mL /g de Tecido.
No Erlenmeyer colocar a colagenase acrescentada de parte da soluo de Hanks,
homogenizando com uma pipeta. Colocar uma barrinha magntica e agitar por aproximadamente
30 minutos a 37o C. Filtrar a colagenase em Millex com o auxlio da seringa e acrescentar o resto do
volume da soluo de Hanks.
Dica: em caso de volumes muito pequenos de soluo (10-15 mL), pode-se usar todo o
volume de Hanks na diluio da enzima.
Colocar na capela: um estojo com pina e tesoura; uma placa de Petry; um Becker ou frasco
para desprezar o meio de transporte; um Erlenmeyer de tripsinizao; uma barrinha magntica;

Biotecnologia

SUMRIO

210

uma colherinha. Desprezar o meio de transporte que contm os fragmentos lavados. Com o frasco
na horizontal, colocar os fragmentos na placa de Petry. Com a pina e tesoura triturar o tecido e
com o auxlio da colherinha, colocar o material triturado no Erlenmeyer, bem como a colagenase
(acondicionada no Banho Maria a 37 C) e a barrinha magntica; Fechar o Erlenmeyer com o papel
alumnio que estava na boca do mesmo; (pode-se colocar uma fita ao redor do papel alumnio para
melhor fix-lo) e colocar sob agitao por 2 horas a 37 oC.
Dica: ao abrir o Erlenmeyer na capela, deve-se ter o cuidado para no tocar na poro interna
do papel alumnio, pois este est esterilizado e ser utilizado para tapar o Erlenmeyer durante
a agitao. Durante todo o processo de lavagem e triturao do tecido, deve-se ter o cuidado de
no tocar com as mos no mesmo, sujeito a contaminaes. Outro cuidado importante com o
tempo desperdiado na triturao, passo no qual as clulas ficam expostas ao ambiente sem a
devida manuteno de suas condies basais, proporcionada pela soluo de Hanks. Durante a
dissociao enzimtica, a temperatura dever permanecer em torno dos 37o C proporcionando,
assim, condies timas ao enzimtica.
Antes do final da dissociao (45 minutos), colocar na capela: filtros com malha de 250 e
150 m encaixados em Erlenmeyers; tubos Corn esterilizados (tampa laranja. Ligar a UV por 30
minutos;
Ao Erlenmeyer de tripsinizao acrescentar igual volume de Hanks utilizado para a
dissociao enzimtica, a fim de inibir a ao da colagenase (poder ser medido em um tubo cnico,
pois no requer preciso de volume). Colocar o meio de cultura de interesse no Banho Maria a 37o C.
Despejar a soluo contendo o tecido dissociado no filtro de 250 m com cuidado e vagarosamente,
para no transbordar a malha. Verter o filtrado na membrana de 150 m. Distribuir o filtrado nos
tubos Corns, no encher muito (40 mL / tubo mx.).
Centrifugar por 10 minutos a 1.500 rpm. Desprezar o sobrenadante e ressuspender o
sedimento em soluo de Hanks (15 - 20 mL), homogeneizar e juntar todo o volume de suspenso
em um nico tubo (em um terceiro tubo). Centrifugar por 10 minutos a 1.500 rpm. Preparar o filtro
de 60 m, verificando se a rosca est bem apertada, e colocando-o em um tubo Corn, com um copo
de seringa acoplada ao filtro.
Dica: deve-se ter o cuidado ao desenrolar o filtro de 60 m, pois o papel que o envolve ser
utilizado para forrar a base da capela ao abri-lo.
Colocar na capela dois Beckers pequenos com Hanks para lavar a membrana. Retirar os
tubos da centrfuga e desprezar o sobrenadante. Ressuspender o pellet em soluo de Hanks,
homogeneizar e filtrar com o filtro de 60.
Dica: o volume de Hanks utilizado dever ser de quatro vezes o tamanho do pellet, 25 mL.
Abrir o filtro sobre o papel alumnio e retirar a membrana com o auxlio de pipetas Pasteur,
fazendo uma trouxinha. Lavar a membrana nos Beckers com soluo de Hanks. Colocar a suspenso
celular da lavagem da membrana em tubo Corn e centrifugar todos os tubos por 10 minutos a 1.500
rpm.
Colocar na capela as placas de Petry e em um Becker mdio colocar o meio de cultura de
interesse. Separar bandejas para colocar placas e garrafas.
Retirar os tubos da centrfuga, desprezando o sobrenadante e ressuspender as clulas
epiteliais no meio de cultura (meio 199).
Dica: preparo do Meio 199:
1 pacote de p MEIO199
1 litro de gua Milli-Q
10 mL de Kanamicina

Biotecnologia

SUMRIO

211

0,35 g de Bicarbonato de Sdio (NaHCO3)


1 Becker de 1 litro
1 barra magntica grande
Colocar em um Becker de um litro a Kanamicina, o meio 199, o bicarbonato e parte da gua.
Agitar no agitador magntico at homogeneizar. Acertar o pH para 7,2 e completar o volume para
um litro. Filtrar para esterilizao com filtro a vcuo (membrana de 0,22 m). Suplementar com
soro bovino fetal na concentrao desejada (5 a 10%).
Colocar uma gota da suspenso em um tubo de ensaio e fazer a contagem das clulas (20 L
corante azul de tripan + 20 L suspenso celular) e olhar no microscpio o volume de suspenso
que deve ser plaqueado em cada placa. O volume a ser plaqueado 1 x 105 clulas/mL. Partindo
dessa densidade, calcula-se o volume de suspenso (mL) a ser plaqueado nas placas.
Dica: clulas contadas no hemocitmetro:

4+6+2+5


3+7+3+2: soma total = 32. Divide-se por 8 =
4, este nmero ser multiplicado por 2 que representa o fator de diluio do corante resultando em
8. Teremos desta forma, 8 x104 clulas/mL; no entanto, o volume a ser plaqueado 1x105 cl/mL
logo: 8 x104 cl./mL = 0,8x105 cl/mL. Desta forma, calcula-se o volume a ser plaqueado por meio
de uma regra de trs. Por exemplo:
0,8x105 cl.------------ 1 mL
1,0x105 cl.------------ X

X = 1,25 mL. Este ser o volume a ser plaqueado para que tenhamos a densidade celular de
1x105 cl/mL em cada placa.
Distribuir em placas de plstico estreis de cultura de 35 mm na concentrao de 1x105
clulas/mL e incubar em estufa a 37C com atmosfera mida e adio automtica de 3% CO2.
Referncias:
SPRITZER, P. M., I. S. SILVA, et al. 1995. Culture of adult human prostatic epithelial cells: A simplified method for
obtaining primary cultures. Med Sci Res 23: 379-381.

Manuteno das clulas de cultura primria da tireoide humana:


As clulas em cultura devem ser observadas a cada 24 horas em microscpio invertido, antes
de ser efetuada a troca do meio de incubao. A primeira troca do meio de cultura das clulas
deve ser realizada 24 horas aps a semeadura para facilitar a adeso das clulas nas placas, sendo
este considerado o dia zero. O meio deve ser trocado para F-12 suplementado com glutamina,
bicarbonato de sdio, soro de vitelo, TSH e antibitico (Kanamicina). Antes de atingir a confluncia,
as clulas devem ser privadas do meio com TSH durante, no mnimo, 48 horas. Aps este perodo,
as clulas devem ser separadas em grupos e tratadas em diferentes condies.

Biotecnologia

SUMRIO

212

CAPTULO 9
CULTURA DE TECIDOS VEGETAIS
Claudimar Sidnei Fior, Elisete Maria de Freitas, Aline Marjana Pavan e Marelise Teixeira

A tecnologia de cultura de clulas, protoplastos e tecidos de plantas constitui uma das reas
de maior xito da biotecnologia. Aps meio sculo de progresso, conquistou destacada posio na
propagao comercial e industrial de plantas.
A tcnica permite a preservao de material gentico in vitro, vindo a somar com as demais
ferramentas utilizadas atualmente na conservao de espcies, ou mesmo gentipos especficos.
Possibilita a conservao de plantas ou tecidos de diferentes procedncias, em condies de
crescimento mnimo ou associado criopreservao, para uso no melhoramento gentico, para
evitar a extino de espcies ou mesmo, para intercmbio entre instituies sem os riscos de
disseminao de pragas ou doenas.
A aplicao da tcnica de cultura de tecidos vegetais exige uma sequncia de procedimentos
conforme descrito a seguir:
1. Preparao de soluo estoque
2. Preparao do meio de cultura
3. Obteno e desinfestao dos explantes
4. Estabelecimento dos explantes e condies de incubao
5. Manuteno das plantas matrizes

Biotecnologia

SUMRIO

213

9.1 PREPARAO DE SOLUES ESTOQUE PARA O MEIO MS


As solues estoque so necessrias quando os meios so utilizados com relativa frequncia
(um ou mais litros por semana), pois agilizam os trabalhos. O volume e a concentrao de cada
soluo dependero da demanda do laboratrio. Assim, quando o consumo baixo, diminui-se a
concentrao e/ou o volume das solues estoque para que a soluo no permanea armazenada
por longo perodo. Quando somente uma pequena quantidade de meio necessria, ou quando o
meio utilizado com pouca frequncia, recomendado pesar e dissolver diretamente os reagentes
para cada preparo.
As solues estoque que compem o meio MS (principalmente macro e micronutrientes)
denominam-se A, B, C, D, E e F. O processo de pesagem dos elementos bsicos dessas solues
realizado uma nica vez para a preparao escalonada de dezenas de litros, seguindo as
concentraes indicadas na tabela 1.
Tabela 1: Componentes de cada uma das solues estoque do Meio MS com as respectivas
quantidades para as concentraes de 10 e 100 X.
Soluo

Componentes

Sol. estoque conc. 100 X (mg L-1)

Sol. estoque conc. 10 X (mg L-1)

NH4NO3

165000

16500

KNO3

190000

19000

H3BO3

620

62

KH2P04

17000

1700

KI

83

8,3

Na2MoO4 2H2O

25

2,5

CoCl2 . 6H2O

2,5

1,25

CaCl22H2O

44000

4400

MgSO4 . 7H2O

37000

3700

MnSO4 . 4H2O

2230

223

ZnSO4 . 7H2O

860

86

CuSO4 . 5H2O

2,5

1,25

Na2 EDTA.2H2O

3720

372

FeSO4 . 7H2O

2780

278

litro:

Passos a serem seguidos para o preparo das solues estoque do Meio MS volume de um
1. Para a diluio dos componentes, deve ser utilizada gua destilada.
2. Os reagentes devem apresentar a mxima pureza possvel.

3. A quantidade de cada componente para o preparo de um litro de soluo estoque depende


da concentrao a ser escolhida e deve ser seguida conforme indicao na tabela 1.
4. Quando a soluo estoque contm Fe, alguns passos devem ser seguidos a fim de evitar a
formao de precipitados na soluo:

Biotecnologia

SUMRIO

214

- O Na2EDTA.2H2O deve ser dissolvido em gua deionizada a 50% do volume final da


soluo, deixando agitar por 10 minutos.
- Posteriormente, a mistura deve ser aquecida at 50 a 70 C, devendo ser acrescentado,
lentamente o FeSO4.7H2O, mantendo agitao.
Aps a completa dissoluo dos cristais, completa-se a soluo para o volume final
preestabelecido.
Para melhor conservao da soluo de Fe, deve-se envolver o frasco com papel alumnio
evitando, assim, a entrada de luz. O mesmo deve acontecer com a soluo de vitaminas.
5. Logo aps a dissoluo, as solues estoque devem ser armazenadas em refrigerador
(entre 1 e 5 C), retirando-as somente momentos antes da preparao do meio.
6. Quando preparadas e armazenadas de forma adequada, as solues podem permanecer
at seis meses sem que seja comprometida a qualidade do meio. No entanto, h possibilidade de
proliferao de microrganismos nas solues, o que pode ser observado pela presena de colnias,
visveis atravs da parede do frasco.
Dica: a sacarose e o gar devem ser dissolvidos somente no momento da preparao do meio
e no devem ser acrescentados s solues estoque. Alm da sacarose e do gar, recomenda-se que
vitaminas, aminocidos e mio-inositol no sejam armazenados em forma de soluo, e sim pesados
no momento da preparao do meio.

Biotecnologia

SUMRIO

215

9.2 PREPARO DO MEIO DE CULTURA MS (MURASHIGE E SKOOG)


Dentre os vrios tipos de meio de cultura que existem, o meio MS, proposto por Murashige e
Skoog (1962) o mais utilizado. Para o seu preparo, necessrio adquirir os componentes listados
na tabela 2. A quantidade necessria de cada um dos componentes para o preparo de um litro de
meio tambm indicada na tabela 2.
Existe a opo da aquisio de fornecedores de produtos qumicos, o meio MS como prmisturas, em quantidades suficientes para preparar vrios litros de meio. Possibilita economia com
mo de obra e com local para armazenamento de reagentes e solues. No entanto, no possvel
modificar a proporo dos seus componentes.
Recomenda-se que:
O meio de cultura seja preparado, preferencialmente, alguns dias antes da incubao.
Quando preparado o meio de cultura, as plantas matrizes a serem utilizadas para a obteno
dos explantes j tenham sido selecionadas, pois o meio no pode ficar armazenado por muito
tempo.
Tabela 2: Componentes do meio de cultura MS (Murashige e Skoog) com a respectiva
quantidade para o preparo de um litro de meio.
MS
Componentes
(mg L-1)
Macronutrientes
CaCl2. 2H2O

Cloreto de clcio dihidratado

440

KH2PO4

Fosfato de potssio

170

KNO3

Nitrato de potssio

1900

MgSO4. 7H2O

Sulfato de magnsio
heptahidratado

370

NH4NO3

Nitrato de amnia

1650

CoCl2.6H2O

Cloreto de cobalto
hexahidratado

0,025

CuSO4.5H2O

Sulfato de cobre
pentahidratado

0,025

H3BO3

cido brico

6,2

KI

Iodeto de potssio

0,83

MnSO4 4H2O

Sulfato de mangans
tetrahidratado

22,3

Na2MoO4.2H2O

Molibdato de sdio
dihidratado

0,25

ZnSO4.4H2O

Sulfato de zingo tetrahidratado

8,6

Sulfato ferroso heptahidratado

27,8

Micronutrientes

FeEDTA:
Fe(SO4).7H2O

Biotecnologia

SUMRIO

216

MS
Componentes
(mg L-1)
Na2EDTA.2H2O

cido
etilendiaminotetraactico, sal
dissdico dihidratado

37,3

Componentes Orgnicos:
cido nicotnico

0,5

Glicina

2,0

Mio-inositol

100

Piridoxina.HCl

0,5

Tiamina.HCl

0,1

Sacarose (g/l)

30

Cada laboratrio deve optar em preparar o meio de cultura com o uso de solues estoque
ou no. Quando no so preparadas solues estoque para o preparo do meio, ou seja, quando
parte-se diretamente dos sais, devem ser seguidos os passos descritos a seguir:
1. Pesam-se todos os componentes, de acordo com a receita (Tabela 2) e a quantidade de
meio a ser preparada.
2. Logo em seguida, todos os componentes devem ser dissolvidos em gua deionizada.
Importante que seja utilizado algum recipiente com volume preciso (como provetas ou bales
volumtricos).
3. Concluda a dissoluo de todos os produtos qumicos e a sacarose, acrescenta-se o gar e
corrige-se o pH.
Dica: O ajuste do pH pode ser realizado com soluo 0,5 mol de cido clordrico (HCl) quando
este estiver muito alto e precisa ser reduzido. Quando ocorrer o inverso, ou seja, o pH estiver muito
baixo, o ajuste deve ser realizado com hidrxido de sdio (NaOH), na mesma concentrao.
A forma mais rpida e prtica para o preparo do meio de cultura atravs da utilizao das
solues estoques (conforme detalhado no item acima). Neste caso procede-se da seguinte forma:
1. Pipetar as alquotas de cada uma das solues, de acordo com a concentrao e a quantidade
de meio a ser preparada. Por exemplo, se a definio o preparo de um litro de meio, devem ser
pipetados 100 mL da soluo estoque A na concentrao 10 X ou de 10 mL quando a concentrao
da soluo for 100 X.
2. Ento deve ser acrescentado o mio-inositol, o carvo e a casena (opcionais) e a sacarose,
mantendo em agitao no agitador magntico.
3. Depois de misturadas todas as solues estoque, o mio-inositol, o carvo, a casena e a
sacarose, acrescenta-se gua deionizada para completar o volume final previamente definido e
corrige-se o pH (recomenda-se que seja 5,8).
4. Para finalizar, independente do mtodo seguido (com uso de soluo estoque ou no),
deve ser acrescentado o gar.
5. A soluo deve ser aquecida at a total dissoluo (recomenda-se utilizar chapa aquecedora
ou forno de micro-ondas) onde o meio atinja 90 a 95 C.
6. To logo alcance esta temperatura, distribui-se todo o volume nos frascos de cultivo (tubos
de ensaio, por exemplo), fechando-os com tampa autoclavvel ou papel alumnio. recomendado
que seja distribuda a mesma quantidade de meio em cada frasco.

Biotecnologia

SUMRIO

217

C.

7. Embora tenha sido aquecido, o meio ainda necessita ser autoclavado por 15 minutos a 121

Este procedimento deve ser realizado to logo o meio seja distribudo nos frascos. Em casos
excepcionais, pode-se autoclavar no dia seguinte ao prepare; no entanto, isso deve ser evitado, pois
colnias de contaminao em desenvolvimento podem liberar toxinas, alm de consumir parte dos
compostos.
8. Depois de esterilizados, os meios esto prontos para a incubao dos explantes (segmentos
nodais, sementes, embries zigticos, meristemas e outros). Contudo, se necessrio, os meios
podem ficar armazenados por uma a duas semanas em local com temperatura amena, limpo e sem
luz.
Referncia:
MURASHIGE, T.; SKOOG, F. A revised medium for rapid growth and bioassays with tobacco tissue cultures.
Physiologia Plantarum, Kopenhagen, v. 15, p. 473-497, 1962.

Biotecnologia

SUMRIO

218

9.3 OBTENO E DESINFESTAO DOS EXPLANTES


Terminado o preparo do meio de cultura, preciso iniciar o processo de desinfestao dos
tecidos vegetais a serem incubados. Isso porque as plantas em desenvolvimento esto em contato
com inmeros microrganismos. A maioria deles se desenvolve na superfcie de ramos, folhas e
demais tecidos sem lhes causar qualquer alterao. Contudo, ao estabelecer um tecido vegetal in
vitro, as condies ambientais de elevada umidade, nutrientes disponveis e alta concentrao de
acar propicia o crescimento destes microrganismos superando e, na maioria das vezes, impedindo
a regenerao e desenvolvimento do explante. Por essa razo, o cultivo de tecidos vegetais in vitro
deve ser feito em condies de mxima assepsia possvel.
Em funo disso, recomenda-se que:
A planta matriz, cujas condies de cultivo esto descritas no item 5, deve ser cultivada
com excelentes condies fitossanitrias para que os explantes fornecidos contenham o mnimo de
propgulos de microrganismos;
Sejam utilizadas substncias como o etanol e compostos a base de cloro, tais como o
hipoclorito de sdio e de clcio para a desinfestao dos explantes que sero incubados. Estas
substncias possuem ao germicida e so as mais utilizadas nos processos de desinfestao.
Observaes:
a. A dificuldade maior nesta etapa da cultura de tecidos vegetais reside em obter tecido
descontaminado sem conduzi-lo morte quando isolado.
b. So determinantes os pr-tratamentos aplicados na planta matriz para o sucesso dessa
etapa do trabalho, principalmente no que se refere aos microrganismos endgenos. Assim, uma das
medidas que pode ser adotada para reduzir os riscos de contaminao a aplicao de fungicidas
por alguns dias antes da obteno dos explantes.
c. Problemas crnicos de contaminao podem ser amenizados adicionando-se fungicidas
e/ou bactericidas ao meio de cultivo. Porm, esta prtica nem sempre d bons resultados,
principalmente quando no so adotados critrios tcnicos para a escolha dos antibiticos, em
funo do tipo de organismo a ser controlado. Manejos adequados durante o tratamento da planta
matriz oferecem melhores resultados e diminuem o risco ao manipulador.
d. A desinfestao apenas permite a limpeza superficial do explante, sem eliminar patgenos
que estejam localizados internamente aos tecidos.
e. A limpeza do ambiente e dos materiais muito importante para viabilizar uma desinfestao
mais eficiente.
Para a desinfestao dos explantes a serem incubados devem ser seguidos os procedimentos
listados a seguir:
1. Coleta dos ramos da planta matriz e remoo de parte das folhas. Para a coleta, devem ser
utilizados, preferencialmente, tesoura esterilizada.
2. No caso da utilizao de segmentos nodais ( 1,0 cm), os ramos podem ser padronizados
em 5,0 cm. Estes devem conter ao menos uma gema.
Dica: importante que os ramos apresentem tamanho maior ao explante que ser incubado
para evitar danos aos tecidos com os tratamentos de desinfestao. Depois de desinfestados, no
momento da incubao, as extremidades do segmento devem ser eliminadas, deixando-o no
tamanho adequado. Quando forem incubados meristemas, os procedimentos so semelhantes,
ou seja, devem ser mantidos ramos maiores, as folhas maiores tambm devem ser removidas, no
entanto, a remoo total das folhas que envolvem o meristema deve ser realizada somente depois
dos procedimentos de desinfestao e no momento da incubao.

Biotecnologia

SUMRIO

219

3. Os ramos devem ser submetidos lavagem em gua corrente por cerca de 20 minutos para
promover a limpeza superficial.
Dica: o tempo de lavagem pode ser diferenciado dependendo de cada espcie, ou mesmo do
tipo de material a ser incubado (segmentos nodais, sementes, embries ou meristemas).
4. Aps, procede-se a retirada de parte das folhas e do caule, que no sero utilizados como
explantes, reduzindo assim a quantidade de inculos.
Recomendaes:
1. Antes de iniciar os procedimentos de incubao, a capela de fluxo laminar deve ser
previamente limpa com lcool etlico 70%.
2. Todo o material (pinas, bisturis, placas de petri) a ser utilizado no procedimento de
incubao deve ser previamente autoclavado.
3. Quando os materiais forem distribudos na cmara de fluxo de ar, estes devem receber
jatos de lcool etlico (70%). Ento, a luz ultravioleta mantida ligada por 20 minutos, perodo em
que ningum deve permanecer na sala de assepsia.
4. A seguir, em capela de fluxo laminar, os ramos restantes so imersos em diferentes
concentraes de substncias (Tabela 3) que podem contribuir para a desinfestao.
A seguir, na cmara de fluxo laminar, os ramos so imersos nas solues de desinfestao,
(Tabela 3), conforme o protocolo a ser seguido. De maneira geral, como procedimento padro,
recomenda-se iniciar pela imerso em lcool etlico que, alm da ao germicida, surfactante e,
quando aplicado inicialmente, facilita ao dos outros produtos. Graduaes de etanol superiores
a 80% podem desidratar os tecidos com facilidade, portanto, a concentrao recomendada 70%.
5. Assim, a primeira imerso deve ser em soluo contendo lcool etlico, sendo a concentrao
e o tempo definidos conforme a sensibilidade dos tecidos da planta. Em mdia, para a maioria dos
tecidos, este tempo pode variar de um a dois minutos.
Dica: tecidos tenros, que oxidam facilmente, so mergulhados em etanol 50 a 70% por alguns
segundos. Excepcionalmente, em se tratando de sementes, cujo tegumento ser removido aps a
desinfestao, pode-se manter em etanol 80% por mais tempo (5 a 10 minutos).
Tabela 3: Substncias desinfestantes comumente usadas em cultivo de tecidos de plantas
com a respectiva concentrao a ser utilizada e tempo mnimo e mximo de exposio.
Desinfestante

Concentrao (%)

Tempo de exposio
(minutos)

Hipoclorito de clcio

9-10

5-30

Hipoclorito de sdio

0,5-5

5-30

gua oxigenada

3-12

5-15

lcool etlico

70-95

1-15

Nitrato de prata

5-30

Cloreto de mercrio

0,1-1

2-10

6. Como procedimento padro na maioria dos laboratrios, aps o tratamento com etanol, os
tecidos vegetais so mergulhados em soluo de hipoclorito de sdio ou clcio com 1,0 a 2,5% de
cloro ativo.
Dicas:
- O hipoclorito de sdio facilmente encontrado em formulaes comerciais de gua sanitria.

Biotecnologia

SUMRIO

220

- As concentraes mais comuns variam de 0,5 a 2,0% de cloro ativo e o tratamento dura
at 50 minutos, no caso de tecido lignificado, embora o tempo mais utilizado para imerso em
hipoclorito seja de 10 a 15 minutos
sdio.

- O hipoclorito de clcio apresenta a vantagem de ser menos txico para os tecidos que o

7. importante que sejam adicionados soluo de hipoclorito, algumas gotas de detergente


concentrado. Com isso, diminui-se a tenso superficial do tecido. Esta medida aumenta a penetrao
do cloro e, consequentemente a eliminao de propgulos de microrganismos. O mais utilizado o
Tween 20, sendo necessrias apenas 4 a 10 gotas por litro de soluo.
8. Aps o tratamento completo de desinfestao, ainda na capela de fluxo laminar, os tecidos
devem ser lavados em gua autoclavada e destilada por trs a cinco vezes. Desta forma, elimina-se
a maior parte do resduo do cloro, pois a manuteno do mesmo, junto ao explante, pode impedir
a regenerao.
Observaes:
a. Em geral, utilizam-se concentraes bastante elevadas das substncias para desinfestao,
o que implica em curto tempo de tratamento. Pode-se, entretanto, trabalhar com concentraes
mais baixas, devendo-se, por isso, aumentar o perodo de exposio.
b. Considerando a sensibilidade do tecido a ser desinfestado, manipula-se a concentrao da
soluo e tempo de exposio de maneira inversamente proporcional.
c. Explantes cobertos de tricomas ou estruturas equivalentes requerem tratamentos mais
intensivos. Tecidos muito tenros e explantes de pequeno tamanho devem ser desinfestados com
maior cuidado.
d. Os cloretos de mercrio e benzacnio so possibilidades de desinfestao. O cloreto de
mercrio bastante txico e utilizado em concentraes inferiores aos hipocloritos. O cloreto de
benzacnio pouco txico aos tecidos e pode ser utilizado em concentraes e tempos semelhantes
aos hipocloritos.
e. Com todos esses cuidados, ainda podem permanecer propgulos de microrganismos
viveis, o que ser percebido com alguns dias de incubao. Em geral, a contaminao por fungos
manifesta-se nos primeiros dias aps o estabelecimento. Contaminaes bacterianas, entretanto,
surgem mais tardiamente, em cerca de uma a trs semanas aps. Contudo, em alguns casos,
principalmente em tecidos de plantas lenhosas, colnias bacterianas surgem aps 30 a 40 dias desde
a incubao.

Biotecnologia

SUMRIO

221

9.4 ESTABELECIMENTO DOS EXPLANTES E CONDIES DE


INCUBAO
O isolamento dos explantes deve ser realizado com a mxima higiene e desinfestao,
conforme descrito acima, tanto do ambiente, como dos tecidos. Esta operao realizada em
cmara de fluxo de ar laminar estril. A forma como o explante manipulado determina o sucesso
da regenerao do tecido, especialmente quando se trabalha com meristemas ou outros explantes
de pequeno tamanho. Recomenda-se que sejam tomados os seguintes procedimentos:
1. Os explantes j desinfestados so acondicionados em placa de petri. Com o uso de bisturi
novo, as suas extremidades devem ser removidas at tamanho adequado, que pode variar com o
tipo de explante e a espcie a ser propagada. Este procedimento permite a retirada das pores do
tecido que foi lesionado ou oxidado durante o processo de desinfestao.
2. A seguir, com o uso de pina de comprimento compatvel com o frasco, deve ser realizada
a incubao do(s) explante(s) no frasco com o meio de cultivo.
Dica: de extrema importncia que as pinas e os bisturis utilizados sejam flambados ou
esterilizados em esterilizadores infravermelho, conforme descrito acima a cada explante incubado.
Esta medida evita que a presena de patgenos em determinado explante seja disseminado para
outros.
3. Terminada a incubao, o frasco deve ser fechado com papel alumnio e papel pardo ou
com tampa autoclavvel.
Observao: Quando forem utilizados frascos maiores (vidros de 200 mL, por exemplo) h
uma quantidade mnima de explante a ser inoculada por frasco de meio, pois a densidade afeta a
diferenciao de clulas na morfognese ou proliferao de brotos. Quanto menor o tamanho de
um explante ou o nmero de explantes em uma determinada quantidade de meio, maior deve ser
a disponibilidade de nutrientes aos tecidos cultivados. Por outro lado, um alto volume de meio por
explante pode no resultar na melhor taxa de propagao.
Para o estabelecimento dos explantes devem ser tomados alguns cuidados especiais:
1. Os materiais utilizados (pinas, agulhas histolgicas, cabos de bisturi, placas de petri, entre
outros) para o estabelecimento dos explantes devem ser autoclavados previamente.
2. Os utenslios metlicos utilizados durante a manipulao e corte dos tecidos devem ser
mergulhados em etanol 96%, e flambados periodicamente durante o processamento do material.
Esta operao impede que a contaminao presente em uma poro do tecido seja disseminada
para os demais explantes isolados durante a preparao e a incubao.
Dependendo da disponibilidade no laboratrio, ao invs de flambar, devem ser utilizados
esterilizadores infravermelhos. Estes tm a vantagem de diminuir os riscos de acidentes aos
usurios.
3. Os cortes nos tecidos devero ser executados com bisturis novos, bem afiados. Assim, o
isolamento do explante ocorre sem injrias excessivas.
Observao: Em geral, h um tamanho timo de explantes para iniciar uma cultura de tecidos.
Explantes muito pequenos no sobrevivem bem em cultura. Porm, explantes grandes podem ser
difceis de descontaminar e de manipular.
4. Explantes muito pequenos, como pices caulinares, embries, etc, so isolados com o
auxlio de estreo-microscpios. A manipulao desse equipamento dever ser feita no interior da
cmara de fluxo estril, a qual dever passar por uma prvia desinfestao, visando-se com isso
evitar a introduo de inculos e, consequentemente, a contaminao dos explantes.

Biotecnologia

SUMRIO

222

5. Como forma de auxiliar na manuteno da assepsia do laboratrio, algumas regras devem


ser respeitadas. A principal delas a restrita utilizao dos equipamentos e utenslios do laboratrio,
ou seja, todo material utilizado para os trabalhos com cultivo de tecidos, no deve ser manipulado
para outras finalidades.
6. Outra prtica que favorece a manuteno da assepsia o uso obrigatrio de aventais
limpos, os quais no devem ser retirados do laboratrio. Em algumas situaes, em que a casa de
vegetao prxima ao laboratrio, recomenda-se o uso de aventais especficos para cada ambiente.
7. Durante dias chuvosos ou com elevada umidade relativa no ar, os riscos de introduo de
microrganismos no laboratrio so potencializados. Uma forma de evit-los restringir ao mximo
a circulao de pessoas no laboratrio durante esses perodos, principalmente naqueles laboratrios
abertos visitao.
8. Quando terminada a incubao, os explantes devem ser mantidos em salas de crescimento
(Figura 2) onde devem prevalecer a condies descritas a seguir.

Figura 2: A. Explante com brotao na sala de crescimento. Este foi incubado em meio MS
com adio de carvo ativado (Imagem: Mara Filter). B. Plantas em cultivo in vitro em sala de
crescimento (Imagem: CSFior).
8.1. A temperatura mdia das salas de crescimento de 25oC. As plantas tropicais e subtropicais
tendem a ser cultivadas em temperaturas levemente mais altas do que espcies temperadas (mdia
de 27oC). Quando uma variao diurna-noturna desejada, normalmente, adota-se 25 C durante o
dia e 20 C noite, ou 28 C/24 C.
8.2. Em geral, para induo de parte area a regio do azul do espectro crtica e a luz
vermelha no apresenta efeitos. As lmpadas recomendadas para iluminao das culturas in vitro
so do tipo fluorescentes brancas fria, Plantilux ou com emisses balanceadas nas regies do azul
(430 nm) e vermelho (660 nm). Assim, em cultivo de tecidos, quando se objetiva a multiplicao de
plantas, as lmpadas devem conter emisses nesses espectros.
8.3. As condies de incubao podem variar muito. Escuro total ou intensidades de luz
reduzidas so teis nos primeiros dias aps o isolamento para reduzir a oxidao fenlica. O incio
da cultura no escuro tambm indicado para evitar estresse em alguns explantes, como meristemas
de rizomas, bulbos e razes.
8.4. A luz de baixa irradiao na cultura de tecidos vegetais utilizada pelas seguintes razes:
a) o fornecimento de altos nveis de luz artificial caro e gera calor no desejado;
b) as culturas em ambientes lacrados tornam-se superaquecidas em altas irradiaes devido
ao efeito estufa;

Biotecnologia

SUMRIO

223

c) a tecnologia de cultivo de tecidos vegetais evoluiu usando tecidos no autotrficos


supridos com carboidrato.
8.5. Em geral, 16 horas de fotoperodo tem mostrado ser satisfatrio para vrias espcies de
plantas, utilizando-se lmpadas fluorescentes branco fria, com intensidade luminosa de 1000 a 2000
lux.
Observaes:
a. Para timo crescimento e desenvolvimento dos explantes in vitro, as exigncias em
fotoperodo das culturas devem ser satisfeitas. O incio de determinado processo morfogentico s
se manifesta quando as culturas esto expostas a um adequado comprimento do dia.
b. O fotoperodo influencia as plantas de duas maneiras: uma pela regulao da quantidade
de energia radiante captada e atravs de um mecanismo controlador, pelo qual as plantas so
capazes de reconhecer mudanas no ambiente. Outra, pela durao do dia, que pode influenciar
nveis de reguladores do crescimento naturais dentro de tecidos de plantas cultivadas.
c. Uma boa aerao parece ser necessria para cultivo in vitro. As plantas produzem oxignio,
gs carbnico, etileno, aldedo e outros compostos volteis. Na natureza, estes compostos so
dissipados na atmosfera. Em cultivo de tecidos, esses gases podem ficar retidos no frasco, alterando
o desenvolvimento das plantas. A acumulao de CO2 em altas concentraes conduz anaerobiose,
fermentao e produo de lcoois. Em alguns casos, altas concentraes de gs carbnico induzem
distrbios no crescimento e desenvolvimento da planta in vitro.

Biotecnologia

SUMRIO

224

9.5 MANUTENO DAS PLANTAS MATRIZES


Os resultados obtidos no cultivo in vitro podem ser influenciados pela forma em que as
plantas matrizes so tratadas e pelo ambiente em que elas crescem. Sabe-se que o melhor explante
proveniente de plantas sadias e vigorosas que so mantidas em estado ativo de crescimento, sem
estresse.
H vrios aspectos relacionados com a planta matriz que podem influenciar para o sucesso
no cultivo in vitro, sendo os principais:
1. Adequada nutrio mineral da planta matriz, o que deve ser feito de acordo com a exigncia
de cada espcie e estdio vegetativo.
2. Plantas matrizes com pragas ou doenas devem ser rejeitadas, pois os patgenos que as
infectam so capazes de causar a morte da cultura in vitro.
3. Recomenda-se que as plantas matrizes sejam mantidas em salas de crescimento sob
condies controladas. Assim, as brotaes para a obteno dos explantes so mais uniformes e
com menos possibilidades de estarem contaminadas por patgenos. Plantas que crescem no campo
esto sujeitas a altas taxas de contaminao.
Observaes:
a. Em geral, a infeco da planta matriz reduz o nmero e tamanho das brotaes. A produo
de brotaes axilares e o nmero de plantas finalmente estabelecidas tendem a ser menores em
cultivos infectados.
b. Algumas associaes patgeno-hospedeiro no apresentam sintomas em casa de vegetao
ou no campo, mas podem resultar em pobre crescimento in vitro.
c. Espcies herbceas so facilmente desinfestadas. J com espcies lenhosas tm sido
experimentadas dificuldades.
4. A melhor poca para realizar a coleta dos explantes , usualmente, quando as plantas
matrizes esto produzindo novas e vigorosas brotaes (ou seja, em regies de clima temperado, na
primavera e incio do vero), mas muitas excees tm sido observadas;
5. Pode-se induzir o crescimento de brotaes juvenis (Figura 2) realizando podas drsticas
das plantas matrizes. Quando for iniciado o cultivo de brotaes, pode ser tambm vantajoso
podar as plantas para obter uma boa quantidade de novas brotaes contendo gemas jovens,
menores e menos contaminadas. Esta medida importante porque os explantes retirados de rgos
recentemente formados so mais capazes de gerar o crescimento e a organognese in vitro;

Biotecnologia

SUMRIO

225

Figura 2: Brotao juvenil emitida aps poda drstica em Rubus idaeus L. cultivado em casa
de vegetao (Imagem: CSFior).
6. Reguladores de crescimento, como giberelinas e citocininas, podem ser aplicados nas
plantas matrizes intactas antes da retirada dos explantes. Estes, com frequncia induzem algum
grau de rejuvenescimento em plantas lenhosas, facilitando a cultura in vitro e induzindo, com
frequncia, a quebra de dormncia de gemas axilares e aumentando o nmero de brotos dos quais
os explantes podem ser tirados. O uso das citocininas em plantas matrizes pode aumentar o nmero
de gemas, propiciando mais brotos para retirada de explantes. A dosagem tima de reguladores de
crescimento para induzir morfognese frequentemente varia de acordo com o tamanho e o tipo de
explante de uma nica planta.

Biotecnologia

SUMRIO

226

CAPTULO 10
ISOLAMENTO E CARACTERIZAO DE BACTRIAS
PROMOTORAS DE CRESCIMENTO VEGETAL
Adriana Ambrosini da Silveira, Camille Eichelberger Granada

As bactrias do solo que estabelecem associao benfica com as plantas so comumente


denominadas PGPR (Plant Growth Promoting Rhizobacteria), as quais so naturalmente
encontradas na rizosfera poro de solo intimamente associado s razes. As PGPRs podem
estabelecer relaes do tipo endoftica (entre as clulas do tecido radicular), associativa (na superfcie
radicular ou muito prxima a ela) ou simbitica (atravs da formao de ndulos fixadores de
nitrognio (N) nas razes). Diferentes protocolos so indicados para o isolamento especfico de
endofticos, associativos e simbiticos, assim como diferentes meios de cultura e procedimentos
so requeridos para a obteno de determinados grupos de bactrias, como as formadoras de
endsporos de resistncia ao estresse. Alm disso, os meios de cultura tambm podem ser usados
na busca por determinadas atividades. Os meios de cultura sem adio de N favorecem a obteno
de diazotrficos (fixadores de N atmosfrico - N2), mas no a garantem. A verificao da presena
da atividade de fixao de N dever ser realizada por outros mtodos, como por exemplo, o ensaio
de reduo de acetileno in vitro e dosagem da atividade da enzima responsvel pelo processo de
fixao, a nitrogenase.
A seleo de diazotrficos um dos procedimentos de isolamento de PGPRs mais utilizados
devido importncia do N para a produtividade agrcola. Entretanto, diversas outras caractersticas
de promoo de crescimento vegetal podem ser analisadas entre os isolados, como a produo de
fito-hormnios e a solubilizao de minerais importantes como fsforo e ferro. Uma mesma PGPR
pode apresentar uma ou mais dessas caractersticas, mas o nmero ou o tipo de caracterstica no
assegura que o isolado seja uma boa PGPR. A identificao dos isolados etapa fundamental
e o sequenciamento do gene 16S rRNA auxilia na definio de gneros e at mesmo espcies,
principalmente quando em conjunto com outras caractersticas como morfologia e colorao da
colnia, reao de Gram, capacidade de esporulao, entre outros. Contudo, devido complexidade
da interao entre bactrias e plantas, experimentos de inoculao em cmaras de crescimento (ou
casas de vegetao) e ensaios a campo so indispensveis para avaliao da efetiva promoo de
crescimento vegetal por um isolado bacteriano.

Biotecnologia

SUMRIO

227

10.1 ISOLAMENTO DE DIAZOTRFICOS ENDOFTICOS DE RAIZ


O processo de isolamento de bactrias endofticas envolve a desinfestao das razes para
que o maior nmero possvel de bactrias aderidas superfcie radicular seja eliminado. Suspenses
contendo razes picotadas so posteriormente inoculadas em meios de cultura sem N para a
obteno de diazotrficos. Esse procedimento pode ser aplicado aos mais variados tipos de plantas,
mas alteraes no volume das solues de lavagem podem ser necessrias conforme variaes no
tamanho e morfologia de diferentes razes vegetais.
Mtodo baseado em Dbereiner et al. (Embrapa, 1995)
1. Lavar as razes em gua corrente para mxima retirada de solo rizosfrico.
Dica: aps a coleta do material vegetal, o mesmo deve ser mantido em geladeira por um
perodo mximo de 48 horas at o processo de isolamento.
2. Transferir o material para um recipiente limpo (bquer de 1 L), adicionar 500 ml de lcool
70% e manter as razes submersas por 1 minuto, com agitao manual.
Dica: caso as razes utilizadas sejam de grande porte, como exemplo do girassol, recomendase cortar pedaos menores para uma adequada desinfeco.
3. Descartar todo volume de lcool 70%, adicionar 500 ml de hipoclorito diludo em gua
destilada estril (1:1) e manter as razes submersas por 1 minuto, com agitao manual.
4. Descartar todo volume de hipoclorito, adicionar 500 ml de gua destilada estril e manter
as razes submersas por 1 minuto, com agitao manual.
5. Enxaguar as razes em gua destilada estril por mais quatro vezes, com troca de gua a
cada nova lavagem.
6. Transferir as razes para uma placa de Petri de vidro, ou material similar, e picot-las com
bisturi (placa de Petri e bisturi devero ser previamente esterilizados).
7. Para o preparo das suspenses iniciais, pesar 10 g de razes picotadas e adicionar a um
frasco do tipo erlemeyer (de 200 ml) contendo 90 ml de soluo salina estril (NaCl 0,85%). Realizar
o procedimento em triplicata e manter os frascos sob agitao constante por 12 horas a 28C.
8. Aliquotar 1 ml da suspenso inicial (100) em um tubo de ensaio contendo 9 ml de soluo
salina estril (NaCl 0,85%) para o preparo da diluio 10-1. Agitar fortemente a soluo resultante e
repetir o procedimento at a obteno da diluio 10-3, conforme abaixo:
100: suspenso inicial
10-1: 1ml de suspenso inicial + 9ml de soluo salina.
10-2: 1ml da diluio 10-1 + 9ml de soluo salina.
10-3: 1ml da diluio 10-2 + 9ml de soluo salina.
9. Em triplicata (ou mais repeties, se desejvel), inocular 100 L de cada uma das suspenses
100, 10-1, 10-2 e 10-3 em diferentes frascos de vidro (de 10 ml) contendo 4 ml de meio de cultura semislido sem N (LGI, LGI-P e/ou Nfb, conforme descrito abaixo), e incubar em estufa a 28 C por 1
semana, ou at formar pelcula de crescimento bacteriano.
Dica: para inoculao dos 100 L das suspenses bacterianas, imergir a ponteira at o fundo
do frasco para que os isolados encontrem a concentrao ideal de oxignio para seu crescimento.

Biotecnologia

SUMRIO

228

Meio de cultura
LGI semi-slido sem
Nitrognio

Reagentes
KH2PO4
Sacarose
K2HPO4
MgSO4.2H2O
CaCl2.2H2O
Na2Mo4.2H2O
Soluo de vitaminas *
FeEDTA **
Azul de bromotimol (0,5%) ***
gua destilada
gar puro

Quantidade
0,6 g
5g
0,2 g
0,2 g
0,02 g
0,002 g
1 mL
4 mL
5 mL
Completar volume para
1L
1,8 g

- pH ajustado para 6,0 - 6,2 com cido sulfrico (H2SO4).


- para o preparo do meio LGI slido com N, adicionar tambm 0,01 g/L de extrato de
levedura e 15 g de gar bacteriolgico, ao invs de gar puro.
* Soluo de vitaminas: biotina 10% e piridoxol-HC 20%, em gua destilada; armazenar em
geladeira.
** FeEDTA: dissolver separadamente 5 g de FeSO4 e 6 g de Na2EDTA em aproximadamente
30 ml de gua destilada cada soluo; juntar as duas solues e completar o volume para 1 L; manter
em vidraria escura ou envolto em papel alumnio e armazenar em geladeira.
*** azul de bromotimol (0,5%): adicionar 0,5 g de azul de bromotimol (C27H28Br2O5S) a 100 ml
de KOH 0,2 N; manter em vidraria escura ou envolto em papel alumnio e armazenar em geladeira.
Meio de cultura
LGI-P semi-slido
sem Nitrognio

Reagentes
KH2PO4
Sacarose
K2HPO4
MgSO4.2H2O
FeCl3.6H2O
CaCl2.2H2O
NaMo4.2H2O
Azul de bromotimol (0,5%) *
gua destilada
gar puro

Para 1L
0,6 g
100 g
0,2 g
0,2 g
0,01 g
0,02 g
0,002 g
2,5 mL
Completar volume para 1 L
1,8 g

- pH ajustado para 5,5 com cido actico glacial (CH3COOH).


- para o preparo do meio LGI-P slido com N, adicionar tambm 0,01 g/L de extrato de
levedura e 15 g de gar bacteriolgico, ao invs de gar puro.
* conforme protocolo do meio LGI semisslido sem N, descrito nesse captulo.
Meio de Cultura
Nfb semisslido sem
Nitrognio

Biotecnologia

Reagentes
cido mlico
K2HPO4
MgSO4.7H2O
NaCl
CaCl2.2H2O
Azul de bromotimol (0,5%) *
FeEDTA *
Soluo de vitaminas *
KOH
Soluo de micronutrientes **
gua destilada
gar puro

Para 1L
5g
0,5 g
0,2 g
0,1g
0,02 g
2 mL
4 mL
1 mL
4,5 g
2 mL
Completar volume para 1 L
1,8 g

SUMRIO

229

- pH ajustado para 6,5 - 6,8 com NaOH.


- para o preparo do meio Nfb slido com N, adicionar tambm 0,02 g/L de extrato de
levedura e 15 g de gar bacteriolgico, ao invs de gar puro.
* conforme protocolo do meio LGI semi-slido sem N, descrito nesse captulo.
** Soluo de micronutrientes para o meio Nfb
Reagentes
CuSO4.5H2O
ZnSO4.7H2O
H3BO3
Na2MoO4.2H2O
MnSO4.H2O

Para 100 mL
0,004 g
0,12 g
0,14 g
0,1 g
0,117 g

10. Aps 1 semana, reinocular todas as amostras para novos frascos de vidro contendo os
meios de cultura correspondentes e manter na estufa 28 C por mais 7 dias.
11. Para o isolamento de colnias, realizar um estriamento em placas de Petry contendo meio
de cultura com N (LGI, LGI-P e/ou Nfb, conforme descrito acima), correspondente ao do frasco de
vidro, e incubar em estufa 28 C por 1 ou 2 dias, ou at obter colnias isoladas.
12. Inocular diferentes colnias em tubos de ensaio contendo 3 ml de meio King-B lquido.
Manter os tubos sob agitao constante 28 C por 24 a 48 h, ou at turvar.
Dica: a escolha de uma ou mais colnias por placa opcional, mas se d preferncia ao
isolamento de colnias morfologicamente diferentes, ou com distintas coloraes.
Meio de Cultura
King-B

Reagentes
Glicerol
Peptona
K2HPO4
MgSO4.7H2O
Triptofano
gua destilada

Para 1 L
15 g
20 g
1,15 g
1,50 g
0,50 g
Completar volume para 1 L

13. Realizar a colorao de Gram com cada uma das amostras cultivadas em tubos de ensaio,
para avaliao da pureza do inculo.
14. Aliquotar 1,2 mL do caldo bacteriano e 300 l de glicerol puro estril em tubos criognicos
de 2 mL, a fim de se obter o estoque do isolado em glicerol 20%.
Dica: importante que o tubo criognico seja levemente agitado para uma mistura
homognea. Mantenha os tubos por pelo menos 6 horas a temperatura ambiente antes de estoc-lo
-20 C. Se possvel, armazene os tubos criognicos a -80 C.
Referncia:
DBEREINER, J., BALDANI V.L.D., BALDANI J.I. 1995. Como isolar e identificar bactrias diazotrficas de plantas
no-leguminosas. Braslia Embrapa-SPI, 60 p.

Biotecnologia

SUMRIO

230

10.2 ISOLAMENTO DE DIAZOTRFICOS DE SOLO RIZOSFRICO


O processo de isolamento de bactrias associativas envolve a coleta de solo rizosfrico,
aquele que est intimamente aderido s razes. Posteriormente, as suspenses so inoculadas em
meios de cultura apropriados ao objetivo do estudo, e o processo de isolamento pode ser aplicado a
solos de qualquer procedncia.
Mtodo baseado em Dbereiner et al. (Embrapa, 1995)
1. Coletar o solo rizosfrico.
2. Para o preparo das suspenses iniciais, pesar 10 g de solo rizosfrico e adicionar a um
frasco do tipo erlemeyer (de 200 ml) contendo 90 ml de soluo salina estril (NaCl 0,85%). Realizar
o procedimento em triplicata e manter os frascos sob agitao constante por 12 horas 30C.
3. Os demais passos so os mesmos descritos nos itens 8 a 14 do 10.1 Protocolo de isolamento
de diazotrficos endofticos de raiz, descrito anteriormente.
Referncias:
DBEREINER J., BALDANI V.L.D., BALDANI J.I. 1995. Como isolar e identificar bactrias diazotrficas de plantas
no-leguminosas. Braslia Embrapa-SPI, 60 p.

Biotecnologia

SUMRIO

231

10.3 ISOLAMENTO DE DIAZOTRFICOS FORMADORES DE


ENDSPOROS DE SOLO RIZOSFRICO
O processo envolve a eliminao das clulas vegetativas presentes na rizosfera, o que
favorece o posterior isolamento de bactrias anaerbias facultativas e formadoras de endsporos
de resistncia ao estresse. A utilizao do meio Tiamina-biotina (TB) sem N favorece a obteno de
diazotrficos dos gneros Bacillus e Paenibacillus, Gram-positivos comumente isolados da rizosfera
de plantas. Porm, isolados de outros gneros como, por exemplo, Clostridium e Brevibacillus,
tambm podem ocorrer, mas geralmente em baixo nmero.
Mtodo baseado em Seldin et al. (1983)
1. Aps a obteno do solo rizosfrico e preparo das suspenses em soluo salina
(NaCl 0,85%) (ver 10.2 Protocolo de isolamento de diazotrficos de solo rizosfrico, descrito
anteriormente), incubar as suspenses 100, 10-1, 10-2 e 10-3 80 C por 15 minutos.
Dica: as mesmas suspenses utilizadas para o isolamento de bactrias de solo rizosfrico
podero ser usadas nesse procedimento, mesmo aps um longo perodo de tempo (at 3 meses), se
armazenadas em geladeira.
2. Em triplicata (ou mais repeties, se desejvel), inocular 100 L de cada uma das suspenses
100, 10-1, 10-2 e 10-3 em placas de Petri contendo meio TB sem N (conforme abaixo).
Dica: para a obteno de um maior nmero de isolados recomenda-se a inoculao de pelo
menos cinco placas de cada tipo de solo rizosfrico, mas esse um nmero aleatrio que dever ser
inicialmente pensado pelo pesquisador.
Meio de Cultura
Tiamina-biotina (TB) sem
Nitrognio

Reagentes
Glicose
MgSO4.7H2O
FeCl3.6H2O
NaMoO4.2H2O
CaCl2.2H2O
K2HPO4
Soluo de tiamina (0,5 mg/ml)
Soluo de biotina (0,5 mg/ml)
Tioglicolato de sdio
Soluo de micronutriente de Jurgensen
*
gua destilada

Soluo de micronutriente de Jurgensen *


Reagentes
H3BO3
MnCl2.4H2O
ZnSO4.7H2O
CuSO45H2O

gar puro

Para 1L
5g
0,2 g
0,04 g
0,005 g
0,15 g
0,8 g
2 ml
2 ml
0,5 g
1 ml
completar volume
para 1 L
15 g

Para 100 mL
0,286 g
0,181 g
0,022 g
0,008 g

3. Organizar as placas em uma jarra de anaerobiose e incubar 28 C por 1 semana.


4. Para o isolamento de colnias, realizar um estriamento em placas de Petri contendo o
mesmo meio TB sem N e incubar novamente a 28 C por 1 semana em jarra de anaerobiose.
Dica: a escolha de uma nica colnia por placa opcional, pois se d preferncia ao isolamento
de colnias morfologicamente diferentes, ou com distintas coloraes.

Biotecnologia

SUMRIO

232

5. Inocular diferentes colnias em tubos de ensaio contendo 3 ml de meio King-B lquido (ver
Protocolo de isolamento de diazotrficos endofticos de raiz, descrito nesse captulo). Manter os
tubos sob agitao constante 28 C por 24 a 48 h, ou at turvar.
6. Realizar a colorao de Gram com cada uma das amostras cultivadas em tubos de ensaio,
para avaliao da pureza do inculo.
7. Aliquotar 1,2 mL do caldo bacteriano e 300 l de glicerol puro estril em tubos criognicos
de 2 mL, a fim de se obter o estoque do isolado em glicerol 20%.
Dica: importante que o tubo criognico seja levemente agitado para uma mistura
homognea. Mantenha os tubos por, pelo menos, 6 horas a temperatura ambiente antes de estoc-lo
-20 C. Se possvel, armazene os tubos criognicos -80 C.
Referncias:
SELDIN L., van Elsas J.D., PENIDO E.G.C. 1983. Bacillus nitrogens fixers from Brazilian soils. Plant Soil 70:243-255.

Biotecnologia

SUMRIO

233

10.4 ISOLAMENTO DE RIZBIOS


As bactrias isoladas de ndulos radiculares de leguminosas so popularmente conhecidas
como rizbios. Os rizbios fixam o nitrognio atmosfrico quando em associao com leguminosas,
podendo suprir todo o nitrognio necessrio para o pleno desenvolvimento da planta em associao.
Os gneros bacterianos de rizbios mais conhecidos so: Rhizobium, Bradyrhizobium, Mesorhizobium
e Sinorhizobium.
Mtodo baseado em Somasegaram & Hoben (1985).
1. Retirar os ndulos das razes da leguminosa estudada.
2. Desinfestar os ndulos obtidos por imerso em lcool 70% e soluo de hipoclorito (2%) por 1
minuto cada. Aps este procedimento, lavar os ndulos com gua destilada esterilizada (cinco vezes).
3. Em um microtubo, macerar o ndulo desinfestado em 500 L de soluo salina (NaCl 0,85%).
4. Inocular aproximadamente 20 L da suspenso obtida anteriormente em meio gar
Levedura Manitol (Vincent, 1970) usando a tcnica de purificao para obteno de colnias isoladas.
Meio de cultura
Levedura Manitol

Componentes
Manitol
K2HPO4
MgSO4 . 7H2O
NaCl
Extrato de levedura
Corante vermelho congo
gar
gua destilada

Quantidade
10 g
0,5 g
0,2 g
0,1 g
0,4 g
25 mg*
12 g
Completar o volume para 1L

* Usar 10mL de uma soluo de vermelho congo 2,5g . L-1. Ajustar o pH do meio de cultura
para 6,8 antes de esterilizar.
5. Incubar a placa em estufa 28C por um perodo de 2 a 10 dias.
Dica: as bactrias do gnero Rhizobium demoram de dois a trs dias para o aparecimento
de colnias em meio Levedura Manitol. Os isolados de Bradyrhizobium demoram de 6-10 dias. Os
gneros Mesorhizobium e Sinorhizobium possuem tempo de crescimento intermedirio.
6. As colnias caractersticas devem ser inoculadas em meio Levedura Manitol lquido 28C
at que a soluo fique turva (usar o mesmo meio descrito anteriormente sem adio de gar e o
corante Vermelho Congo).
Dica: sero consideradas caractersticas as colnias com bordas lisas, que no absorverem
corante, possurem colorao leitosa e aspecto gomoso.
7. Em um tubo estril adicionar 1mL da cultura bacteriana crescida em meio lquido
juntamente com 800-1000 L de glicerol estril. Agitar suavemente a soluo resultante at que esta
fique homognea.
8. Deixar a soluo a temperatura ambiente por 2-5 horas agitando suavemente a cada 30
minutos.
9. Estocar a soluo -20C.
Dica: quando for necessrio trabalhar com o isolado bacteriano que est preservado em
glicerol, inocular 20 L do estoque em meio de cultura apropriado.
Referncias
SOMASEGARAM P, HOBEN MJ. Methods in legume-rhizobium technology. NIFTAL, Hawaii, p 367. 1985.

Biotecnologia

SUMRIO

234

10.5 IDENTIFICAO DO GNERO E ESPCIE BACTERIANA


Atualmente, somente o isolamento e os testes bioqumicos no so o suficiente para a
identificao bacteriana. Para confirmao do gnero e espcie da bactria estudada, devemos
caracterizar o gene 16S rDNA (codifica a subunidade menor do ribossomo bacteriano) por tcnicas
de biologia molecular. Este protocolo descreve dois oligonucleotdeos iniciadores e as reaes de
PCR para caracterizao do gene 16S rDNA em bactrias.
1. Extrair o DNA do isolado bacteriano conforme descrito no protocolo de extrao de DNA
de um isolado bacteriano descrito no captulo 2: Extrao e quantificao de cidos nuclicos e
protenas.
2. Utilizar 50-100 ng de DNA para reao de PCR com seguintes oligonucleotdeos iniciadores:
Para amplificar um fragmento de aproximadamente 450 pares de bases da regio V6 do gene
16S rDNA, usar os oligonucleotdeos iniciadores:
Nome
U968 For
L1401 Rev

Sequncia
5 AAC GCG AAG AAC CTT AC 3
5 CGG TGT GTA CAA GAC CC 3

Posio
968-985
1401-1418

Condies da PCR
94 C 5 min; 30 ciclos de 94 C 45 seg, 52 C 45 seg, 72 C 45 seg; e 72 C 10 min
Dica: pelo alto nvel de conservao do gene 16S rDNA em bactrias, estes oligonucleotdeos
iniciadores amplificam o gene em qualquer espcie bacteriana.
Dica: como esta reao amplifica somente um poro do gene 16S rDNA, por esta metodologia
podemos identificar somente o gnero bacteriano.
Para amplificar o gene 16S rDNA completo, usar os oligonucleotdeos iniciadores:
Nome
pA
1542R

Sequncia
5 AGA GTT TGA TCC TGG CTC AG 3
5 AGA AAG GAG GTG ATC CAG CC 3

Posio
8-28
1525-1542

Condies da PCR
94 C 5 min; 30 ciclos de 94 C 45 seg, 55 C 45 seg, 72 C 1 min; e 72 C 5 min
Dica: pelo alto nvel de conservao do gene 16S rDNA em bactrias, estes oligonucleotdeos
iniciadores amplificam o gene em qualquer espcie bacteriana.
Dica: como esta reao amplifica o gene 16S rDNA completo, por esta metodologia podemos
identificar o gnero e a espcie bacteriana.
3. O fragmento do DNA obtido pelos PCRs descritos acima deve ser sequenciado.
4. A sequncia obtida deve ser comparada com as sequncias do banco de dados GenBank
pelo software BlastN (disponvel em http://blast.ncbi.nlm.nih.gov) ou ez-taxon (disponvel em
http://www.ezbiocloud.net/eztaxon).
Referncias:
FELSKE A, RHEIMS H, WOKERINK A, STACKEBRANDT E, AKKERMANS DL.
Ribosome analysis reveals prominent activity of an uncultured member of the class Actinobacteria in grasslands
soils. Microbiol 143:29832989. 1997.
BROSIUS J, PALMER ML, KENNEDY PJ and NOLLER HF (1978). Complete nucleotide sequence of a 16s ribosomal
RNA gene from Escherichia coli. Proc Natl Acad Sci USA 75:4801-4805.
STACKEBRANDT, E., LIESACK, W. Nucleic acids and classification, p.151194. In M. Goodfellow and A. ODonnell
(ed.), Handbook of new bacterial systematics. Academic Press, London. 1993.

Biotecnologia

SUMRIO

235

EDWARDS U, ROGALL T, BLOCKERL H, EMDE M, BOTTGER EC,. Isolation and direct complete nucleotide
determination of entire genes. Characterization of a gene coding for 16S ribosomal RNA. Nucleic Acids Research
17(19):7843-7853. 1989.

Biotecnologia

SUMRIO

236

10.6 PRODUO DE COMPOSTOS INDLICOS


Compostos indlicos semelhantes ao cido indol-actico so de fundamental importncia
para o crescimento e desenvolvimento da planta. Hormnios vegetais pertencentes a este grupo
aumentam a taxa de formao de razes; controlam o processo de crescimento vegetativo, tropismo,
florescncia e frutificao das plantas; afetam a biossntese de vrios metablitos e aumentam a
resistncia da planta a fatores de estresse.
Mtodo baseado em Glickmann e Dessaux (1995)
1. Inocular o isolado bacteriano a ser testado em meio KingB modificado lquido por 72 horas
28 C.
Meio
KingB

Composio
Glicerol
Peptona
K2HPO4
MgSO4.7H2O
Triptofano
gua destilada

Quantidade
15 g
20 g
1,15 g
1,50 g
0,5 g
Completar o volume para 1L

O pH deve ser ajustado para 6,8 antes de esterilizar.


2. Aps o crescimento da cultura bacteriana, aliquotar 1 mL da suspenso bacteriana em um
microtubo e centrifugar a 12.000 rpm por 3 minutos.
3. Retirar o sobrenadante e adicionar 1 volume de reagente de Salkowsky
Soluo
Salkowsky

Composio
FeCl3
H2SO4
gua destilada

Quantidade
2,4 g
84,2 mL
Completar o volume para 200 mL

Dicas: dissolver o FeCl3 em aproximadamente 80 mL de gua destilada. Ir adicionando o


H2SO4 aos poucos na soluo. Completar o volume para 200 mL com gua destilada.
4. Manter as amostras por 30 minutos no escuro.
Dica: transcorrido os 30 minutos, as solues que adquirirem a colorao rosada so
consideradas produtoras de compostos indlicos.
5. Fazer a leitura da absorbncia em espectrofotmetro 520nm.
Dica: para transformar os dados obtidos na absorbncia para g . mL-1 deve ser elaborada
uma curva com concentraes conhecidas de algum composto do grupo indol (exemplo: cido
indol-actico, cido indol-butrico e etc).
Referncia:
GLICKMANN E., DESSAUX Y.: A critical examination of the specificity of the Salkowski reagent for indolic
compounds produced by phytopathogenic bacteria. Appl Environ Microbiol 61(2):793-796. 1995.

Biotecnologia

SUMRIO

237

10.7 SOLUBILIZAO DE FOSFATO DE CLCIO


O fsforo um dos macronutrientes essenciais para o crescimento e desenvolvimento das
plantas. Este elemento um dos mais abundantes no solo. Entretanto, uma quantia muito baixa
deste elemento est complexada de uma maneira solvel e disponvel para as plantas. A habilidade
de solubilizar fosfato frequentemente encontrada em microrganismos que, por meio da liberao
fosfatases e/ou acidificao do solo, solubilizam fosfato mineral insolvel e liberam ons solveis
que podem ser captados pelas plantas.
Mtodo baseado em Sylvester-Bradley et al. (1982)
1. Crescer o isolado bacteriano em um meio de cultura apropriado para seu pleno
desenvolvimento.
2. Preparar a soluo 1, soluo 2 e meio GL.
Meio de Cultura
Soluo 1
Soluo 2
Meio GL

Componente
K2HPO4
gua destilada
CaCl2
gua destilada
Glicose
Extrato de levedura
gar
gua destilada

Quantidade
5g
50 mL de gua destilada
10 g
100 mL de gua destilada
10 g
2g
15 g
Completar para 1L

O pH do meio GL deve ser ajustado para 6,8. As solues 1 e 2 e o meio GL devem ser
autoclavadas separadamente.
3. Antes de verter o meio de cultura GL em placas de Petri, misturar a este as soluo 1 e 2 e
homogeneizar a soluo resultante.
Dica: a soluo resultante deve apresentar um fino precipitado esbranquiado (Ca3(PO4)2).
Este precipitado deve ser homogeneizado, juntamente com o meio antes de ser vertido.
4. Inocular 20 L da cultura bacteriana previamente crescida em meio lquido ao meio slido
obtido.
5. Esperar a gota secar e incubar 28C por 3-5 dias.
6. A formao de um halo de solubilizao claro entorno da colnia bacteriana indicativo
que este isolado solubilizou o fosfato precipitado.
Referncia:
SYLVESTER-BRADLEY R., ASAKAWA N., LA TORRACA S., MAGALHES FMM., OLIVEIRA L., PEREIRA
RM.: Levantamento quantitativo de microrganismos solubilizadores de fosfatos na rizosfera de gramneas e
leguminosas forrageiras na Amaznia. Acta Amazon 12:1522.1982.

Biotecnologia

SUMRIO

238

10.8 PRODUO DE SIDERFOROS BACTERIANOS


Siderforos no ligantes de ferro com importante funo na promoo de crescimento
vegetal e na supresso de doenas fngicas. Estas molculas se ligam ao ferro insolvel do solo
(que no pode ser absorvido pelas plantas) tornando-o disponvel para absoro da microbiota e
das plantas. Alm do Ferro, os siderforos bacterianos podem se ligar a metais como cromo (Cr),
chumbo (Pb), alumnio (Al), cdmio (Cd), cobre (Cu) e zinco (Zn) sendo de essencial importncia
na biorremediao de solos contaminados.
Mtodo baseado em Schwyn & Neilands (1987)
1. Crescer o isolado bacteriano a ser testado no meio de cultura lquido mais apropriado para
seu pleno desenvolvimento.
2. Preparar o meio de cultura gar KingB diludo.
Meio de Cultura
gar King B

Componente
Glicerol
Peptona
K2HPO4
MgSO4.7H2O
gar
gua destilada

Quantidade
3g
4g
0,23 g
0,3 g
15 g
Completar o volume para 1L

Ajustar o pH para 6,8. Autoclavar a 121 C por 15 minutos.


3. Preparar o corante CAS.
Corante
CAS - Chrome
Azurol S

Composio
Soluo 1
Soluo 2
Soluo 3
Soluo 4

Quantidade
7,5 mL
37,5 mL
30 mL
Completar o volume

Autoclavar um erlenmeyer de 500mL com 100mL de gua ultrapura.


Adicionar lentamente o volume das Sol 1 e Sol 2.
Acrescentar o volume da Sol 3.
Completar o volume com a Sol.4.
Dica: realizar todos procedimentos com gua ultrapura e vidrarias estreis e dentro do fluxo,
sempre que possvel.
SOLUO 1
Composio
FeCl3.6 H2O
HCl

Quantidade
13,5 mg
41 mL

Proteger da luz. Volume final 50 mL

Concentrao final
1 mM
10 mM

SOLUO 2
Composio
CAS
gua ultrapura estril

Quantidade
121 mg
Completar o volume para 100
mL

Concentrao final
2 mM

Proteger da luz

Biotecnologia

SUMRIO

239

SOLUO 3
Composio
CTAB (HDTMA)
gua ultrapura estril
Proteger da luz

Quantidade
364,45 mg
Completar o volume para 100 mL

Concentrao final
10 mM

SOLUO 4
Composio
Piperazina anidra
HCl 12M (puro = 37%)
Volume da Soluo Final

Diluir em 20mL
4,307 g
6,25 mL
100 mL

Diluir em 100mL
21,535 g
~ 31,25 mL
500 mL

Adicionar HCl aos poucos at pH 5,6. Esta soluo deve ser preparada na hora.
4. Aps esterilizar o meio gar King B, esperar a temperatura baixar um pouco e adicionar
aproximadamente 20% do volume do meio de corante CAS ao meio.
5. Verter a mistura resultante em placas de Petri estreis.
Dica: o meio de cultura dever ter a colorao azul escuro. Caso o meio fique com outra
colorao voc deve ter errado o pH do meio ou vertido o corante, quando o meio ainda estava
muito quente.
6. Inocular uma gota de aproximadamente 20 L da cultura bacteriana crescida no meio
lquido na placa de Petri preparada anteriormente.
7. Incubar a 28C por 2-3 dias.
8. O aparecimento de um halo cor laranja em torno da colnia bacteriana indicativo de
produo de siderforos.
Referncia:
SCHWYN B & NEILANDS JB.: Universal chemical assay for the detection and determination of siderophores. Anal
Biochem 160: 47-56. 1987.

Biotecnologia

SUMRIO

240

10.9 ATIVIDADE DA ENZIMA ACC DEAMINASE


O ACC (1-aminociclopropano-1-carboxilato) o precursor da sntese de etileno em plantas
superiores, fito-hormnio que tem sua sntese aumentada sob diversas situaes de estresse.
Bactrias que possuem atividade de ACC deaminase podem contribuir para a reduo dos nveis
de etileno na rizosfera por meio do sequestro e clivagem de ACC a cido -cetobutirato e amnia.
Um screening da atividade de ACC deaminase pode ser avaliada em meio mnimo contendo ACC
como recurso de N, por meio da comparao de desenvolvimento e tamanho da colnia bacteriana
na presena (meio DF salts sem N e contendo ACC) ou ausncia (meio DF salts sem N) de N.
Mtodo baseado em Penrose & Glick (2003)
1. Para o preparo do meio de cultura DF salts sem N (Dworkin & Foster, 1958), dissolver os
reagentes em aproximadamente 700 ml de gua destilada, conforme a tabela abaixo:
Meio de cultura
DF salts sem
Nitrognio

Reagentes
KH2PO4
Na2HPO4
MgSO4.7H2O
Glicose
cido glucnico
cido ctrico
FeSO4.7H2O *
Soluo de elementos-trao **
gua destilada

Para 1 L
4g
6g
0,2 g
2g
2g
2g
100 L
100 L
Completar volume para 1L

* Soluo de FeSO4.7H2O: 0,1 g em 10 mL de gua; manter em vidraria escura ou envolto em


papel alumnio e armazenar em geladeira.
** Soluo de elementos-trao:
Reagentes
H3BO3
MnSO4.H2O
ZnSO4.7H2O
CuSO4.5H2O

Volume - 100 mL
0,01 g
0,01119 g
0,1246 g
0,07822 g

2. Regular o pH para 7,2 com KOH 5M, completar o volume para 1 L com gua destilada e
adicionar 10 g de gar puro.
3. Aps solidificado em placa de Petri, espalhar 50 L de ACC 0,5 M sobre o meio.
Dica: s descongelar a ACC no momento de uso e no mant-la fora do gelo por tempo
maior que o necessrio.
4. Inocular pela tcnica da gota 2 L de um caldo bacteriano recentemente cultivado e incubar
as placas 28 C por cerca de 5 dias, acompanhando o desenvolvimento da colnia diariamente.
5. Como controle negativo de crescimento so utilizadas placas de Petri sem adio de ACC,
contendo apenas o meio de cultura DF salts sem N.
Dica: importante destacar que mesmo no meio sem N e ACC (controle negativo) poder
haver crescimento bacteriano, mas em menor grau e tamanho de colnia quando comparado
ao meio contendo ACC. A diferena de crescimento o indicativo da atividade da enzima. A
quantificao de a-cetobutirato fornece maior preciso da atividade enzimtica e pode ser avaliada
por ensaios espectrofotomtricos (PENROSE & GLICK, 2003).
Referncias:
DRORKIN, M. & FOSTER, J.: Experiments with some microorganisms which utilize ethane and hydrogen. J
Bacteriol 75:592-601. 1958.
PENROSE, D.M. & GLICK, B.R. Methods for isolating and characterizing ACC deaminase-containing plant growthpromoting rhizobacteria. Physiol Planta 118:10-15. 2003.

Biotecnologia

SUMRIO

241

CAPTULO 11
ANLISES BSICAS DE BIOINFORMTICA
Felipe Klein Ricachenevsky, Walter Orlando Beys da Silva

Biotecnologia

SUMRIO

242

11.1 DESENHO DE INICIADORES (PRIMERS) PARA PCR UTILIZANDO


SOFTWARES ONLINE
O desenho ou projeto de primers tem por funo permitir a deteco, clonagem ou
sequenciamento de fragmentos especficos de DNA.
Uso do software Oligo Perfect Designer, da Invitrogen/Life Technologies, para projetar
primers:
1. Acessar o site http://tools.lifetechnologies.com/content.cfm?pageid=9716.
2. Colar a sequncia de DNA para a qual se deseja projetar primers na caixa adequada (Target
sequence).
3. Selecionar a aplicao desejada para o primer (PCR: Cloning para clonagem; PCR: Detection
para deteco; e Sequencing para sequenciamento). Preencher as caixas opcionais, informando o
nome da sequncia e o nome do pesquisador, caso necessrio.
Clicar em Submit.
Dica: a seleo de uma aplicao no necessariamente restringe o uso do primer projetado
quela aplicao. A seleo importante somente para que o programa permita ao usurio informar
as caractersticas tpicas para cada tipo de PCR. Por exemplo: caso a aplicao selecionada seja PCR:
Cloning, a prxima pgina do programa exigir que o usurio informe o fragmento exato a ser
amplificado, indicando o nucleotdeo de incio e de trmino. J em PCR: Detection, o programa pede
apenas o tamanho do fragmento a ser detectado e qual regio da sequncia deve ser considerada,
permitindo ao programa a busca pelos melhores pares de primers dentro dessa regio.
4. Para primers visando clonagem (opo PCR: Cloning), definir a regio a ser clonada.
Lembrar que, neste caso, os primers comearo e terminaro exatamente nos nucleotdeos definidos.
Para primers visando a deteco (opo PCR: Detection), definir tanto a regio a ser analisada em
busca de primers quanto o tamanho do fragmento a ser amplificado. Lembrar que, neste caso, o
programa buscar primers que estejam dentro dos parmetros definidos, podendo haver variao
do nucleotdeo de incio e de trmino.
Para primers para sequenciamento (opo Sequencing), definir a regio a ser sequenciada
(Sequencing Region), a sequncia inicial para anelamento do primeiro primer (Primer Position: Lead) e
o nmero de nucleotdeos de intervalo entre cada primer (Spacing). Lembrar que, neste caso, sero
gerados primers em intervalos regulares.
Clicar em Submit.
Dica: inicialmente, no alterar os outros parmetros. Caso o programa no encontre primers
dentro dos parmetros iniciais (mensagem No primers could be found within your specified parameters.
Please loosen your parameters and try again), tente aumentar a Tm (Primer Tm (C)) mxima e diminuir
a mnima (por exemplo, para 65 e 55, respectivamente). Tambm pode ser necessrio indicar outra
regio da sequncia para ser analisada.
5. Analisar os resultados. O programa indica a porcentagem de GC (%GC), se o primer
direto ou reverso (Strand), tamanho (Size) e Tm (Tm C). Clicar em Highlight Target Sequence para
ver onde os primers anelam na sequncia-alvo.
Dica: primers ideais tem em torno de 50% de GC, tamanho de 20 pares de bases e Tm em
torno de 60 C.

Biotecnologia

SUMRIO

243

11.2 VERIFICAO DA QUALIDADE DOS PRIMERS PROJETADOS


Apesar de robustos, os programas para projetar primers muitas vezes podem fornecer primers
no-ideais, que podem prejudicar o seu uso na bancada. Assim, interessante usar softwares
complementares para analisar a possibilidade de amplificao inespecfica, e formao de homo e
heterodmeros. O primeiro software o Primer-BLAST do NCBI, que permite verificar se os primers
projetados so complementares a outras sequncias que no as que se deseja amplificar. O segundo
o website da IDT (Integrated DNA Technologies), que permite verificar se cada primer projetado
anela em si mesmo ou no outro primer que compe o par.
Verificao de inespecificidade dos primers usando a ferramenta Primer-BLAST do National
Center for Biotechnology Information (NCBI):
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, encontrar dentre as opes de Specialized BLAST o link para PrimerBLAST.
Dica: para acessar o site mais facilmente, basta digital ncbi primer blast no Google.
3. Na pgina do Primer-BLAST, colar a sequncia dos primers projetados anteriormente nas
respectivas caixas. Elas so as primeiras na seo Primer Parameters.
4. Na seo Primer Pair Specificity Checking Parameters, selecionar o tipo de base de dados
(Database). Caso esteja analisando uma sequncia expressa, selecionar as base de dados de RNA
(Refseq RNA ou Refseq mRNA). Caso esteja analisando uma sequncia de DNA genmico, selecionar
as bases de dados de genoma (Genome).
Dica: caso queira incluir o maior nmero de sequncias possvel, tanto genmicas quanto
expressas, selecionar a base de dados nr. Ela refere-se non-redundant (no-redundante), ou
seja, inclui todas as sequncias presentes no banco que no sejam repetidas.
5. Informar qual o organismo para o qual os primers foram desenhados (Organism). Devido
grande demanda de uso para sequncias derivadas de humano, o padro da pgina manter
o organismo como Homo sapiens. Caso esteja analisando primers para sequncias de humanos,
portanto, no necessrio mudar. No caso de outro organismos, digitar.
Dica: quando comear a digitar o nome do organismo, uma lista com opes aparecer,
facilitando encontrar o nome que se deseja e evitando erros de digitao.
6. Clicar em Get Primers.
7. Na pgina contendo o resultado, verificar Products on target templates. Para cada possvel
sequncia amplificada, mostrado o nmero de acesso da mesma, o tamanho do produto em
pares de bases, e a complementariedade entre os primers (parte superior) e a sequncia-alvo (parte
inferior). So mostrados, na parte inferior, apenas os nucleotdeos que no so complementares
sequncia dos primers. Para aqueles que so complementares, h um ponto. Em geral, o primeiro
resultado referente sequncia para a qual os primers foram projetados. Verifique as sequncias
seguintes, a fim de identificar aquelas que possivelmente possuem complementariedade com os
primers e que poderiam gerar bandas inespecficas em uma PCR.
Dica: algumas vezes, h mais de um registro (nmero de acesso) para uma mesma sequncia.
Nestes casos, os resultados mostraro duas ou mais sequncias com complementariedade perfeita,
induzindo o usurio a pensar que os primers no sero especficos e anelam igualmente em
ambas. Observe o tamanho do produto amplificado (product length); se for o mesmo para todas as
sequncias, provvel que sejam apenas registros independentes da mesma sequncia.

Biotecnologia

SUMRIO

244

Dica 2: ao verificar se h complementariedade dos primers com outros produtos, importante


observar se essa complementariedade extensa o suficiente para que o mesmo seja amplificado em
uma PCR. Embora no haja como prever in silico, cuidar principalmente se a complementaridade
ocorre nos nucleotdeos mais a 3 do primer (regio de reconhecimento da DNA Polimerase) e se
o produto a ser gerado de tamanho compatvel com a reao (por exemplo, produtos de 10.000
pares de bases no seriam problemticos em uma PCR cujo produto que se deseja amplificar tenha
de 100 a 200 pares de bases).
Verificao da possibilidade de formao de homodmeros e heterodmeros entre primers
usando a ferramenta OligoAnalyzer da IDT (Integrated DNA Technologies):
1. Acessar o site https://www.idtdna.com/analyzer/Applications/OligoAnalyzer/.
Dica: para encontrar diretamente o site, digitar oligoanalyzer IDT no Google.
2. Colar a sequncia do primer a ser analisado na janela apropriada (Sequence).
3. Clicar em Hairpin. Esta opo analisar a possibilidade de formao de pareamentos
intra-cadeia na sequncia do primer, o que pode impedir o seu anelamento com a sequncia-alvo.
4. Analisar os resultados na seo Structures. Verificar a temperatura em que cada
pareamento intra-cadeia ocorre (Tm C).
Dica: os pareamentos intra-cadeia que podem tornar um primer problemtico so aqueles
que ocorrem prximos a temperaturas utilizadas na PCR. Aqueles que ocorrem em temperaturas
muito baixas no so relevantes.
5. Clicar em Self-dimer. Esta opo analisar a possibilidade de formao de pareamentos
entre duas molculas do mesmo primer, o que pode impedir o seu anelamento com a sequnciaalvo.
6. Analisar os resultados na seo Homo-dimer analysis. Verificar pareamentos que
contenham mais do que quatro pares de base consecutivos pareados entre duas molculas do
mesmo primer.
Dica: pareamentos relevantes so representados por linhas contnuas, e o nmero de pares
de bases pareadas mostrado para cada possibilidade (Base pairs).
7. Clicar em Hetero-dimer. Colar a sequncia do segundo primer a ser utilizado na PCR na
caixa Secondary sequence. Esta opo analisar a possibilidade de formao de pareamentos entre
as duas molculas de primer, o que pode impedir o seu anelamento com a sequncia-alvo. Clicar em
Calculate.
8. Analisar os resultados na seo Hetero-dimer analysis. Verificar pareamentos que
contenham mais do que quatro pares de base consecutivos pareados entre as molculas dos dois
primers.
Dica: pareamentos relevantes so representados por linhas contnuas, e o nmero de pares
de bases pareadas mostrado para cada possibilidade (Base pairs).

Biotecnologia

SUMRIO

245

11.3 PREPARAO DE ARQUIVO CONTENDO SEQUNCIA NO


FORMATO FASTA
O arquivo FASTA um formato simples de armazenar sequncias mltiplas, e que permite
aos programas de anlise reconhecer cada fragmento de sequncia a ser analisado.
Preparando um arquivo no formato FASTA:
Cada sequncia deve ser precedida por um identificador. Em um processador de texto
(Microsoft Word, Bloco de Notas, Pages), coloque o sinal de >, seguido de um nome, cdigo
ou nmero. Aps, pressione em enter para iniciar um novo pargrafo. Os programa que leem
arquivos FASTA consideraro quaisquer caracteres entre o sinal de > e o enter como o
identificador da sequncia.
Dica: quando estiver trabalhando com genes cujos loci so conhecidos, interessante us-los
como identificadores, para evitar confuso, o que mais provvel se nomes como sequencia1 ou
geneA for utilizado.
Copie e cole a sequncia referente ao identificador no novo pargrafo. A sequncia pode
ser de nucleotdeos (e portanto conter os caracteres A, T, C e G) ou de protenas (e portanto
conter caracteres referentes ao cdigo IUPAC de uma letra para amino cidos - http://www.
bioinformatics.org/sms/iupac.html).
Esta a cara que o texto do arquivo deve ter:
> Identificador
TAGCTACGTACGATCGATCGATCGATCGATCGATCGATCGATAGCTAGCTACGTAC
GATCGATCGACGATCGATCGATCGATTATATATGATCGATATAGTAGCTAGCAT
CGATCGATTAGTAGCATCGATCGATCGATCGATCGATCGATCGTACGATC
GATCGATCGATCGATCGATATATATTAG
> Identificador2
MERFVQFLRRGNGLMAASLAAGSCAEEVAKAEGAGCRDDAAALRLKGVAMATILVA
GVVGVGLPLAGRKRRALRTDSAAFVAAKAFAAGVILATGFVHMLHDAEHALSSPCLPAHPW
RSFPFPGFVAMSAALATLVLDFLATRFYEGKHRAETERVKAAAAAALAASSASDDDITVVT
VTEDDNDNKAPLLQ
Dica: apesar de poder salvar como arquivo do prprio processador de texto, o ideal converter
o arquivo em .txt, por este ser mais leve (especialmente trabalhando com vrias sequncias em um
mesmo arquivo) e por permitir o acesso de uma gama maior de programas. Outra possibilidade
salvar as sequncias FASTA em uma planilha do Excel. Para isso, necessrio retirar todos os
espaos entre os caracteres que compem a sequncia. No Excel, uma clula conter o sinal de
> e o identificador, e a clula abaixo conter a sequncia, j sem espaos. Esta maneira facilita o
armazenamento, devido ao menor tamanho do arquivo.

Biotecnologia

SUMRIO

246

11.4 OBTENO DE SEQUNCIAS REVERSO-COMPLEMENTAR


As sequncias de nucleotdeos so escritas normalmente no sentido 5 para 3, e representam
uma dupla-fita de DNA, para a qual apenas uma das fitas escrita. Dependendo da necessidade,
muitas vezes interessante obter a sequncia da fita oposta, que reversa (ou seja, orientada de
3 para 5 em relao fita para a qual se conhece as sequncias) e complementar (baseada no
pareamento de bases A-T e C-G) que se est utilizando.
Sequncia reverso-complementar:
Acesse o site abaixo:
(http://www.bioinformatics.org/sms/rev_comp.html).
Dica: para encontrar diretamente o site, digitar reverse complement no Google.
Na janela, cole a sequncia para o qual deseja gerar a sequncia reverso-complementar.
Clique em Submit.
Dica: caso deseje gerar apenas a sequncia reversa, ou apenas a sequncia complementar,
modifique a opo selecionada no menu abaixo da janela para reverse ou complement. A opopadro ser sempre reverse-complement.
A sequncia reverso-complementar ser gerada em uma nova janela.

Biotecnologia

SUMRIO

247

11.5 BUSCA DE SIMILARIDADE DE SEQUNCIAS UTILIZANDO UM


BANCO DE DADOS DE SEQUNCIAS E AS FERRAMENTAS BLAST
(BASIC LOCAL ALIGNMENT SEARCH TOOL)
Sequncias de nucleotdeos e amino cidos apresentam similaridade com outras sequncias,
principalmente quando estas so relacionadas evolutivamente. Por exemplo, sequncias de genes
que so parte de uma mesma famlia gnica apresentam regies parecidas, em diferentes graus.
A ferramenta BLAST permite identificar as regies de uma sequncia de interesse (query) que se
parea com outras presentes em bancos de dados, como o GenBank. Isto pode ser feito tanto com
sequncias de nucleotdeos quanto de protena. O BLAST se baseia no chamado alinhamento local,
que permite alinhar pores de uma sequncia de interesse com outras, sem necessariamente
comparar todos os nucleotdeos/amino cidos presentes nas mesmas. Portanto, o alinhamento
local alinha pedaos similares de sequncia e mostra o quo parecidos estes fragmentos so, mas
no obrigatoriamente mostra o quo similar as duas sequncias completas so.
Busca por similaridade em banco de dados de nucleotdeo utilizando sequncia nucleotdica
como query BLASTn (nucleotdeos X nucleotdeos):
O BLASTn utilizando quando se quer encontrar sequncias de nucleotdeos em um banco
de dados que apresentem similaridade com uma sequncia de interesse tambm de nucleotdeos.
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, clique na opo nucleotide blast, na seo Basic BLAST.
3. Na caixa Enter query sequence, cole a sequncia de nucleotdeos que deseja alinhar com o
banco de dados.
4. No menu Database, selecione o conjunto de dados contra o qual a sequncia de interesse
ser alinhada. Caso queira buscar em todo o banco de dados do GenBank, selecione Nucleotide
collection.
Dica: se o objetivo for buscar sequncias derivadas de mRNA (sequncias expressas),
selecionar dentre os conjuntos de dados aqueles que correspondem a este tipo de dado (Reference
RNA sequences). Se o objetivo for buscar sequncias genmicas, selecionar aqueles que correspondem
a sequncias derivadas de DNA genmico (Reference genomic sequences).
5. Na caixa Organism, possvel restringir as buscas para apenas aquelas que so derivadas
de um organismos especfico. Tambm possvel excluir apenas essa espcie, clicando no boto
Exclude; e adicionar mais organismos para restringir ou excluir os mesmos das buscas (boto
+).
6. Clique em BLAST. O resultado pode demorar alguns minutos.
7. Analisar os resultados. Na seo Graphic Summary, possvel ver uma representao
grfica dos resultados. O tamanho das barras coloridas indica a extenso do alinhamento da
sequncia de interesse (query) com diferentes sequncias do banco de dados. J as cores indicam
o quo similares elas so. Arrastando o mouse por cima das barras, a caixa acima da representao
grfica mostrar o nome da sequncia com a qual a sequncia query apresenta similaridade.
8. Na seo Descriptions, so mostradas as sequncias que apresentam similaridade, e os
dados que quantificam essa similaridade. Dentre eles, importante observar os seguintes: Query
coverage (indica qual porcentagem da sequncia de interesse coberta pelo alinhamento com
cada sequncia do banco lembre-se que, por se tratar de um alinhamento local, muitas vezes
apenas uma regio de ambas as sequncias sero alinhadas); E value (indica a probabilidade de

Biotecnologia

SUMRIO

248

encontrar aquele alinhamento de maneira aleatria ou seja, quanto menor o valor, maior a
confiana, sendo o E value = 0 o mais confivel); e Identity (indica quantos nucleotdeos idnticos
so encontrados apenas na regio que foi alinhada).
Dica: dependendo do tipo de alinhamento feito, um E value aceitvel pode variar. Por
exemplo, se estamos alinhando sequncias de um organismo que apresenta grande nmero
de sequncias depositadas no banco, como humanos, camundongo, mosca-da-fruta ou arroz,
esperamos encontrar E value baixos, prximo a zero. J no caso de buscarmos sequncias obtidas
a partir de um organismo que no possui muitas sequncias no banco, em geral iremos encontrar
sequncias de outros organismos que apresentam similaridade, mas no so idnticas. Portanto,
nesse caso, esperamos E value mais alto (1e-10, por exemplo).
9. Na seo Alignments, possvel ver os alinhamentos propriamente ditos.
Dica: para acessar as sequncias encontradas (para copi-las e arquiv-las em formato
FASTA, por exemplo), basta clicar no nmero de acesso das mesmas nesta seo. Uma nova janela/
aba ser aberta, mostrando a sequncia e todas as informaes associadas a ela.
Busca por similaridade em banco de dados de protenas utilizando sequncia proteica como
query BLASTp (protena X protenas):
O BLASTp utilizando quando se quer encontrar sequncias de protenas em um banco de
dados que apresentem similaridade com uma sequncia de interesse tambm de protena.
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, clique na opo protein blast, na seo Basic BLAST.
3. Na caixa Enter query sequence, cole a sequncia da protena que deseja alinhar com o
banco de dados.
4. No menu Database, selecione o conjunto de dados contra o qual a sequncia de interesse
ser alinhada. Caso queira buscar em todo o banco de dados do GenBank, selecione Non-redundant
protein sequences.
5. Na caixa Organism, possvel restringir as buscas para apenas aquelas que so derivadas
de um organismos especfico. Tambm possvel excluir apenas essa espcie, clicando no boto
Exclude, assim como adicionar mais organismos para restringir ou excluir os mesmos das buscas
(boto +).
6. Clique em BLAST. O resultado pode demorar alguns minutos.
7. Analisar os resultados. Na seo Graphic Summary, possvel ver uma representao
grfica dos resultados. O tamanho das barras coloridas indica a extenso do alinhamento da
sequncia de interesse (query) com diferentes sequncias do banco de dados. J as cores indicam o
quo similares elas so. Arrastando o mouse por cima das barras, a caixa acima da representao
grfica mostrar o nome da sequncia com a qual a sequncia query apresenta similaridade.
8. Na seo Descriptions, so mostradas as sequncias que apresentam similaridade, e os
dados que quantificam essa similaridade. Dentre eles, importante observar os seguintes: Query
coverage (indica qual porcentagem da sequncia de interesse coberta pelo alinhamento com
cada sequncia do banco lembre-se que, por se tratar de um alinhamento local, muitas vezes
apenas uma regio de ambas as sequncias sero alinhadas); E value (indica a probabilidade
de encontrar aquele alinhamento de maneira aleatria ou seja, quanto menor o valor, maior
a confiana, sendo o E value = 0 o mais confivel); e Identity (indica quantos amino cidos
idnticos so encontrados apenas na regio que foi alinhada).

Biotecnologia

SUMRIO

249

Dica: dependendo do tipo de alinhamento feito, um E value aceitvel pode variar. Por
exemplo, se estamos alinhando sequncias de um organismo que apresenta grande nmero
de sequncias depositadas no banco, como humanos, camundongo, mosca-da-fruta ou arroz,
esperamos encontrar E value baixos, prximo a zero. J no caso de buscarmos sequncias obtidas
a partir de um organismo que no possui muitas sequncias no banco, em geral iremos encontrar
sequncias de outros organismos que apresentam similaridade, mas no so idnticas. Portanto,
nesse caso, esperamos E value mais alto (1e-10, por exemplo).
9. Na seo Alignments, possvel ver os alinhamentos propriamente ditos.
Dica: para acessar as sequncias encontradas (para copi-las e arquiv-las em formato
FASTA, por exemplo), basta clicar no nmero de acesso das mesmas nesta seo. Uma nova janela/
aba ser aberta, mostrando a sequncia e todas as informaes associadas a ela.
Busca por similaridade em banco de dados de protenas utilizando sequncia de nucleotdeos
como query BLASTx (nucleotdeos traduzidos X protenas):
O BLASTx utilizando quando se quer encontrar sequncias de protenas em um banco de
dados que apresentem similaridade com uma sequncia de interesse de nucleotdeos. Para isso, o
BLAST traduz a sequncia de interesse nas seis fases de leitura possveis (trs da fita senso, e trs
da fita antissenso), gerando seis sequncias de protenas que so ento comparadas com o banco de
dados de protena.
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, clique na opo blastx, na seo Basic BLAST.
3. Na caixa Enter query sequence, cole a sequncia de nucleotdeos que deseja alinhar com o
banco de dados.
4. No menu Database, selecione o conjunto de dados contra o qual a sequncia de interesse
ser alinhada. Caso queira buscar em todo o banco de dados do GenBank, selecione Non-redundant
protein sequences.
5. Na caixa Organism, possvel restringir as buscas para apenas aquelas que so derivadas
de um organismos especfico. Tambm possvel excluir apenas essa espcie, clicando no boto
Exclude, assim como adicionar mais organismos para restringir ou excluir os mesmos das buscas
(boto +).
6. Clique em BLAST. O resultado pode demorar alguns minutos.
7. Analisar os resultados. Na seo Graphic Summary, possvel ver uma representao
grfica dos resultados. O tamanho das barras coloridas indica a extenso do alinhamento da
sequncia de interesse (query) com diferentes sequncias do banco de dados. J as cores indicam o
quo similares elas so. Arrastando o mouse por cima das barras, a caixa acima da representao
grfica mostrar o nome da sequncia com a qual a sequncia query apresenta similaridade.
8. Na seo Descriptions, so mostradas as sequncias que apresentam similaridade, e os
dados que quantificam essa similaridade. Dentre eles, importante observar os seguintes: Query
coverage (indica qual porcentagem da sequncia de interesse coberta pelo alinhamento com
cada sequncia do banco lembre-se que, por se tratar de um alinhamento local, muitas vezes
apenas uma regio de ambas as sequncias sero alinhadas); E value (indica a probabilidade
de encontrar aquele alinhamento de maneira aleatria ou seja, quanto menor o valor, maior
a confiana, sendo o E value = 0 o mais confivel); e Identity (indica quantos amino cidos
idnticos so encontrados apenas na regio que foi alinhada).

Biotecnologia

SUMRIO

250

Dica: dependendo do tipo de alinhamento feito, um E value aceitvel pode variar. Por
exemplo, se estamos alinhando sequncias de um organismo que apresenta grande nmero
de sequncias depositadas no banco, como humanos, camundongo, mosca-da-fruta ou arroz,
esperamos encontrar E value baixos, prximo a zero. J no caso de buscarmos sequncias, obtidas
a partir de um organismo que no possui muitas sequncias no banco, em geral iremos encontrar
sequncias de outros organismos que apresentam similaridade, mas no so idnticas. Portanto,
nesse caso, esperamos E value mais alto (1e-10, por exemplo).
9. Na seo Alignments, possvel ver os alinhamentos propriamente ditos.
Dica: para acessar as sequncias encontradas (para copi-las e arquiv-las em formato
FASTA, por exemplo), basta clicar no nmero de acesso das mesmas nesta seo. Uma nova janela/
aba ser aberta, mostrando a sequncia e todas as informaes associadas a ela.
Dica 2: observar no cabealho de cada alinhamento qual a fase de leitura da sequncia de
interesse, a qual foi alinhada com a sequncia de protena do banco, em Frame. Valores +1, +2 e
+3 indicam fases de leitura da fita senso; -1, -2 e -3 indicam fases de leitura da fita antissenso.
Busca por similaridade em banco de dados de nucleotdeos traduzidos para protena utilizando
sequncia de protena como query tBLASTn (protena X nucleotdeos traduzidos):
O tBLASTn utilizando quando se quer encontrar sequncias de nucleotdeo em um banco
de dados que apresentem similaridade com uma sequncia de interesse de protena. Para isso, o
BLAST traduz todas as sequncias de nucleotdeos do banco nas seis fases de leitura possveis (trs
da fita senso, e trs da fita antissenso), gerando seis sequncias de protenas para cada uma, que so
ento comparadas com a sequncia de interesse de protena.
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, clique na opo tblastn, na seo Basic BLAST.
3. Na caixa Enter query sequence, cole a sequncia de protena que deseja alinhar com o
banco de dados.
4. No menu Database, selecione o conjunto de dados contra o qual a sequncia de interesse
ser alinhada. Caso queira buscar em todo o banco de dados do GenBank, selecione Nucleotide
collection.
5. Na caixa Organism, possvel restringir as buscas para apenas aquelas que so derivadas
de um organismos especfico. Tambm possvel excluir apenas essa espcie, clicando no boto
Exclude, assim como adicionar mais organismos para restringir ou excluir os mesmos das buscas
(boto +).
6. Clique em BLAST. O resultado pode demorar alguns minutos.
7. Analisar os resultados. Na seo Graphic Summary, possvel ver uma representao
grfica dos resultados. O tamanho das barras coloridas indica a extenso do alinhamento da
sequncia de interesse (query) com diferentes sequncias do banco de dados. J as cores indicam o
quo similares elas so. Arrastando o mouse por cima das barras, a caixa acima da representao
grfica mostrar o nome da sequncia com a qual a sequncia query apresenta similaridade.
8. Na seo Descriptions, so mostradas as sequncias que apresentam similaridade, e os
dados que quantificam essa similaridade. Dentre eles, importante observar os seguintes: Query
coverage (indica qual porcentagem da sequncia de interesse coberta pelo alinhamento com
cada sequncia do banco lembre-se que, por se tratar de um alinhamento local, muitas vezes
apenas uma regio de ambas as sequncias sero alinhadas); E value (indica a probabilidade
de encontrar aquele alinhamento de maneira aleatria ou seja, quanto menor o valor, maior

Biotecnologia

SUMRIO

251

a confiana, sendo o E value = 0 o mais confivel); e Identity (indica quantos amino cidos
idnticos so encontrados apenas na regio que foi alinhada).
Dica: dependendo do tipo de alinhamento feito, um E value aceitvel pode variar. Por
exemplo, se estamos alinhando sequncias de um organismo que apresenta grande nmero
de sequncias depositadas no banco, como humanos, camundongo, mosca-da-fruta ou arroz,
esperamos encontrar E value baixos, prximo a zero. J no caso de buscarmos sequncias obtidas
a partir de um organismo que no possui muitas sequncias no banco, em geral iremos encontrar
sequncias de outros organismos que apresentam similaridade, mas no so idnticas. Portanto,
nesse caso, esperamos E value mais alto (1e-10, por exemplo).
9. Na seo Alignments, possvel ver os alinhamentos propriamente ditos.
Dica: para acessar as sequncias encontradas (para copi-las e arquiv-las em formato
FASTA, por exemplo), basta clicar no nmero de acesso das mesmas nesta seo. Uma nova janela/
aba ser aberta, mostrando a sequncia e todas as informaes associadas a ela.
Dica 2: observar no cabealho de cada alinhamento qual a fase de leitura da sequncia do
banco, a qual foi alinhada com a sequncia de interesse, em Frame. Valores +1, +2 e +3 indicam
fases de leitura da fita senso; -1, -2 e -3 indicam fases de leitura da fita anti-senso.
Busca por similaridade em banco de dados de nucleotdeos traduzidos para protena utilizando
sequncia de nucleotdeos traduzidos para protena como query tBLASTx (nucleotdeos
traduzidos X nucleotdeos traduzidos):
O tBLASTx utilizando quando se quer comparar sequncias de nucleotdeos com o banco
de nucleotdeos, porm, tanto o banco de dados quanto a sequncia de interesse so traduzidos
em todas as seis fases de leitura possveis. Trata-se do modo mais abrangente de procurar por
sequncias similares, porm, o que mais consome tempo de computao. Para isso, o BLAST traduz
todas as sequncias de nucleotdeos do banco nas seis fases de leitura possveis (trs da fita senso, e
trs da fita antissenso), gerando seis sequncias de protenas para cada, que so ento comparadas
com as seis sequncias geradas da mesma forma para a sequncia de interesse de protena.
1. Acessar o site http://www.ncbi.nlm.nih.gov/. No canto direito da pgina, encontrar e
clicar na opo BLAST.
2. Na pgina seguinte, clique na opo tblastx, na seo Basic BLAST.
3. Na caixa Enter query sequence, cole a sequncia de protena que deseja alinhar com o
banco de dados.
4. No menu Database, selecione o conjunto de dados contra o qual a sequncia de interesse
ser alinhada. Caso queira buscar em todo o banco de dados do GenBank, selecione Nucleotide
collection.
5. Na caixa Organism, possvel restringir as buscas para apenas aquelas que so derivadas
de um organismos especfico. Tambm possvel excluir apenas essa espcie, clicando no boto
Exclude, assim como adicionar mais organismos para restringir ou excluir os mesmos das buscas
(boto +).
6. Clique em BLAST. O resultado pode demorar alguns minutos.
7. Analisar os resultados. Na seo Graphic Summary, possvel ver uma representao
grfica dos resultados. O tamanho das barras coloridas indica a extenso do alinhamento da
sequncia de interesse (query) com diferentes sequncias do banco de dados. J as cores indicam o
quo similares elas so. Arrastando o mouse por cima das barras, a caixa acima da representao
grfica mostrar o nome da sequncia com a qual a sequncia query apresenta similaridade.
8. Na seo Descriptions, so mostradas as sequncias que apresentam similaridade, e os
dados que quantificam essa similaridade. Dentre eles, importante observar os seguintes: Query

Biotecnologia

SUMRIO

252

coverage (indica qual porcentagem da sequncia de interesse coberta pelo alinhamento com
cada sequncia do banco lembre-se que, por se tratar de um alinhamento local, muitas vezes
apenas uma regio de ambas as sequncias sero alinhadas); E value (indica a probabilidade
de encontrar aquele alinhamento de maneira aleatria ou seja, quanto menor o valor, maior
a confiana, sendo o E value = 0 o mais confivel); e Identity (indica quantos amino cidos
idnticos so encontrados apenas na regio que foi alinhada).
Dica: dependendo do tipo de alinhamento feito, um E value aceitvel pode variar. Por
exemplo, se estamos alinhando sequncias de um organismo que apresenta grande nmero
de sequncias depositadas no banco, como humanos, camundongo, mosca-da-fruta ou arroz,
esperamos encontrar E value baixos, prximo a zero. J no caso de buscarmos sequncias obtidas
a partir de um organismo que no possui muitas sequncias no banco, em geral iremos encontrar
sequncias de outros organismos que apresentam similaridade, mas no so idnticas. Portanto,
nesse caso, esperamos E value mais alto (1e-10, por exemplo).
9. Na seo Alignments, possvel ver os alinhamentos propriamente ditos.
Dica: para acessar as sequncias encontradas (para copi-las e arquiv-las em formato
FASTA, por exemplo), basta clicar no nmero de acesso das mesmas nesta seo. Uma nova janela/
aba ser aberta, mostrando a sequncia e todas as informaes associadas a ela.
Dica 2: observar no cabealho de cada alinhamento qual a fase de leitura da sequncia do
banco a qual foi alinhada com a sequncia de interesse, em Frame. Valores +1, +2 e +3 indicam
fases de leitura da fita senso; -1, -2 e -3 indicam fases de leitura da fita anti-senso. Um segundo valor
indica tambm a fase de leitura da sequncia de interesse que foi usada no alinhamento.

Biotecnologia

SUMRIO

253

11.6 ALINHAMENTO DE SEQUNCIAS DE NUCLEOTDEOS E


PROTENAS (ALINHAMENTO GLOBAL)
Sequncias de nucleotdeos e amino cidos apresentam similaridade com outras sequncias,
principalmente quando estas so relacionadas evolutivamente. Por exemplo, sequncias de
genes que so parte de uma mesma famlia gnica apresentam regies parecidas, em diferentes
graus. Diferente do alinhamento local, que permite encontrar regies de similaridade entre duas
sequncias, o alinhamento global visa a obter o melhor alinhamento possvel para duas ou mais
sequncias, considerando a extenso total das mesmas. Assim, o alinhamento global permite
observar o quo parecidas duas sequncias completas so. importante salientar que esse tipo de
mtodo resultar em um alinhamento mesmo que as sequncias escolhidas sejam pouco similares.
Portanto, interessante ter conhecimento das mesmas a priori, sabendo que se tratam de sequncias
de genes ou protenas similares, aumentando assim as chances de se obter resultados informativos.
Existem diversos softwares para alinhamentos globais; um dos mais utilizados o ClustalW.
Alinhamentos globais utilizando a ferramenta ClustalW:
1. Acessar o site http://www.ebi.ac.uk/Tools/msa/clustalw2/.
2. Na caixa localizada na seo STEP 1 - Enter your input sequences, cole as sequncias a
serem alinhadas.
Dica: utilize sequncias no formato FASTA, que sero automaticamente reconhecidas.
3. Selecionar a opo PROTEINS para alinhamento de protenas, e DNA para alinhamento
de nucleotdeos.
4. Na seo STEP 2 - Set your Pairwise Alignment Options, selecione entre as opes slow e
fast. Estas opes se referem ao tempo que o alinhamento levar para ser realizado.
Dica: apesar de ser mais rpida, a opo fast pode ser menos eficiente em alinhar sequncias
menos similares, ou contendo regies bastante diferentes. J a opo slow, embora mais lenta,
pode mostrar resultados mais prximos do timo. Na maioria dos casos, no entanto, a diferena
quase negligencivel.
5. Clique em Submit.
6. Analise os resultados. As sequncias estaro alinhadas logo abaixo, e os identificadores de
cada uma sero mostrados no canto direito do alinhamento.
Dica: possvel ver o alinhamento em cores diferentes, facilitando a visualizao de regies
conservadas. Clicar em Show Colors.
Alinhamentos globais utilizando a ferramenta DiAlign:
1. Acessar o site http://www.genomatix.de/cgi-bin/dialign/dialign.pl.
2. Na primeira caixa na seo Sequence Input, cole as sequncias a serem alinhadas.
Dica: utilize sequncias no formato FASTA, que sero automaticamente reconhecidas.
3. Na seo Sequence type selecione o tipo de alinhamento entre DNA sequence e Protein
sequence.
4. Clique em Load sequences for DiAlign.
5. A prxima pgina permite ao usurio decidir alguns parmetros do alinhamento e tambm
do resultado (output). Aps decidir quais parmetros sero utilizados (ou mant-los), clique em
Start Alignment.

Biotecnologia

SUMRIO

254

Dica: um dos parmetros do resultado que interessante ser alterado a caixa Do not show
non-aligned blocks. Ao clic-la, o alinhamento mostrar tambm as regies que no foram alinhadas
entre as sequncias utilizadas.
Dica 2: para decidir qual a melhor maneira de visualizar um resultado em particular,
importante testar e conhecer as opes de output. Teste diferentes combinaes.
6. Analisar o resultado. Verificar a seo Aligned sequences, que mostra quais sequncias
foram alinhadas, cada uma identificada de maneira independente e mostrando o tamanho da
mesmas (em pares de bases ou nmero de amino cidos). As identificaes so derivadas do
identificador do formato FASTA.
7. Observar o alinhamento propriamente dito, na seo Alignment. Na seo seguinte,
Pairwise similarities, as sequncias so comparadas uma a uma, mostrando valores de similaridade
e identidade.
Dica: similaridade e identidade so dois termos utilizados para expressar o quanto duas
sequncias so parecidas. Em se tratando de sequncias de DNA, os termos so usados de maneira
equivalente. J para alinhamentos entre sequncias de amino cidos, o termo identidade se refere
ao nmero de resduos iguais entre as duas sequncias; j o termo similaridade se refere tambm
aos resduos idnticos, mas inclui ainda as posies do alinhamento as quais, embora contenham
amino cidos diferentes, estes apresentam a mesma caracterstica de polaridade da cadeia lateral.
Portanto, a similaridade entre duas sequncias sempre maior ou igual identidade.

Biotecnologia

SUMRIO

255

11.7 LOCALIZAO DE DOMNIOS CONSERVADOS EM SEQUNCIAS


DE PROTENAS
Embora protenas diferentes tenham sequncias distintas, estas sequncias podem conter
padres, grupos de amino cidos que so conservados ao longo da evoluo, e que em geral
cumprem funes similares. Estes conjuntos de amino cidos so chamados de domnios proteicos,
e podem ser facilmente detectados por ferramentas computacionais. Existem diversas bases de
dados sobre domnios conservados de protenas. Esse tipo de anlise permite inferir, ainda que de
maneira indireta, a funo de uma determinada sequncia de protena, baseado apenas na presena
de domnios conservados.
Anlise de domnios conservados utilizando InterProScan:
O InterProScan integra diferentes bases de dados de domnios conservados, fazendo a busca
simultnea em todos eles.
1. Acessar o site http://www.ebi.ac.uk/Tools/pfa/iprscan/.
Dica: para encontrar diretamente o site do InterProScan, digite interproscan no Google.
2. Na caixa localizada na seo STEP 1 - Enter your input sequences, colar a sequncia a ser
alinhada.
3. Clicar em Submit.
4. Analisar o resultado. A representao grfica mostra a sequncia de interesse (query) como
uma linha pontilhada na parte superior, e os diferentes domnios encontrados dispostos abaixo. As
caixas coloridas representam os domnios, e a sua localizao mostrada ao longo da sequncia
de interesse. Observe que os domnios podem apresentar um cdigo, localizado esquerda do
domnio. Clicando neste cdigo, possvel acessar informaes especficas sobre o domnio.
Dica: alguns domnios podem conter entradas em mais de uma base de dados, e por isso
podem aparecer mais de uma vez. Observar sempre a ocorrncia de domnios na mesma regio da
sequncia de interesse.

Biotecnologia

SUMRIO

256

11.8 PREDIO DE DOMNIOS TRANSMEMBRANA A PARTIR DE


SEQUNCIAS DE PROTENAS
Estas ferramentas tm por finalidade predizer a presena de domnios transmembrana ao
longo de uma cadeia polipeptdica, a partir de sua sequncia.
Predio de domnios transmembrana utilizando Phobius:
1. Acessar o site http://phobius.sbc.su.se/.
Dica: para encontrar diretamente, digite phobius no Google.
2. Na caixa, colar a sequncia a ser analisada.
3. Clicar em Submit query.
4. Analisar o resultado. O Phobius mostra inicialmente quais domnios transmembrana
foram preditos para a sequncia de interesse, e qual a extenso dos mesmos (indicando resduos
de incio e trmino para cada um). Observar a presena de peptdeo-sinal (identificado por
SIGNAL), alas (identificadas por TOPO_DOM) e domnios transmembrana (identificados por
TRANSMEM). Os amino cidos de incio e trmino so indicados. Na parte inferior, mostrada
a representao grfica do resultado. No eixo X, mostrado o nmero do resduo; e no eixo Y, qual
a probabilidade de cada resduo fazer parte do domnio em questo. Observar a linha vermelha
(indica a probabilidade de presena de um peptdeo-sinal), e as linhas verde e azul (indicam amino
cidos ao longo da sequncia com maior probabilidade de estarem voltados para o citoplasma ou
para o meio extracelular, respectivamente). As regies com domnios transmembrana preditos so
mostradas em cinza.
Predio de domnios transmembrana utilizando TMHMM:
1. Acessar o site http://www.cbs.dtu.dk/services/TMHMM/.
Dica: para encontrar diretamente, digite tmhmm no Google.
2. Na caixa Submission, colar a sequncia a ser analisada.
3. Clicar em Submit.
4. Analisar o resultado. O TMHMM mostra quais domnios transmembrana foram preditos
para a sequncia de interesse, e qual a extenso dos mesmos (indicando resduos de incio e trmino
para cada um). Observar a presena de alas (identificadas por inside ou outside, indicando a
orientao da ala em relao membrana plasmtica) e domnios transmembrana (identificados
por TMhelix). Os amino cidos de incio e trmino so indicados. Na parte inferior, mostrada
a representao grfica do resultado. No eixo X, mostrado o nmero do resduo; e no eixo Y, a
probabilidade de cada resduo fazer parte do domnio em questo. Observar a linha vermelha (ndica
a probabilidade de presena de domnio transmembrana), e as linhas azul e rosa (indicam amino
cidos ao longo da sequncia com maior probabilidade de estarem voltados para o citoplasma ou
para o meio extracelular, respectivamente). As regies com domnios transmembrana preditos so
mostradas em vermelho. H tambm uma representao utilizando caixas para indicar a localizao
dos domnios transmemebrana, ao longo da sequncia, na parte superior do grfico.

Biotecnologia

SUMRIO

257

11.9 PREDIO DE LOCALIZAO SUBCELULAR, PRESENA


DE PEPTDEO DE DIRECIONAMENTO N-TERMINAL E DE SINAL
DE LOCALIZAO NUCLEAR, A PARTIR DE SEQUNCIAS DE
PROTENAS
Estas ferramentas permitem predizer, utilizando caractersticas da prpria sequncia de
protena, qual a provvel localizao subcelular do polipetdeo maduro (mitocndria, cloroplasto,
membrana plasmtica, etc). Alguns deles, ou ferramentas especficas para este fim, permitem
tambm predizer a presena de sequncias N-terminais e de sinal de localizao nuclear, envolvidos
no direcionamento de protenas para diferentes organelas ou compartimentos subcelulares e para
o ncleo, respectivamente. Estes programas no so 100% acurados, e portanto, interessante
analisar as sequncias em mais de um deles, focando em resultados concordantes.
Predio de localizao subcelular utilizando PSORT:
A primeira verso do PSORT permite a anlise de sequncias oriundas de plantas, animais,
levedura, bactrias gram-negativas e bactrias gram-positivas.
1. Acessar o site http://psort.hgc.jp/form.html.
Dica: para encontrar diretamente, digite psort no Google. Ao entrar na pgina, busque e
clique em PSORT Prediction.
2. Escolher a origem da sequncia entre Gram-positive bacterium, Gram-negative bacterium,
yeast, animal e plant.
3. Colar a sequncia na caixa Enter your Amino Acid sequence below (by copy & paste).
4. Clique em Submit
5. Analisar os resultados. O PSORT utiliza vrias informaes para chegar ao resultado
mostrado no final da pgina. So indicados valores para cada possvel localizao subcelular.
Aquelas com valores mais altos so as mais provveis. Notar que no se trata de valores de
probabilidade.
Predio de localizao subcelular utilizando PSORTII:
Esta verso do PSORT permite a anlise de sequncias oriundas de animais e levedura.
1. Acessar o site http://psort.hgc.jp/form2.html.
Dica: para encontrar diretamente, digite psort no Google. Ao entrar na pgina, busque e
clique em PSORTII Prediction.
2. Colar a sequncia na caixa Enter your AMINO ACID SEQUENCE.
3. Clique em Submit.
4. Analisar os resultados. O PSORTII utiliza vrias informaes para chegar ao resultado
mostrado no final da pgina. So indicados valores para cada possvel localizao subcelular,
mostrados em porcentagem.

Biotecnologia

SUMRIO

258

Predio de localizao subcelular utilizando WolfPSORT:


O WolfPSORT a verso mais atual do PSORT, e permite a anlise de sequncias oriundas
de animais, plantas e fungos.
1. Acessar o site http://wolfpsort.org/.
Dica: para encontrar diretamente, digite psort no Google. Ao entrar na pgina, busque e
clique em WolfPSORT Prediction.
2. Escolher a origem da sequncia entre animal, plant e fungi.
3. Colar a sequncia na caixa Enter multifasta format protein sequence(s) here.
Dica: o WolfPSORT permite a anlise de mais de uma sequncias simultaneamente, caso
queira analisar mltiplas sequncias (col-las na caixa em formato FASTA).
4. Clique em Submit Query.
5. Analisar os resultados. O WolfPSORT utiliza vrias informaes para chegar ao resultado
final. So indicados valores para cada possvel localizao subcelular. Os maiores valores so os
mais provveis. Notar que os valores no so valores de probabilidade.
Predio de sequncias N-terminais de direcionamento utilizando iPSORT:
O iPSORT permite a predio de sequncias de direcionamento localizadas na regio
N-terminal das protenas analisadas. Dentre eles, destacam-se os peptdeos-sinal, envolvidos
no direcionamento de protenas para a via de secreo; peptdeos de direcionamento para a
mitocndria e peptdeos de direcionamento para o cloroplasto.
1. Acessar o site http://wolfpsort.org/.
Dica: para encontrar diretamente, digite psort no Google. Ao entrar na pgina, busque e
clique em iPSORT Prediction.
2. Colar a sequncia na caixa abaixo de iPSORT Prediction.
3. Selecionar a origem da sequncia entre Plant Protein e Non-plant Protein
4. Clique em Submit.
5. Analisar os resultados. O iPSORT compara a sequncia N-terminal da sequncia submetida
com as de protenas sabidamente contendo sinais N-terminais de direcionamento. Trs perguntas
sero respondidas nos resultados: se a sequncia possui em peptdeo-sinal (SP), se possui um
peptdeo de direcionamento mitocondrial e se possui um peptdeo de direcionamento de cloroplasto.
Respostas Yes ou No indicaro a presena e o tipo de sequncia de direcionamento na protena
analisada.

Biotecnologia

SUMRIO

259

Predio de direcionamento subcelular utilizando TargetP:


A ferramenta TargetP permite a predio de direcionamento de protenas para a via de
secreo, para mitocndrias e para cloroplastos.
1. Acessar o site http://www.cbs.dtu.dk/services/TargetP/.
Dica: para encontrar diretamente, digite targetp no Google.
2. Colar a sequncia na caixa SUBMISSION.
3. Selecionar a origem da sequncia entre Non-plant e Plant
4. Selecionar ou no a opo Perform cleavage site predictions. Esta opo permite a predio
do local de clivagem, no caso de a protena analisada apresentar peptdeo de direcionamento
N-terminal.
Dica: analisar a sequncia, tanto utilizando quanto no utilizando esta opo, e comparar os
resultados.
5. Selecionar os cutoffs. Na opo no cutoffs, a opo que apresentar maior valor ser a
selecionada (winner takes it all). Nas opes specificity >0.95 e specificity >0.90, possvel definir
a estringncia da anlise, sendo a primeira mais estringente para definir como aceitvel a predio.
A quarta opo permite ao usurio definir os prprios valores para a estringncia (cutoffs).
Dica: analisar a sequncia utilizando diferentes opes, e comparar os resultados.
6. Clicar em Submit
7. Analisar os resultados. Os mesmos sero apresentados em uma tabela contendo o nome
da sequncia, o tamanho da mesma e os valores para cada predio (mTP = mitochondrial transit
peptide, peptdeo de trnsito mitocondrial), (cTP = chloroplast transit peptide, peptdeo de trnsito de
cloroplasto), peptdeo-sinal (SP, signal-peptide) e outras (other). indicada, de acordo com os valores
de estringncia definidos na pgina anterior, qual a predio final do programa, na coluna Loc.
Tambm mostrado o valor de confiabilidade da predio (RC = reliability class), que vai de 1 a 5,
sendo 1 a mais confivel e 5 a menos.
Predio de sinal de localizao nuclear utilizando SeqNLS:
A ferramenta SeqNLS permite a predio de sequncia de localizao nuclear, indicando que
a protena deve se localizar no ncleo.
1. Acessar o site http://mleg.cse.sc.edu/seqNLS.
Dica: para encontrar diretamente, digite seqnls no Google.
2. Colar a sequncia na caixa para submisso.
3. Selecionar a estringncia. Considere que o padro j est marcado (0.86).
4. Clique em Predict.
5. Analisar os resultados. Em Prediction result, o identificador e a prpria sequncia so
mostrados. Regies contendo provveis sinais de localizao nuclear so mostrados em cores, e o
valor de confiabilidade da predio segue a escala mostrada na tabela Definition of different colors in
predictions. Na sequncia, o provvel NLS sublinhado. Uma segunda tabela The predicted NLS
mostra o nome da sequncia submetida, os resduos de amino cidos que fazem parte do NLS e sua
posio relativa na sequncia, e o valor de confiabilidade da predio.

Biotecnologia

SUMRIO

260

11.10 IDENTIFICAO E ANLISE DA REGIO PROMOTORA DE


GENES ORIUNDOS DE GENOMAS DE PLANTAS
A identificao da regio promotora de um gene requer a anlise prvia da sequncia do
gene em questo. Para definir qual a regio promotora, em geral difcil de ser determinada com
preciso (ou seja, saber exatamente qual o nucleotdeo de incio e qual o nucleotdeo de trmino),
importante conhecer ao menos o incio da regio codificante, marcada pelo primeiro ATG. Tambm
relevante identificar o stio de incio de transcrio propriamente dito, localizado no incio da
regio 5 no-traduzida. A partir desses nucleotdeos, possvel isolar a sequncia do promotor,
normalmente compreendida entre os nucleotdeos +1 (considerando o primeiro a ser transcrito) e
-2000 (pode haver variao, sendo utilizado desde -1000 at -2500). A anlise do promotor depende
do conhecimento da sequncia e, portanto, facilitada para plantas cujo genoma j foi sequenciado.
De posse da sequncia do promotor, a anlise feita em bases de dados que reconhecem stios de
ligao de fatores de transcrio. Estes stios podem ser bastante especficos ou apresentar regies
variveis.
Anlise da regio promotora de genes de plantas utilizando Plant Cis-acting Regulatory DNA
Elements (PLACE):
1. Acessar o site https://sogo.dna.affrc.go.jp/cgi-bin/sogo.cgi?sid=&lang=en&pj=640&acti
on=page&page=newplace.
Dica: o PLACE foi recentemente refeito e este o novo site. Digitando place promoter
analysis no Google, o site acessado ser o da verso anterior. Deste, possvel encontrar a verso
mais nova clicando em NewPLACE, logo abaixo do ttulo Important Note.
2. Copiar e colar a sequncia do promotor a ser analisado na caixa.
3. Clicar em Submit Query
4. Analisar os resultados. O PLACE mostrar a sequncia completa que foi analisada. Logo
abaixo, a sequncia ser novamente mostrada em conjuntos de 50 nucleotdeos. Abaixo de cada
trecho do promotor, sero indicadas as posies relativas de diferentes stios regulatrios. So
mostradas a fita na qual a sequncia ocorre (+ = fita senso, - = fita antissenso), o nome do
stio regulatrio, a posio (nucleotdeo de incio do stio, considerando a sequncia analisada),
e a sequncia-consenso do mesmo, de acordo com o banco. O mesmo resultado mostrado mais
abaixo em formato de tabela, listando os nomes dos motivos encontrados, posies relativas, fita
em que ocorrem e sequncia-consenso.
Dica: o PLACE apresenta apenas stios regulatrios descritos na literatura. Para acessar
as informaes originalmente depositadas no banco, basta clicar nos cdigos de cada um, que
aparecem no formato S000001. Os stios so mostrados tanto abaixo do promotor quanto na
tabela. Ao clicar, o usurio direcionado a uma pgina especfica, onde h uma breve explicao da
funo do stio regulatrio e referncias que suportam a funo do mesmo.
Anlise da regio promotora de genes de plantas utilizando PlantCARE (Cis-Acting Regulatory
Element):
1. Acessar o site http://bioinformatics.psb.ugent.be/webtools/plantcare/html/.
Dica: para encontrar diretamente, digite plantcare no Google.
2. No canto esquerdo superior, clique no cone Search for CARE.
3. Copiar e colar a sequncia do promotor a ser analisado na caixa apropriada.
4. Clicar em Submit Query

Biotecnologia

SUMRIO

261

5. Analisar os resultados. O PlantCARE mostrar a sequncia completa que foi analisada,


mostrando ambas as fitas (senso e antissenso). Abaixo, todos os stios regulatrios estaro listados.
Para mostrar quais posies apresentam determinado stios, clicar no + no lado esquerdo de cada
um. A posio dos stios na sequncia do promotor ser destaca em cores. Caso haja mais de um
stio no mesmo promotor, todas as sequncias regulatrias sero destacadas.
Anlise da regio promotora de genes de plantas utilizando PlantPAN (Promoter Analysis
Navigator):
1. Acessar o site http://plantpan.mbc.nctu.edu.tw/.
Dica: para encontrar diretamente, digite plantpan no Google.
2. Na parte superior, clique no cone Promoter Analysis.
3. Copiar e colar a sequncia do promotor a ser analisado na caixa Please Input The Promoter
Sequence in FASTA Format.
4. Na seo Please Select What You Want To Analyze, possvel selecionar alguns parmetros
da anlise. Clicando na opo Transcription Factor Binding Sites, sero buscados stios regulatrios
na sequncia do promotor. necessrio tambm escolher qual a espcie de planta que est sendo
analisada, clicando na mesma logo abaixo. Clicando na opo Tandem Repeat, repeties in
tandem sero identificadas, caso estejam presentes. Estas repeties, embora muitas vezes ainda
no descritas, podem conter stios regulatrios. Clicando na opo CpNpG, stios contendo uma
citosina, seguido de qualquer nucleotdeo, seguido de guanina, sero identificados. Estes stios so
comumente metilados em promotores, podendo levar diminuio da taxa de transcrio a partir
do promotor. Clicando em miRNA target Site, sero identificados stios de complementariedade
com microRNAs conhecidos. Estes pequenos RNAs tm papel importante na regulao gnica.
5. Analisar os resultados. Para cada opo de anlise selecionada na pgina anterior,
mostrada uma figura contendo uma representao da sequncia submetida, na parte superior, e a
posio relativa de cada stio encontrado, logo abaixo. Para cada stio/repetio/CpNpGp/stio de
ligao de miRNA, uma linha contnua mostrada, e uma caixa colorida mostrada para cada stio
encontrado. Coloraes diferentes so dadas para stios encontrados na fita senso ou antissenso.
Caso haja um nmero grande de stios, haver uma barra de rolagem no canto direito. Clicando no
nome dos elementos regulatrios, possvel acessar detalhes do mesmo. Na parte superior de cada
seo, h um link para uma tabela listando todos os elementos (View in Table), na qual indicada a
posio, fita, sequncia, espcie onde o mesmo foi descrito e a fonte (bancos de dados de anlise de
promotor).

Biotecnologia

SUMRIO

262

11.11 PREDIO DE SECREO E LOCALIZAO DE PROTENAS


Estas ferramentas tm por finalidade predizer, baseado em similaridade de sequncias
conservadas, se uma protena secretada e o tipo de rota utilizada para secreo da mesma, bem
como indicar uma possvel localizao direcionada para a secreo.
Predio de protenas com ancoramento GPI (glicosilfosfatidilinositol):
GPI um glicolipdeo que pode ser adicionado protena, considerado uma modificao
ps-traducional. Protenas com ancoramento GPI contem peptdeo sinal. O ancoramento GPI faz
com que a protena fique ligada face externa da membrana celular, podendo ser clivada por
fosfolipases e, portanto, secretada para o meio extracelular. A presena de GPI um dos possveis
indcios de secreo. Outras ferramentas podem ser aplicadas para a predio de outros sinais
clssicos de secreo.
1. Acessar o site http://gpcr.biocomp.unibo.it/predgpi/index.htm
2. Clicar em Prediction
3. Colar a sequncia a ser analisada em formato fasta, ou submeter o arquivo com todas as
sequncias a serem analisadas, clicando no link Escolher arquivo.
4. Clicar em Display.
5. Analisar o resultado. Uma tabela ser gerada com o nmero de protenas com a probabilidade
de conter GPI: Altamente provvel, provvel, fracamente provvel e sem ancoramento GPI.
O resultado deve ser apresentado desta maneira, e o critrio de excluso (considerar
que altamente provvel e provvel ou somente altamente provvel considerado positivo potencialmente secretado) determinado pelo analista.
Predio de secreo de protenas com peptdeo sinal:
Esta ferramenta prediz a presena e localizao de stios de peptdeo sinal em protenas de
diferentes organismos.
1. Acessar o site http://www.cbs.dtu.dk/services/SignalP/
2. Na caixa Submission, colar a sequncia em formato fasta a ser analisada, ou submeter o
arquivo com todas as sequncias a serem analisadas, clicando no link Escolher arquivo.
3. Escolher o grupo taxonmico entre Eukaryotes e Gram-negative ou Gram-positive Bacteria.
Dica: pode-se selecionar o tipo de anlise a ser feita (alterando o valor de D-cutoff), e como
os resultados sero mostrados (com ou sem grfico, simples ou estendido). Isto definido pelo
analista.
Dica: cada parmetro de anlise e visualizao dos resultados autoexplicativo, bastando
clicar em Explain.
4. Clicar em Submit.
5. Analisar o resultado: Observar na tabela o signal peptide: se YES contm peptdeo sinal
e, portanto, pode ser secretada; se NO, sem peptdeo sinal.
Dica: ao final da anlise encontra-se Explain the output. Clicando, abre-se uma nova aba
com a explicao detalhada dos resultados obtidos.

Biotecnologia

SUMRIO

263

Predio de rota no clssica de secreo de protenas:


1. Acessar o site http://www.cbs.dtu.dk/services/SecretomeP/
2. Na caixa Submission, colar a sequncia em formato fasta a ser analisada, ou submeter o
arquivo com todas as sequncias a serem analisadas, clicando no link Escolher arquivo.
3. Selecionar o grupo taxonmico do organismo ao qual as sequncias pertencem: Bacteria
Gram positiva ou negativa ou Mamfero.
4. Clicar em Submit.
5. Analisar o resultado. Valores de SecP ou NN-score acima de 0,5 indicam possvel secreo.
Dica: algumas protenas com peptdeo sinal (rota clssica de secreo) podem ser positivas
neste programa. Para confirmar a rota, pode-se fazer a busca no programa SignalP.
Dica: o critrio de utilizar o valor de 0,5 ou superior como sendo positivo definido pelo
analista.
Exemplo:
# Name

NN-score Odds Weighted Warning

# by prior
FGF1_HUMAN

0.847 4.267 0.009 -

FGF4_HUMAN

0.945 6.804 0.014 signal peptide predicted by SignalP

ATRX_HUMAN

0.093 0.205 0.000 -

Biotecnologia

SUMRIO

264

CAPTULO 12
CRIAO E APLICAO DE CAROS PARA
CONTROLE BIOLGICO
Guilherme Liberato da Silva, Matheus dos Santos Rocha, Noeli Juarez Ferla

Biotecnologia

SUMRIO

265

12.1 CRIAO E APLICAO DE CAROS PARA CONTROLE


BIOLGICO
Este protocolo tem o objetivo de apresentar aspectos gerais acerca da criao massal e uso de
caros predadores no controle biolgico de caros praga no campo.
SALA DE SEMEADURA DE FEIJO
Etapas de produo do feijoeiro
1. O substrato ser disponibilizado em bandeja plstica de 45cm x 30cm x 8 cm;
2. Cada bandeja plstica receber 20 sementes de feijo (Phaseolus vulgaris L.) (Figura 1.A);
3. As bandejas com feijo devero ser mantidas em sala climatizada a 261 C, 705% UR e
fotofase de 12 horas;
4. Diariamente sero acrescidos 350 ml de gua ao substrato.
SALA DE CAROS FITFAGOS
Criao estoque de caros fitfagos:
1. Coleta dos caros fitfago-alvo no campo;
2. Triagem utilizando microscpio tico e montagem de lminas em meio de Hoyer para a
identificao sob microscpio estereoscpio com contraste de fases.
3. Aps a confirmao de identificao da espcie-alvo, os caros sero introduzidos nas
bandejas com feijo (Figura 1.B);
4. Manter em sala climatizada a 261 C, 8010% UR e fotofase de 12 horas;
5. Adio diria de 350 ml de gua ao substrato;
6. Obter contaminao de aproximadamente 30 espcimes/planta.
SALA DE CAROS PREDADORES
Criao estoque de caros predadores:
1. Coleta do caro predador-alvo no campo;
2. Triagem utilizando microscpio tico e montagem de lminas em meio de Hoyer para a
identificao sob microscpio estereoscpio com contraste de fases.
3. Aps a confirmao de identificao da espcie-alvo, os caros sero introduzidos nas
bandejas de feijo contaminado com aproximadamente 30 caros fitfagos/planta (Figura 1.C);
4. Manter em sala climatizada a 261 C, 8010% UR e fotofase de 12 horas;
5. Adio diria de 350 ml de gua ao substrato.
Ressalta-se que:
No deve haver contato entre as criaes estoque de caros fitfagos e predadores e, de
preferncia, devem ser mantidas em ambientes separados. Tambm devem ser manipuladas por
indivduos diferentes para evitar contaminaes.
Liberao inundativa em campo
1. Para acondicionar caros predadores, ser necessrio manter casca de arroz moda no
fundo do recipiente.

Biotecnologia

SUMRIO

266

2. Cerca de 200 indivduos sero retirados da criao estoque e acondicionados no recipiente


(8cm altura x 5cm dimetro) (Figura 1.D).
3. Os recipientes com caros predadores sero transportados em caixas de isopor com Gelox
para diminuir a atividade metablica.
4. Na cultura-alvo a liberao inundativa dos caros predadores ser feita com a distribuio
da casca de arroz nos focos de infestao dos caros fitfagos (Figura 1.E).
Figura 1 A-E. Representao esquemtica do processo de produo e distribuio de caros predadores do
projeto de controle biolgico de caros fitfagos.

Biotecnologia

SUMRIO

267

CAPTULO 13
CLULAS FNGICAS: PRODUO, CONTAGEM
E VIABILIDADE APLICADAS AO CONTROLE
BIOLGICO
Luclia Santi, Markus Berger Oliveira, Walter Orlando Beys da Silva

Biotecnologia

SUMRIO

268

13.1 PRODUO DE CONDIOS DE FUNGOS FILAMENTOSOS


Condios (ou esporos assexuados) de fungos filamentosos representam a forma mais comum
de reproduo assexuada dos fungos, e so muito importantes para a disperso destes organismos
na natureza. Os condios so clulas haploides, geneticamente semelhantes aos progenitores,
sendo capazes de gerar um novo organismo ao encontrarem condies ambientais favorveis. A
produo de condios pode ser feita em placas de Petri, normalmente utilizando um meio sinttico,
ou em substratos mais simples e comuns, como gros tais como arroz. No ltimo caso, a produo
considerada de larga escala, pois um mtodo simples e de alto rendimento.
As metodologias apresentadas aqui foram baseadas principalmente para dois fungos
amplamente utilizados para controle biolgico: Metarhizium anisopliae e Beauveria bassiana.
Entretanto, os mtodos podem ser tambm aplicados para outros fungos.
a. Em placas de petri
1. Preparar placas contendo o meio escolhido. Para muitos fungos pode-se utilizar o meio
BDA (batata-dextrose-gar), por ser fcil de preparar e conter todos os compostos essenciais para o
crescimento fngico. um meio de cultura barato e fcil de ser encontrado comercialmente.
placa.

2. Fazer o inculo estriado do fungo utilizando uma ala de platina, preenchendo toda a
3. Manter as placas em estufa 28oC ou a temperatura desejada at a total esporulao.
4. As placas podem ser utilizadas para a suspenso de esporos, conforme ser visto a seguir.

Meio BDA
300 g
10 g
18 g
1L

Batata (descascadas e picadas)*


Glicose
gar
H2O destilada

*ferver a batata com um pouco de gua destilada em micro-ondas (10 minutos). Filtrar a gua do cozimento,
para ser usada no meio, e adicionar os outros ingredientes. Ajustar o volume para 1 L. Esterilizar por
autoclavagem (15 minutos 121oC).

Referncias
FRAZZON, A. P.; SILVA, Vaz Junior da; MASUDA,A.;SCHRANK, A; VAIINSTEIN, MH.: In vitro assessment
ofMetarhiziumanisopliae isolates to control the cattle tick Boophilus microplus. Veterinary Parasitology. 94(1-2): 117-125.
2000.

b. em arroz produo em grande escala:


1. Preparar sacos de polipropileno contendo 100 g de arroz branco e 30 mL de uma soluo
de 0,5% peptona (0,5 g peptona em 100 mL de gua destilada). Fechar os sacos com barbante
no apertar muito para permitir a entrada do vapor esterilizante. Esterilizar por autoclavagem (15
minutos, 1 atm, 121oC). Aps autoclavagem, apertar o barbante para manter o material estril.
Dica: o arroz autoclavado pode ficar com grumos, que devem ser desmanchados manualmente
(com o saco fechado) antes do inculo, para facilitar a disseminao do fungo.
2. Em cada saco de arroz esterilizado, adicionar 1 mL de suspenso de condios na
concentrao de 106 condios/mL e misturar bem manualmente.

Biotecnologia

SUMRIO

269

3. Manter os sacos de arroz em estufa por 28oC por 14 dias. Dependendo do fungo, este
tempo pode ser menor ou maior e render mais ou menos condios.
Dica: semanalmente, observar os sacos inoculados e agitar manualmente o arroz para
disperso dos esporos e melhora no rendimento.
4. Aps esporulao do fungo de forma satisfatria, misturar manualmente o arroz para
melhorar a liberao dos condios. Pode-se utilizar uma esptula estril para misturar o arroz.
5. Colocar o arroz em uma peneira e esfregar com uma esptula estril para liberao dos
esporos.
Dica: preparar um becker grande estril e colocar sob a peneira para coleta dos esporos. Por
ser muito leve, a formao de poeira de esporos fcil; portanto, o ato de peneirar deve ser feito
cuidadosamente para evitar a perda de material.
6. Estes esporos podem ser utilizados de duas formas:
6.1. secos: devem ser armazenados em falcons de 50 mL na geladeira, mantendo uma
viabilidade alta por normalmente at 1 ms (dependendo do fungo ou isolado).
6.2. em suspenso: utilizando uma soluo de Tween 80 0,01%, somente gua ou outra
formulao especfica. Podem ser armazenados na geladeira e mantm, normalmente, alta
viabilidade por at 1 semana, dependendo do fungo ou isolado.
Dica: o preparo da suspenso pode ser feita diretamente a partir do esporo produzido em
placa ou nos sacos de arroz adicionando a gua ou soluo sem a peneiragem dos esporos.
Dica: sempre antes de utilizar os esporos, independente se forem secos ou em suspenso,
deve-se testar sua esterilidade por meio de cultura por 16 horas em meio Luria-Bertani (LB).
Meio LB (Luria-Bertani)
10 g
5g
10 g
1L

Peptona
Extrato de levedura
NaCl
H2O destilada

Autoclavar 15 minutos 121oC

Referncias:
BEYS DA SILVA, W.O., SANTI, L., BERGER M., PINTO, A.F.M., GUIMARES, J.A., SCHRANK, A., VAINSTEIN,
M.H.: Characterization of a spore surface lipase from the biocontrol agent Metarhizium anisopliae. Process
Biochemistry, 44: 829834. 2009.
SANTI, L.; SILVA, L.A.D.; BEYS DA SILVA, W.O.; CORREA, A.P.F.; RANGEL, D.E.N.; CARLINI, C.R.; SCHRANK,
A.; VAINSTEIN, M.H.: Virulence of the entomopathogenic fungus Metarhizium anisopliae using soybean oil
formulation for control of the cotton stainer bug, Dysdercus peruvianus. World Journal of Microbiology and
Biotechnology 27:22972303. 2011.

Biotecnologia

SUMRIO

270

13.2 PREPARAO DA SUSPENSO DE CONDIOS (ESPOROS) DE


FUNGOS FILAMENTOSOS
O processo de preparo de suspenso de condios (ou esporos) de fungos filamentosos
consiste em liberar os esporos dos fungos cultivados em placas de petri ou outro substrato para
posterior cultivo ou inculo do microrganismo. Desta forma, os experimentos so padronizados
pelo nmero de condios a ser adicionado.
1. Despejar 3 mL de soluo de Tween 80 0,01% sobre a placa de petri contendo o cultivo do
fungo filamentoso esporulado.
2. Esfregar com ala de vidro cuidadosamente para liberar os esporos.
3. Transferir o lquido para um tubo do tipo falcon estril (de 15 ou 50 mL, dependendo da
centrfuga a ser utilizada).
4. Centrifugar (5.000 rpm / 10 minutos) e descartar o sobrenadante.
Lavar os esporos com gua destilada estril.
Centrifugar (5.000 rpm / 10 minutos) e descartar o sobrenadante.
Ressuspender a suspenso com gua destilada estril
Testar a esterilidade adicionar a um tubo de vidro contendo 3 mL de meio LB estril 10 L
da suspenso de esporos.
Os tubos com meio LB devem ser mantidos por 16 horas sob agitao (180 rpm) 37oC. Se,
aps este perodo, no houver turbidez no tubo, a suspenso no est contaminada e poder ser
utilizada.
Dica: a suspenso de esporos pode ser mantida na geladeira por at sete dias com viabilidade
alta, dependendo do fungo ou isolado.
Tween 80 0,01*
1,0 mL
100 mL

Tween 80
H2O destilada

*autoclavar 15 minutos 121oC

Biotecnologia

SUMRIO

271

13.3 CONTAGEM DA SUSPENSO DE CONDIOS OU LEVEDURAS


A contagem de uma suspenso de esporos ou leveduras baseia-se no nmero de clulas
visualizadas em cmera de Neubauer. importante lembrar que esta contagem no diferencia
clulas viveis de no viveis.
Em um tubo eppendorf (1,5 mL) adicionar 990 L de gua e 10 L da suspenso de esporos e
agitar por alguns segundos em vortex.
Importante lembrar que, para manter a esterilidade da suspenso, a mesma dever ser
sempre manipulada em capela de fluxo laminar ou prxima a um bico de Bunsen, para manter a
esterilidade do ambiente de manipulao.
Colocar 10 L desta mistura em uma cmara de Neubauer e cobrir com uma lamnula.
Para cmaras com 25 quadrados: contar os cinco quadrados das pontas, mais o central (ver
figura abaixo):

Clculo da concentrao: nmero de clulas contadas x 5 (para fechar os 25 quadrados) x


10 (fator da cmara de Neubauer) x 102 (diluio realizada dos esporos) o valor dado em x
clulas/mL.
4

Biotecnologia

SUMRIO

272

13.4 TESTE DE VIABILIDADE DA SUSPENSO DE CONDIOS


A viabilidade de uma suspenso de esporos fundamental para o sucesso do cultivo ou outro
tipo de teste, como, por exemplo, bioensaio. O ideal que uma suspenso tenha uma viabilidade
maior ou igual a 80%.
Dica: o teste de viabilidade pode ser realizado logo aps a suspenso de esporos ficar pronta,
uma vez que o tempo para avaliao da viabilidade prximo ao tempo para teste de esterilidade.
Em uma placa de petri contendo meio BDA (batata-dextrose-gar), adicionar 0,1 mL da
suspenso de esporos e espalhar com o auxlio de uma ala de vidro, previamente esterilizada e
fria.
Incubar a placa em estufa de 24 a 72 horas, dependendo do fungo ou isolado, 28oC.
Realizar a contagem dos esporos ou condios germinados a partir das Unidades Formadoras
de Colnia (UFCs) visualizadas.

Biotecnologia

SUMRIO

273

13.5 EXTRAO DE PROTENAS DE SUPERFCIE DE CONDIOS


FNGICOS
Condios apresentam diversas protenas em sua superfcie, que podem ser separadas sem
necessariamente causar a ruptura celular. Estas protenas so importantes para estudos de interao
das clulas fngicas com seus hospedeiros, caracterizao enzimtica ou protemica, por exemplo.
1. Os condios podem estar secos ou midos (como aps a centrifugao de uma suspenso
como descrito acima).
2. Adicionar s clulas o tampo de extrao (Tris-HCl pH 8,0 contendo 0,25% de Triton
X-100) na proporo de 1:2,5 (1 g de clula para 2,5 mL tampo).
3. Agitar em vortex por 5 minutos.
4. Centrifugar o material por 15 minutos a 13.000 rpm.
5. Filtrar o sobrenadante em filtro de poro 0,22 m.
6. Aliquotar (em eppendorfs de 1,5 mL e falcons de 15 mL) e armazenar -20 oC.
Dica: antes da filtragem em poro 0,22 m, filtrar em papel filtro comum, que facilita a ltima
etapa e economiza o filtro mais caro.
Referncias
BEYS DA SILVA, W.O.; SANTI, L.; BERGER M.; PINTO, A.F.M.; GUIMARES, J.A.; SCHRANK, A.; VAINSTEIN,
M.H.: Characterization of a spore surface lipase from the biocontrol agent Metarhizium anisopliae. Process
Biochemistry, 44: 829834. 2009.

Biotecnologia

SUMRIO

274

CAPTULO 14
MODELOS BIOLGICOS PR-CLNICOS PARA
AVALIAO DA ATIVIDADE DE SUBSTNCIAS
FARMACOLOGICAMENTE ATIVAS
Jorge Almeida Guimares, Luclia Santi, Markus Berger Oliveira, Walter Orlando Beys da Silva

Os modelos biolgicos tm papel fundamental, tanto na etapa de pesquisa bsica quanto nas
etapas de desenvolvimento pr-clinico, para novos medicamentos e substncias farmacologicamente
ativas. Nesses casos, modelos que utilizam organismos vivos para mimetizar uma determinada
fisiopatologia so imprescindveis para o seguimento de uma srie de etapas, entre elas: A seleo
do alvo molecular; o desenvolvimento de ensaios farmacolgicos especficos que permitam aferir
a atividade sobre o alvo selecionado; o desenho molecular racional de ligantes para o alvo eleito;
testes de segurana e eficcia; e ensaios de toxicologia. Neste captulo, apresentaremos alguns
protocolos de modelos biolgicos in vivo clssicos teis tanto para o estudo do mecanismo de ao
de novas substncias e/ ou extratos quanto para a investigao da fisiopatologia de doenas. nfase
ser dada aos modelos de doenas tromboemblicas e inflamatrias.

Biotecnologia

SUMRIO

275

14.1 MODELO DE TROMBOSE VENOSA LOCAL


Neste protocolo o processo de trombose venosa induzido localmente na veia cava
inferior de ratos por uma combinao de estase mecnica e estmulo pr-coagulante. A formao
de trombo induzida tanto pelo estreitamento da veia cava (estase) quanto pela injeo de um
agente que dispara a cascata de coagulao sangunea (tromboplastina). As principais aplicaes
so para a avaliao dos efeitos anticoagulantes e antitrombticos de diferentes frmacos, extratos
ou compostos isolados de plantas, ou ainda para estudar o papel de diferentes protenas, clulas,
plaquetas e outros mediadores do processo de hemostasia.
Animais
So utilizados ratos adultos machos da linhagem Wistar (200-250 g), mantidos em biotrio
especfico, com ciclo claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60 - 80 %,
com livre acesso gua e rao. Pelo menos dois dias antes dos experimentos, transferir os
animais para o biotrio do setor onde os procedimentos sero realizados para adaptao. Todos os
experimentos com animais devem seguir obrigatoriamente as atribuies e competncias definidas
na Lei 11.794/08 e em resolues do Conselho Nacional de Controle em Experimentao Animal
(CONCEA). Antes da realizao de qualquer procedimento, o protocolo - incluindo a identificao
das substncias ou extratos a serem testados e suas doses -, devem ser submetidos anlise da
Comisso de tica para o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e
eutansia sugeridos aqui esto de acordo com o NIH Guide for the Care and Use of Laboratory Animals
(edio revisada em 1996 -http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
- Fio cirrgico de Nylon monofilamento 4-0 (45 cm) 3/8, estril, no absorvvel sem agulha;
- Algodo e gaze;
- Material cirrgico (pina simples reta, pina simples curva, pina dente-de-rato, pinas
hemostticas e tesoura reta);
- Placas de petri e papel filtro;
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- Cronmetro;
- Estufa 60 C;
- Balana analtica;
- Tampo fosfato (PBS);
- lcool iodado 1%;
- Tromboplastina;
- Xilazina e Ketamina.

Biotecnologia

SUMRIO

276

Procedimentos
1. Pesar o animal;
2. Preparar na mesma seringa e administrar por via intraperitoneal (i.p.) a mistura de
Xilazina (10 mg/kg) + Ketamina (75 mg/kg). Esta dose mantm um bom plano anestsico por 3045 minutos. Aps este tempo, suplementar com 1/3 da dose de Ketamina;
3. Dispor o animal na mesa cirrgica em decbito dorsal, prendendo patas e cabea;
4. Realizar a tricotomia de toda a regio abdominal e antissepsia com algodo embebido em
lcool iodado 1%;
5. Proceder a inciso do abdome, afastar a parede antero-lateral com as pinas hemostticas e
rebater o intestino grosso para o lado direto do animal, a fim de expor a veia cava inferior. Manter
a regio do intestino permanentemente hidratada com gaze embebida em PBS (37 C) durante todo
o procedimento;
6. Localizar a veia cava inferior prximo s veias renais e, com o auxlio das pinas retas
e dente-de-rato, dissec-la cuidadosamente at a regio de confluncia das veias ilacas comuns,
isolando-a do tecido conjuntivo adjacente e da aorta abdominal;
7. Com o auxlio da pina simples curva, passar os fios de nylon 4-0 pelas tributrias de
maior calibre e pela veia renal esquerda deixando ns frouxos, sem que haja obstruo do fluxo
sanguneo, para posterior ligadura;
8. Com o auxlio da pina simples curva passar um fio de nylon 4-0 na extremidade cranial
(ou superior da veia cava), imediatamente abaixo da veia renal direita, e outro fio na extremidade
caudal (ou inferior da veia cava) prximo regio de confluncia das veias ilacas comuns. Manter
os ns frouxos, sem que haja obstruo do fluxo sanguneo, para posterior ligadura;
9. Administrar a substncia a ser testada ou PBS (no caso dos animais do grupo controle)
por via intravenosa, diretamente na veia cava inferior prximo s ilacas. O volume mximo a ser
injetado deve ser de 0,5 mL diludos em PBS (37 C);
10. Cronometrar 5 minutos;
11. Administrar a soluo de tromboplastina (3 mg/kg em volume mximo de 0,5 mL)
diretamente na veia cava inferior prximo s ilacas e ligar a extremidade cranial (logo abaixo da
veia renal direita);
12. Cronometrar 20 minutos;
13. Ligar os demais pontos, incluindo a veia renal esquerda, as tributrias de maior calibre e
a extremidade caudal da veia cava inferior;
14. Dissecar cuidadosamente o segmento da veia cava ligado contendo o trombo. Comear
a disseco pela extremidade superior e, aps retir-lo completamente, lavar o segmento com PBS
(37 C);
15. Cortar um dos ns do segmento extrado e retirar o trombo formado;
16. Lavar o trombo com PBS 37 C, secar em papel filtro e pesar o trombo mido em balana
analtica;
17. Manter o trombo em estufa 60 C por 1 hora;
18. Pesar o trombo seco em balana analtica.

Biotecnologia

SUMRIO

277

Anlise dos Resultados


Os resultados so expressos pela razo entre a massa do trombo seco e a massa do animal
(geralmente mg de trombo/g de rato) e representados em um grfico versus a dose da substncia
testada. No caso de uma substncia antitrombtica, antiplaquetria ou de um inibidor da coagulao,
espera-se que essa razo diminua conforme h um aumento de dose. Um nmero de 8-10 animais
por grupo a ser testado recomendado para garantir a reprodutibilidade dos resultados.
Referncias:
DAHMER, T.; BERGER, M.; BARLETTE, AG.; RECK, J. Jr.; SEGALIN, J.; VERZA, S.; ORTEGA, GG.; GNOATTO, SC.;
GUIMARES, J.A.; VERLI, H.; GOSMANN, G.: Antithrombotic effect of chikusetsusaponin IVa isolated from Ilex
paraguariensis (Mat). J Med Food. 2012, 15(12):1073-80.
RECK, J. Jr.; BERGER, M.; MARKS F.S.; ZINGALI, R.B.; CANAL, C. W.;, FERREIRA, C. A.; GUIMARES, J. A.;
TERMIGNONI, C.: Pharmacological action of tick saliva upon haemostasis and the neutralization ability of sera from
repeatedly infested hosts. Parasitology. 2009, 136(11):1339-49.
VOGEL, G. M.; MEULEMAN, D. G.; BOURGONDIEN, F. G.; HOBBELEN, P. M.: Comparison of two experimental
thrombosis models in rats effects of four glycosaminoglycans. Thromb Res 1989; 54: 399410.

Biotecnologia

SUMRIO

278

14.2 MODELO DE TROMBOSE VENOSA PROFUNDA


Neste protocolo o processo de trombose venosa induzido sistemicamente na veia cava
inferior de ratos ou camundongos por estase mecnica. O trombo formado pela completa obstruo
de parte da veia cava inferior o que acaba por disparar o processo de coagulao naturalmente por
leso endotelial e inflamao da parede do vaso. As principais aplicaes so para a avaliao dos
efeitos anticoagulantes e antitrombticos de diferentes frmacos, extratos ou compostos isolados
de plantas, ou ainda para estudar o papel de diferentes protenas, clulas, plaquetas e tambm a
contribuio de mediadores inflamatrios e quimiocinas para o processo de hemostasia. Modelo de
escolha para o estudo da interao entre o processo inflamatrio na parede do vaso e a formao de
um trombo venoso oclusivo.
Animais
So utilizados ratos (200-250 g) ou camundongos (25-30 g) adultos machos mantidos em
biotrio especfico, com ciclo claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60
- 80 %, com livre acesso a gua e rao. Pelo menos dois dias antes dos experimentos, transferir os
animais para o biotrio do setor onde os procedimentos sero realizados para adaptao. Todos
os experimentos com animais devem seguir obrigatoriamente as atribuies e as competncias
definidas na Lei 11.794/08 e em resolues do Conselho Nacional de Controle em Experimentao
Animal (CONCEA). Antes da realizao de qualquer procedimento o protocolo, incluindo a
identificao das substncias ou extratos a serem testados e suas doses, devem ser submetidos
anlise da Comisso de tica para o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia
e eutansia sugeridos aqui esto de acordo com o NIH Guide for the Care and Use of Laboratory Animals
(edio revisada em 1996 -http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Manta de aquecimento;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
- Fio cirrgico de Nylon monofilamento 4-0 (45 cm) 3/8, estril, no absorvvel com e sem
agulha;
- Algodo e gaze;
- Material cirrgico (pina simples reta, pina simples curva, pina dente-de-rato, pinas
hemostticas e tesoura reta);
- Placas de petri e papel filtro;
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- Estufa 60 C;
- Balana analtica;
- Tampo fosfato (PBS);
- lcool iodado 1%;
- Lidocana;
- Xilazina e Ketamina.

Biotecnologia

SUMRIO

279

Procedimentos
1. Pesar o animal;
2. Preparar na mesma seringa e administrar por via intraperitoneal (i.p.) a mistura de
Xilazina (10 mg/kg) + Ketamina (75 mg/kg). Esta dose mantm um bom plano anestsico por 3045 minutos. Aps este tempo, suplementar com 1/3 da dose de Ketamina;
3. Dispor o animal na mesa cirrgica aquecida 37 C em decbito dorsal, prendendo patas e
cabea (importante manter a temperatura de 37-38 C durante todo o procedimento);
4. Realizar a tricotomia de toda a regio abdominal e antissepsia com algodo embebido em
lcool iodado 1%;
5. Proceder a inciso do abdome (inciso de aproximadamente 2 cm), afastar a parede anterolateral com as pinas hemostticas e rebater o intestino grosso para o lado direto do animal, a fim
de expor a veia cava inferior. Manter a regio do intestino permanentemente hidratada com gaze
embebida em PBS (37 C) durante todo o procedimento;
6. Localizar a veia cava inferior prximo s veias renais e com o auxlio das pinas retas e
dente-de-rato dissec-la cuidadosamente somente na regio entre as veias renais esquerda e direita,
isolando-a do tecido conjuntivo adjacente e da aorta abdominal.
Dica: esta etapa deve ser realizada com cuidado especial no caso de camundongos devido
fragilidade dos tecidos. Recomenda-se o uso de uma lupa cirrgica para facilitar a visualizao das
estruturas e evitar leso na cava e aorta;
7. Com o auxlio da pina simples curva passar os fios de nylon 4-0 e imediatamente ligar
as tributrias de maior calibre e outros pequenos vasos que so ramificaes da cava inferior
principalmente no segmento entre as veias renais e a bifurcao da veia ilaca;
8. Com o auxlio da pina simples curva passar um fio de nylon 4-0 e imediatamente ligar a
veia cava inferior logo abaixo das veias renais;
9. Cuidadosamente acondicionar novamente o intestino na cavidade abdominal e suturar em
dois planos (parede abdominal e pele);
10. Administrar lidocana 4 mg/kg (0,4 mL/kg de uma soluo 1 %) diretamente no local
da sutura;
11. Manter os animais na manta de aquecimento 37 C at a completa recuperao da
anestesia;
12. Aps diferentes tempos da induo da estase (aps a ligao da veia cava) os animais so
novamente anestesiados seguindo o esquema acima e uma nova inciso na parede abdominal
realizada;
14. Dissecar cuidadosamente o segmento da veia cava ligado contendo o trombo (abaixo
das veias renais). Comear a disseco pela extremidade superior e, aps retir-lo completamente,
lavar o segmento com PBS (37 C);
15. Cortar o n do segmento extrado e retirar o trombo formado;
16. Lavar o trombo com PBS 37 C, secar em papel filtro e pesar o trombo mido em balana
analtica;
17. Manter o trombo em estufa 60 C por 1 hora;
18. Pesar o trombo seco em balana analtica.
Dicas: 1. Usando este modelo, a substncia a ser testada pode ser administrada como prtratamento (antes da induo da estase) ou ps-tratamento (aps a induo da estase) por via oral,
intraperitoneal, subcutnea ou intravenosa. Se a via de escolha for a intravenosa, recomenda-se
administrar pela veia caudal;

Biotecnologia

SUMRIO

280

2. O trombo pode ser retirado em diferentes tempos aps a induo da estase variando de 24
horas at 21 dias dependendo do tipo de substncia a ser testada. Normalmente a massa do trombo
aumenta com o tempo entre o primeiro e o quarto dia devido ao intenso processo inflamatrio e
ativao da coagulao e, posteriormente, diminui a partir do quarto dia dependendo da resoluo
do processo inflamatrio e ativao da fibrinlise.
Anlise dos Resultados
Os resultados so expressos pela razo entre a massa do trombo seco e a massa do animal
(geralmente mg de trombo/g de rato) e representados em um grfico versus a dose da substncia
testada. No caso de uma substncia antitrombtica, antiplaquetria ou de um inibidor da coagulao
espera-se que essa razo diminua conforme h um aumento de dose. Um nmero de 8-10 animais
por grupo a ser testado recomendado para garantir a reprodutibilidade dos resultados.
Alm da massa do trombo outros parmetros podem ser analisados como contagem de clulas
inflamatrias na parede do vaso, histologia, quantificao da deposio de protenas e fibrose na
parede do vaso, morfologia e morfometria do cogulo, anlise da expresso de genes de interesse
nas clulas vasculares, e ensaios de atividade enzimtica no plasma.
Referncias
Diaz JA, Ballard-Lipka NE, Farris DM, Hawley AE, Wrobleski SK, Myers DD, Henke PK, Lawrence DA, Wakefield
TW. Impaired fibrinolytic system in ApoE gene-deleted mice with hyperlipidemia augments deep vein thrombosis. J
Vasc Surg. 2012;55(3):815-22.
Shuster KA, Wrobleski SK, Hawley AE, Lucchesi BR, Sorenson DR, Bergin IL, Sigler RE, Guire KE, Nowland MH,
Wakefield TW, Myers DD Jr. Prothrombotic effects of thrombolytic therapy in a rat (Rattus norvegicus) model of
venous thrombolysis. Comp Med. 2013; 63(3):244-51.
Wrobleski SK, Farris DM, Diaz JA, Myers DD Jr, Wakefield TW. Mouse complete stasis model of inferior vena cava
thrombosis. J Vis Exp. 2011; 15;(52).

Biotecnologia

SUMRIO

281

14.3 MODELO DE HEMORRAGIA


Neste protocolo a hemorragia induzida pelo corte da cauda de ratos ou camundongos e o
tempo de sangramento registrado. As principais aplicaes so para a avaliao da segurana de
substncias e/ou extratos com reconhecida atividade anticoagulante e/ou antitrombtica.
Animais
So utilizados ratos (200-250 g) ou camundongos (25-30 g) adultos machos mantidos em
biotrio especfico, com ciclo claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60
- 80 %, com livre acesso a gua e rao. Pelo menos dois dias antes dos experimentos, transferir os
animais para o biotrio do setor onde os procedimentos sero realizados para adaptao. Todos os
experimentos com animais devem seguir obrigatoriamente as atribuies e competncias definidas
na Lei 11.794/08 e em resolues do Conselho Nacional de Controle em Experimentao Animal
(CONCEA). Antes da realizao de qualquer procedimento o protocolo, incluindo a identificao
das substncias ou extratos a serem testados e suas doses, devem ser submetidos anlise da
Comisso de tica para o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e
eutansia sugeridos aqui esto de acordo com o NIH Guide for the Care and Use of Laboratory Animals
(edio revisada em 1996 -http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
- Lmina de bisturi n 20;
- Cronmetro;
- Papel filtro;
- gua destilada;
- PBS;
- lcool iodado 1%;
- Heparina;
- Xilazina e Ketamina.
Procedimentos
1. Pesar o animal;
2. Preparar na mesma seringa e administrar por via intraperitoneal (i.p.) a mistura de
Xilazina (10 mg/kg) + Ketamina (75 mg/kg). Esta dose mantm um bom plano anestsico por 3045 minutos. Aps este tempo, suplementar com 1/3 da dose de Ketamina;
3. Dispor o animal na mesa cirrgica em decbito dorsal, prendendo patas e cabea;
4. Realizar a antissepsia da cauda com lcool iodado 1% e administrar a substncia a ser
testada, PBS ou heparina (50 g/kg) por via intravenosa na veia caudal;
5. Aps 5 minutos, com a lmina de bisturi, realizar uma inciso a distncia de
aproximadamente 3 mm da ponta da cauda;
6. Cronometrar o tempo de parada do sangramento;
7. Aps o experimento sacrificar os animais por aprofundamento da anestesia.

Biotecnologia

SUMRIO

282

Anlise dos Resultados


Os resultados so expressos como tempo de sangramento e comparados com os tempos dos
animais controles tratados com PBS ou heparina;
Espera-se que substncias com atividade anticoagulante e/ou antitrombtica prolonguem o
tempo de sangramento. No entanto, esse tempo no deve ser superior ao tempo de sangramento
induzido pela droga controle (heparina). Caso seja superior, a substncia teste possui um risco
potencial de ser hemorrgica.
Referncias:
Dahmer T, Berger M, Barlette AG, Reck J Jr, Segalin J, Verza S, Ortega GG, Gnoatto SC, Guimares JA, Verli H,
Gosmann G. Antithrombotic effect of chikusetsusaponin IVa isolated from Ilex paraguariensis (Mat). J Med Food.
2012, 15(12):1073-80.
Mendes-Silva W, Assafim M, Ruta B, Monteiro RQ, Guimares JA, Zingali RB. Antithrombotic effect of Glycyrrhizin, a
plant-derived thrombin inhibitor. Thromb Res. 2003;112(1-2):93-8.

Biotecnologia

SUMRIO

283

14.4 MODELO DE ASMA ALRGICA


Neste protocolo a inflamao pulmonar alrgica induzida por ovalbumina em camundongos.
As principais aplicaes so para a avaliao dos efeitos anti-inflamatrios e imunorregulatrios de
diferentes substncias, como drogas sintticas e produtos naturais (extratos ou compostos isolados
de plantas), ou ainda, para estudar o papel de clulas inflamatrias, protenas, quimiocinas e
citocinas no pulmo.
Animais
So utilizados camundongos (25-30 g) adultos machos mantidos em biotrio especfico, com
ciclo claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60 - 80 %, com livre acesso
a gua e rao. Pelo menos dois dias antes dos experimentos transferir os animais para o biotrio
do setor onde os procedimentos sero realizados para adaptao. Todos os experimentos com
animais devem seguir obrigatoriamente as atribuies e competncias definidas na Lei 11.794/08
e em resolues do Conselho Nacional de Controle em Experimentao Animal (CONCEA). Antes
da realizao de qualquer procedimento o protocolo, incluindo a identificao das substncias ou
extratos a serem testados e suas doses, devem ser submetidos anlise da Comisso de tica para
o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e eutansia sugeridos aqui esto
de acordo com o NIH Guide for the Care and Use of Laboratory Animals (edio revisada em 1996
-http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
reta);

- Material cirrgico (pina simples reta, pina dente-de-rato, pinas hemostticas e tesoura
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- Cateter intravascular perifrico (20 G) ou cnula PE-50 conectada a uma seringa de 1 mL;
- Pina histolgica (ponta fina);
- Pipeta automtica;
- PBS;
- Heparina (20 UI/mL);
- Hidrxido de Alumnio;
- Isoflurano;
Pentobarbital sdico;
Ovalbumina.

Procedimentos
1. Anestesiar os animais levemente com isoflurano e realizar a 1 imunizao (dia zero) pela
injeo subcutnea (s.c.) de uma suspenso contendo 4 g de ovalbumina e 1,6 mg de hidrxido de
alumnio em PBS (volume mximo de 0,2 mL). Os animais controle devem ser injetados com PBS
(0,2 mL) por via s.c.;
2. No 7 dia aps a 1 imunizao (dia zero), realizar a 2 imunizao seguindo o mesmo
esquema anterior;

Biotecnologia

SUMRIO

284

3. No 14 dia (1 desafio) aps a primeira imunizao (dia zero), anestesiar levemente os


animais com isoflurano e administrar via intranasal (i.n) 50 L de uma soluo contendo 10 g de
ovalbumina em PBS. Aos animais controle administrar 50 L de PBS (i.n).
Dica: aplicar a ovalbumina ou PBS com o auxlio de uma pipeta diretamente ao focinho dos
animais enquanto estiverem ofegantes;
zero);

4. Repetir o procedimento anterior no 21 dia (2 desafio) aps a primeira imunizao (dia

5. Aps 24 h do 2 desafio sacrificar os animais pela injeo i.p de pentobarbital sdico (50
mg/kg);
6. Dispor o animal na mesa cirrgica em decbito dorsal, prendendo patas e cabea;
7. Proceder a tricotomia da regio do pescoo e trax, realizar uma inciso na regio do
pescoo (1 cm abaixo do focinho) e expor a traqueia. Dissecar cuidadosamente a regio da traqueia
separando-a do tecido conjuntivo subjacente, glndulas e msculo;
8. Aps a completa disseco e exposio da traqueia, inserir a pina histolgica na regio
abaixo da traqueia no sentido do lado esquerdo para o direito do animal, a fim de dar suporte para
a insero do cateter;
9. Introduzir o cateter intravascular 20 G ou a cnula PE-50 na poro superior da traqueia.
Se for utilizado o cateter, retirar a agulha e, em seguida, retirar tambm a pina histolgica abaixo
da traqueia;
10. Realizar a lavagem bronco-alveolar. Para isso, conectar uma seringa de insulina (1 mL)
no cateter ou cnula e injetar de 0,3 - 0,4 mL de heparina (20 UI/mL) diluda em PBS. O lquido
injetado deve ser coletado novamente e o procedimento deve ser repetido por mais duas vezes
totalizando um volume coletado de lavado bronco-alveolar de 1 mL.
Dica: trocar a seringa a cada grupo experimental e manter o lavado coletado no gelo;
11. Aps a coleta do lavado bronco-alveolar, dissecar a regio dos pulmes, remov-los e
lav-los com PBS. Parte do tecido pulmonar deve ser congelado imediatamente em nitrognio
lquido e reservado para posterior anlise de mediadores inflamatrios. Outra parte do tecido deve
ser armazenada em formaldedo tamponado 10 % para anlise histolgica.
Anlise dos Resultados
Neste protocolo, os resultados podem ser expressos de uma srie de maneiras diferentes
dependendo do direcionamento das anlises. Normalmente, o grau de inflamao pulmonar
determinado pela contagem total e diferencial de clulas inflamatrias presentes no lavado
bronco-alveolar. A anlise dessas clulas tambm pode ser feita diretamente no tecido pulmonar
por histologia. Alm disso, citocinas, quimiocinas, xido ntrico e a atividade de algumas enzimas
podem ser dosadas tanto no lavado bronco-alveolar quanto no tecido pulmonar.
Referncias:
RUSSO M, NAHORI MA, LEFORT J, GOMES E, DE CASTRO KELLER A, RODRIGUEZ D, RIBEIRO OG,
ADRIOUCH S, GALLOIS V, DE FARIA AM, VARGAFTIG BB. Suppression of asthma-like responses in different
mouse strains by oral tolerance. Am J Respir Cell Mol Biol. 2001;24(5):518-26.

Biotecnologia

SUMRIO

285

14.5 MODELO DE PERMEABILIDADE VASCULAR


Neste protocolo as alteraes da permeabilidade vascular podem ser quantificadas pelo
extravasamento vascular de um marcador (o corante azul de evans) que liga-se albumina
plasmtica. Pela ao de um estmulo vasodilatador ou pr-inflamatrio o corante pode ser
detectado no tecido. As principais aplicaes so para a avaliao dos efeitos anti-inflamatrios e
antiedematognicos de diferentes substncias, como drogas sintticas e produtos naturais (extratos
ou compostos isolados de plantas), ou ainda, para estudar o papel de clulas inflamatrias,
peptdeos vasoativos, substncias vasodilatadoras, quimiocinas e citocinas.
Animais
So utilizados ratos adultos machos (200-250 g) mantidos em biotrio especfico, com ciclo
claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60 - 80 %, com livre acesso gua
e rao. Pelo menos dois dias antes dos experimentos, transferir os animais para o biotrio do
setor onde os procedimentos sero realizados para adaptao. Todos os experimentos com animais
devem seguir obrigatoriamente as atribuies e competncias definidas na Lei 11.794/08 e em
resolues do Conselho Nacional de Controle em Experimentao Animal (CONCEA). Antes da
realizao de qualquer procedimento, o protocolo - incluindo a identificao das substncias ou
extratos a serem testados e suas doses -, devem ser submetidos anlise da Comisso de tica
para o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e eutansia sugeridos aqui
esto de acordo com o NIH Guide for the Care and Use of Laboratory Animals (edio revisada em 1996
-http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
reta);

- Material cirrgico (pina simples reta, pina dente-de-rato, pinas hemostticas e tesoura
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- PBS;
- Azul de Evans (C34H24N6Na4O14S4);
- Bradicinina;
- Histamina;
- Formamida;
- Estufa 40 C;
- Xilazina e Ketamina;

Procedimentos
1. Preparar na mesma seringa e administrar por via intraperitoneal (i.p.) a mistura de
Xilazina (10 mg/kg) + Ketamina (75 mg/kg). Esta dose mantm um bom plano anestsico por 3045 minutos. Aps este tempo, suplementar com 1/3 da dose de Ketamina;
2. Dispor o animal na mesa cirrgica em decbito ventral, prendendo patas e cabea;
3. Injetar por via intravenosa na veia caudal 50 mg/kg de Azul de Evans diludo em PBS
(volume mximo de 0,5 mL);

Biotecnologia

SUMRIO

286

4. Realizar a tricotomia de toda a regio dorsal do animal e dividir o dorso em


aproximadamente 10 - 12 quadrantes.
Dica: os pelos devem ser retirados completamente para facilitar a marcao e posterior
injeo intradrmica (i.d.);
5. Em cada quadrante injetar via i.d. (volume mximo de 0,1 mL): PBS (controle negativo),
3 nmols de bradicinina (controle positivo), 30 pmols de histamina (controle positivo) e diferentes
doses da substncia a ser testada.
Dica: outras substncias podem ser usadas como controle positivo dependendo do mecanismo
que se deseja explorar. Alternativamente, a substncia-teste tambm pode ser coadministrada com
bradicinina ou histamina para explorar a sua capacidade de inibir o extravasamento causado por
essas drogas vasoativas;
6. Aps 30 minutos sacrificar os animais por aumento da dose de anestsico;
7. Dissecar cuidadosamente toda a regio subcutnea do dorso do animal e remover a pele;
8. Separar cada quadrante em tubos previamente identificados contendo 2,5 mL de
formamida 1:1;
9. Extrair o azul de evans extravasado para o tecido incubando os tubos 40 C por 48 horas;
10. Separar a formamida de cada um dos tubos e dosar o azul de evans extrado em
espectrofotmetro a 600 nm;
11. Calcular a quantidade de azul de evans presente em cada tubo, utilizando uma curva
padro feita previamente com concentraes conhecidas do corante.
Anlise dos Resultados
Os resultados so expressos como quantidade de azul de evans (g) extrada por quadrante
de pele. A quantidade de azul de evans extrada na presena da substncia a ser testada deve ser
comparada com aquela extrada na presena de uma droga controle que induza o aumento de
permeabilidade vascular (no caso sugerimos bradicinina ou histamina).
O modelo oferece a vantagem de que diferentes doses podem ser testadas em um nico animal.
Referncias:
RATTMANN YD, PEREIRA CR, CURY Y, GREMSKI W, MARQUES MC, DA SILVA-SANTOS JE. Vascular
permeability and vasodilation induced by the Loxosceles intermedia venom in rats: involvement of mast cell
degranulation, histamine and 5-HT receptors. Toxicon 2008; 1;51(3):363-72.

Biotecnologia

SUMRIO

287

14.6 MODELO DE GASTRITE


Neste protocolo, a inflamao no estmago (lcera gstrica) induzida em ratos pelo
tratamento com etanol/HCl. As principais aplicaes so para a avaliao dos efeitos antiinflamatrios e imunorregulatrios de diferentes substncias, como drogas sintticas e produtos
naturais (extratos ou compostos isolados de plantas), ou ainda, para estudar o papel de clulas
inflamatrias, protenas, quimiocinas e citocinas no processo de inflamao gstrica.
Animais
So utilizados ratos adultos machos (200-250 g) mantidos em biotrio especfico, com ciclo
claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60 - 80 %, com livre acesso
gua e rao. Pelo menos dois dias antes dos experimentos, transferir os animais para o biotrio
do setor onde os procedimentos sero realizados para adaptao. Todos os experimentos com
animais devem seguir obrigatoriamente as atribuies e competncias definidas na Lei 11.794/08
e em resolues do Conselho Nacional de Controle em Experimentao Animal (CONCEA). Antes
da realizao de qualquer procedimento o protocolo, incluindo a identificao das substncias ou
extratos a serem testados e suas doses, devem ser submetidos anlise da Comisso de tica para
o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e eutansia sugeridos aqui esto
de acordo com o NIH Guide for the Care and Use of Laboratory Animals (edio revisada em 1996
-http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
- Fio cirrgico de Nylon monofilamento 4-0 (45 cm) 3/8, estril, no absorvvel sem agulha;
reta);

- Material cirrgico (pina simples reta, pina dente-de-rato, pinas hemostticas e tesoura
- Cnula de gavagem para ratos;
- Fita para medio de pH;
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- PBS;
- Etanol 80 %;
- HCl 5 %;
- Pantoprazol;
- Pentobarbital sdico;

Procedimentos
caixa;

1. Pesar os animais, identific-los e dividi-los em grupos de, no mximo, 4 indivduos por

2. Vinte e quatro horas antes da realizao do experimento, retirar a rao dos animais,
mantendo-os em jejum de alimentos slidos com acesso somente gua;
3. Com o auxlio da cnula de gavagem, injetar nos animais por via oral a substncia a ser
testada ou o controle positivo - pantoprazol 40 mg/kg;

Biotecnologia

SUMRIO

288

4. Aps 1 hora, tambm com o auxlio da cnula de gavagem, administrar 5 mL/kg da


mistura ulcerognica (80 % etanol + 5 % HCl);
5. Aps 4 horas da administrao da mistura ulcerognica sacrificar os animais pela injeo
i.p de pentobarbital sdico (50 mg/kg);
6. Dispor o animal na mesa cirrgica em decbito dorsal, prendendo patas e cabea;
7. Realizar a tricotomia da regio abdominal;
8. Realizar uma inciso na regio do abdome (abaixo da apfise xifide) de 3-4 cm, expor o
estmago (sem cort-lo) e ligar o esfago e o piloro com o auxlio dos fios de nylon 4-0, a fim de que
o contedo gstrico no se perca;
9. Remover o estmago cortando na extremidade anterior dos ns do esfago e piloro;
10. Remover o n do piloro, recolher o contedo gstrico em um recipiente e medir o pH com
o auxlio das fitas de medio;
11. Remover o n do esfago e abrir o estmago ao longo da grande curvatura para a
contagem das leses gstricas;
12. Lavar o estmago com PBS e observ-lo para a presena de hiperemia, hemorragia,
nmero e tamanho das lceras. Alternativamente, as lceras podero ser medidas com o auxlio
de um paqumetro para quantificar o tamanho da rea lesionada. Nesses casos, leses de nvel 1
correspondem a lceras de 1 mm, leses de nvel 2 a lceras de 2 mm e leses de nvel 3 a lceras de
3 mm (Szeleny & Thiemer, 1978);
13. Congelar imediatamente parte do tecido de cada estmago em nitrognio lquido para
anlise posterior de citocinas, quimiocinas e outros marcadores moleculares de leso. Outra parte
dos tecidos devem ser reservadas em formaldedo tamponado 10 % para anlise histolgica.
Anlise dos Resultados
Neste protocolo, os resultados podem ser expressos de uma srie de maneiras diferentes,
dependendo do direcionamento das anlises. Normalmente, o grau de inflamao gstrica e
gravidade da doena desenvolvida determinado pela avaliao do estado geral dos animais,
aparncia morfolgica macroscpica do estmago, pH do contedo gstrico, tamanho das lceras
desenvolvidas e alteraes histolgicas associadas inflamao. Alm disso, citocinas, quimiocinas,
xido ntrico e a atividade de algumas enzimas podem ser dosadas no tecido gstrico.
Referncias
HAULE EE, MOSHI MJ, NONDO RS, MWANGOMO DT, MAHUNNAH RL. A study of antimicrobial activity, acute
toxicity and cytoprotective effect of a polyherbal extract in a rat ethanol-HCl gastric ulcer model. BMC Res Notes.
2012; 2;5:546.
MOSHI MJ, NONDO RS, HAULE EE, MAHUNNAH RL, KIDUKULI AW. Antimicrobial activity, acute toxicity and
cytoprotective effect of Crassocephalum vitellinum (Benth.) S. Moore extract in a rat ethanol-HCl gastric ulcer model.
BMC Res Notes. 2014; 19;7(1):91.
SZELENYI I, THIEMER K. Distention ulcer as a model for testing of drugs for ulcerogenic side effects. Arch Toxicol.
1978; 13;41(1):99-105.

Biotecnologia

SUMRIO

289

14.7 MODELO DE COLITE


Neste protocolo, a inflamao no clon (colite ulcerativa ou doena de Crohn) induzida
em ratos ou camundongos pelo tratamento com dextran sulfato de sdio (DSS). As principais
aplicaes so para a avaliao dos efeitos anti-inflamatrios e imunorregulatrios de diferentes
substncias, como drogas sintticas e produtos naturais (extratos ou compostos isolados de
plantas), ou ainda, para estudar o papel de clulas inflamatrias, protenas, quimiocinas e citocinas
no processo de inflamao colnica. O modelo tambm bastante til para o estudo de doenas
extraintestinais, comumente associadas doena de Crohn, como: insuficincia renal, trombose e
inflamao pulmonar.
Animais
So utilizados ratos (200-250 g) ou camundongos (25-30 g) adultos machos mantidos em
biotrio especfico, com ciclo claro-escuro de 12 horas, temperatura de 22 2 C e umidade de 60
- 80 %, com livre acesso a gua e rao. Pelo menos dois dias antes dos experimentos, transferir os
animais para o biotrio do setor onde os procedimentos sero realizados para adaptao. Todos os
experimentos com animais devem seguir obrigatoriamente as atribuies e competncias definidas
na Lei 11.794/08 e em resolues do Conselho Nacional de Controle em Experimentao Animal
(CONCEA). Antes da realizao de qualquer procedimento o protocolo, incluindo a identificao
das substncias ou extratos a serem testados e suas doses, devem ser submetidos anlise da
Comisso de tica para o Uso de Animais (CEUA) da instituio. Os mtodos de anestesia e
eutansia sugeridos aqui esto de acordo com o NIH Guide for the Care and Use of Laboratory Animals
(edio revisada em 1996 -http://www.nap.edu/readingroom/ books/ labrats/).
Materiais
- Mesa cirrgica;
- Seringa descartvel para insulina com agulha 1 mL (13 X 0,45 mm - 26 G1/2);
reta);

- Material cirrgico (pina simples reta, pina dente-de-rato, pinas hemostticas e tesoura
- Lmina de ao para realizar tricotomia ou raspador eltrico;
- Balana analtica;
- PBS;
- Dextran sulfato de sdio (DSS);
- Pentobarbital sdico;

Procedimentos
caixa;
zero).

1. Pesar os animais, identific-los e dividi-los em grupos de, no mximo, 4 indivduos por


2. Iniciar o tratamento com DSS 3,5 % diludo diretamente na gua de beber dos animais (dia
Dica: os animais controle permanecem tendo acesso gua normal;
3. Manter o tratamento com DSS 3,5 % por 8 dias.
Dica: os animais devem ser observados, trocados e pesados diariamente durante o tratamento;

4. No dia 6 de induo da colite, administrar o tratamento com a substncia a ser testada pela
via de escolha.

Biotecnologia

SUMRIO

290

Dica: o esquema de tratamento com a substncia-teste pode variar de acordo com o caso. Aqui
sugerimos um ps-tratamento de dose nica. No entanto, podem ser administradas doses seguidas
a partir do 6 dia at o fim do experimento. Alternativamente, pode-se optar por um esquema de
pr-tratamento administrando a substncia-teste dias antes da induo da colite com DSS;
5. No dia 8, interromper o tratamento com DSS, substituindo-o por gua;
6. No dia 10 sacrificar os animais pela injeo i.p de pentobarbital sdico (50 mg/kg);
7. Dispor o animal na mesa cirrgica em decbito dorsal, prendendo patas e cabea;
8. Realizar a tricotomia da regio abdominal;
9. Realizar uma inciso na regio mediana do abdome (5-6 cm), dissecar e remover o clon
desde o cecum at o reto (para retirar o reto sem romp-lo, necessrio cortar o osso que o protege
na poro final do clon).
Dica: adicionalmente, o bao, linfonodos, mesentrio e sangue podem ser coletados para
anlises posteriores;
10. As fezes presentes nos clons removidos devem ser retiradas, as estruturas lavadas com
PBS e o excesso de tecido conjuntivo adjacente tambm deve ser removido;
11. Pesar os clons limpos, medir o comprimento de cada estrutura e avaliar os danos
macroscpicos, dando ateno particular presena de hiperemia, leses hemorrgicas, lceras e
espessamento ou estreitamento da parede do clon.
Dica: a severidade do dano ao clon pode ser avaliada pela atribuio de um score de dano
que varia de acordo com o grau da leso (exemplos de grade de avaliao de danos podem ser
encontradas em Morris et al., 1989 ou McCafferty et al., 1999).
12. Congelar imediatamente parte do tecido de cada clon em nitrognio lquido para anlise
posterior de citocinas, quimiocinas e outros marcadores moleculares de leso. Outra parte dos
tecidos deve ser reservada em formaldedo tamponado 10 % para anlise histolgica.
Anlise dos Resultados
Neste protocolo, os resultados podem ser expressos de uma srie de maneiras diferentes,
dependendo do direcionamento das anlises. Normalmente, o grau de inflamao colnica e
gravidade da doena desenvolvida determinado pela avaliao do estado geral dos animais, perda
de peso, ndice de mortalidade, scores macroscpicos de leso no clon e alteraes histolgicas
associadas inflamao. Alm disso, citocinas, quimiocinas, xido ntrico e a atividade de algumas
enzimas podem ser dosadas no tecido colnico.
Referncias:
BENTO AF, LEITE DF, MARCON R, CLAUDINO RF, DUTRA RC, COLA M, MARTINI AC, CALIXTO JB. Evaluation
of chemical mediators and cellular response during acute and chronic gut inflammatory response induced by dextran
sodium sulfate in mice. Biochem Pharmacol. 2012 Dec 1;84(11):1459-69.
MCCAFFERTY DM, MIAMPAMBA M, SIHOTA E, SHARKEY KA, KUBES P. Role of inducible nitric oxide synthase
in trinitrobenzene sulphonic acid induced colitis in mice. Gut 1999;45(6):864-73.
MORRIS GP, BECK PL, HERRIDGE MS, DEPEW WT, SZEWCZUK MR, WALLACE JL. Hapten-induced model of
chronic inflammation and ulceration in the rat colon. Gastroenterology 1989;96(3):795-803.
YOSHIDA H, RUSSELL J, GRANGER DN. Thrombin mediates the extraintestinal thrombosis associated with
experimental colitis. Am J Physiol Gastrointest Liver Physiol. 2008; 295(5):G904-8.
YOSHIDA H, RUSSELL J, SENCHENKOVA EY, ALMEIDA PAULA LD, GRANGER DN. Interleukin-1beta mediates
the extra-intestinal thrombosis associated with experimental colitis. Am J Pathol. 2010;177(6):2774-81.

Biotecnologia

SUMRIO

291

CAPTULO 15
QUANTIFICAO E ANLISE DE ATIVIDADE
ENZIMTICA
Jorge Almeida Guimares, Luclia Santi, Markus Berger Oliveira, Walter Orlando Beys da Silva

Enzimas so protenas com atividade cataltica, ou seja, capazes de catalisar uma reao
qumica. As enzimas possuem a capacidade de converter uma substncia (substrato) em outra
(produto). Muitas enzimas so consideradas extremamente especficas, sendo capazes de agir sobre
um nico tipo de substrato. Para se quantificar uma determinada enzima. necessrio utilizar o
substrato especfico para esta. Para dosagem da atividade enzimtica, os mtodos mais amplamente
aplicados baseiam-se, principalmente, na liberao de cor (colorimtrico), de fluorescncia
(fluorescente) ou de luz (quimioluminescente) aps a converso do substrato em produto. A seguir,
veremos alguns protocolos para a quantificao de atividades enzimticas comuns presentes em
amostras biolgicas diversas.

Biotecnologia

SUMRIO

292

15.1 ATIVIDADE PROTEOLTICA: AZOCASENA


Este mtodo baseia-se na determinao da atividade proteoltica por meio da quantificao
do grupamento azo liberado pela hidrlise do substrato cromognico azocasena. A azocasena
um derivado da casena, ao qual foi adicionado um grupo sulfonilamida, que tem colorao
alaranjada. A digesto de uma soluo de azocasena por enzimas proteolticas resulta na formao
de componentes coloridos solveis em cido tricloroactico.
1. Procedimento
Preparo das Solues
1.1. Preparar uma soluo tampo de Tris-HCl 0,05 M, pH 8,0, pela dissoluo de 0,605 g de
Tris em 80 mL de gua destilada. Ajustar o pH com HCl 5 M e completar o volume para 100 mL
com gua destilada;
1.2. Preparar uma soluo de HCl 5M pela adio lenta de 41,8 mL de HCl P.A (cido
clordrico fumegante) em 58,2 mL de gua destilada;
1.3. Preparar uma soluo de azocasena 2%. Para tanto, dissolver 2 g de azocasena em 100
mL de gua destilada. Estocar a 4C por no mximo uma semana.
1.4. Preparar uma soluo de TCA 20%. Para tanto, dissolver 20 g de TCA em 100 mL de
gua destilada e estocar a 4C.
Mtodo do ensaio
1.5. Em um tubo de 2mL, adicionar 200 L de tampo Tris-HCl 0,05M pH 8,0 e 100 L de
azocasena 2%.
Dica: para cada amostra, dever ser feito um tubo considerado o branco da amostra. Para
isso, adicionar a um dos tubos 800L de soluo de TCA 20% antes de iniciar o ensaio;
1.6. Incubar os tubos em banho-maria a 40 C at atingir o equilbrio trmico (aproximadamente
5 minutos).
Dica: a amostra a ser dosada deve ser tambm acondicionada previamente em banho-maria
a 40 C, para atingir o equilbrio trmico antes de ser adicionada ao sistema de reao;
1.7. Adicionar 100 L da amostra a ser testada nos tubos contendo o substrato e incubar por
15 minutos;
1.8. Aps os 15 minutos, adicionar 800 L de TCA 20% a fim de parar a reao;
1.9. Centrifugar os tubos a 10.000 rpm por 5 minutos;
1.10. Medir a absorbncia do sobrenadante em espectrofotmetro utilizando o comprimento
de onda de 440 nm.
Dica: se a amostra for muito concentrada (valor de absorbncia normalmente maior que
0,9 ou acima do limite mximo de leitura recomendado do espectrofotmetro utilizado), diluir a
amostra com tampo 50 mM Tris-HCl, pH 8,0).
2. Anlise dos resultados
2.1. O valor de absorbncia das amostras dever ser multiplicado por 40. Se feita diluio da
amostra, este valor dever ser multiplicado tambm pelo fator de diluio utilizado.
2.2. O resultado deste ensaio definido como Unidades arbitrrias uma vez que o mecanismo
de protelise sobre o substrato pode ocorrer em outros pontos alm do ponto de liberao do grupo
azo, que resulta na formao de cor. Este substrato utilizando uma protena complexada com o

Biotecnologia

SUMRIO

293

grupamento azo um dos ensaios para dosagem de atividade proteoltica mais aplicados e pode
ser realizado com outras protenas ao invs de casena, como colgeno e queratina, por exemplo.
Referncias:
Sangorrn, M.P.; Folco, E.J.; Martone, C.M.; Snchez, J.J 2001. Purification and characterization of a proteinase inhibitor
from white croaker skeletal muscle (Micropogon opercularis). International Journal of Biochemistry and Cell Biology
33:691-699.

Biotecnologia

SUMRIO

294

15.2 ATIVIDADE PROTEOLTICA: TRIPSINA



A tripsina uma serino-proteinase que possui importantes funes fisiolgicas e
fisiopatolgicas. fundamental para o processo digestivo, diferenciao e migrao celular e
tambm est relacionada a uma srie de doenas como pancreatite, inflamao e reaes alrgicas.
Neste protocolo apresentamos um ensaio clssico para a medida da atividade desta enzima. As
principais aplicaes so para estudar a atividade inibitria de diferentes frmacos inibidores de
proteases, extratos ou compostos isolados de plantas. Por utilizar volumes pequenos de reagentes
e ser realizado em microplacas, o protocolo bastante til no screening de inibidores de proteases,
possibilitando o teste de diferentes amostras em um s ensaio e com economia de reagentes. O
ensaio utiliza um substrato especfico para tripsina associado a um grupamento cromgeno
(p-nitroanilina). A reao acontece quando a tripsina reconhece o substrato, cliva entre a arginina e
o grupamento cromgeno, e libera a p-nitroanilina, que um produto de cor amarela. A atividade
da tripsina proporcional quantidade de p-nitroanilina liberada, e pode ser facilmente medida
por espectrofotometria.
1. Procedimento
Curva Padro de p-Nitroanilina
mM.

1.1. Pesar a p-nitroanilina em balana analtica, e preparar de 2 a 5 mL de uma soluo 0,14

Dica: Preparar a soluo de p-nitroanilina no tampo utilizado para o ensaio (Tris-HCl 20


mM, pH 7,4). Para facilitar a dissoluo, pode-se adicionar um pouco de etanol absoluto, mas sem
exceder o volume final. As diluies devem ser feitas diretamente no tampo Tris-HCl 20 mM, pH
7,4;
1.2. Pipetar a soluo de p-nitroanilina e tampo em uma microplaca de 96 poos de fundo
chato, conforme as quantidades indicadas na tabela 1:
Tabela 1: Curva padro de p-nitroanilina
Tampo

p-nitroanilina

p-nitroanilina

[p-nitroanilina] final

(L)
100
97
95
90
80
70
60
50
--

(L)
-3
5
10
20
30
40
50
100

(nmol/ poo)
0
0,36
0,72
1,44
2,88
4,32
5,76
7,2
14,4

(M)
0
4,2
7,2
14,0
28,0
42,0
56,0
70,0
140,0

Poo
1A
1B
1C
1D
1E
1F
1G
1H
2A

Dica: cada ponto da curva deve ser pipetado em triplicata na placa. O volume final de cada
poo deve ser de 100 L.
1.3. Medir a absorbncia em espectrofotmetro de microplacas 405 nm;
1.4. Construir um grfico de regresso linear simples colocando os valores das mdias
aritmticas das leituras de cada ponto nas ordenadas (eixo y) e os valores de quantidade de
p-nitroanilina (nmol/poo) ou a concentrao de p-nitroanilina (M) nas abscissas (eixo x);

Biotecnologia

SUMRIO

295

1.5. Obter a equao da reta na forma de: y = ax + b. Reservar a equao para calcular os
valores de atividade enzimtica posteriormente.
Dica: para a curva ser considerada satistafria, o valor de R deve ser maior ou igual a 0,95.
Ensaio de Atividade Enzimtica da Tripsina
1.6. Preparar uma soluo estoque de 5 mg/mL de tripsina.
Dica: dissolver a tripsina em tampo Tris-HCl 20 mM, pH 7,4, aliquotar em tubos de 1 ou 0,5
mL e manter congelado -20 C;
1.7. Preparar uma soluo de trabalho de tripsina na concentrao de 0,1 mg/mL.
Dica: diluir a partir da soluo estoque usando o tampo Tris-HCl 20 mM, pH 7,4 e aliquotar
em tubos de 1 ou 0,5 mL. At o momento do ensaio manter no gelo (4 C). Aps o ensaio manter
congelado -20 C;
1.8. Preparar 10 mL de uma soluo do substrato BAPNA (Hidrocloreto de N-Benzoil-DLarginina-4-nitroanilida) 10 mM.
Dica: Dissolver o BAPNA em uma soluo contento 9 partes de DMSO para 1 parte de gua
miliQ. Aliquotar o substrato em tubos de 0,5 mL e manter congelado -20 C;
1.9. Pipetar os reagentes na microplaca de 96 poos de fundo chato, conforme o esquema
sugerido na tabela 2:
Tabela 2: Protocolo do ensaio de tripsina
Poo

Identificao da
amostra
L
--Xa

1A
1B
1C

g/poo
--Xa

Tripsina

Substrato

Tampo (L)

90
80
Xa

(0,1 mg/mL) (BAPNA 10 mM, L)


L g/poo
--10
10
1
10
10
1
10

As quantidades e o nmero de amostras a serem testadas devem ser definidas previamente e dependem de
cada experimento.
*

Dicas: O volume final de cada poo deve ser de 100 L;


O volume de substrato e tripsina so fixos. O volume de amostra pode variar. Utilizar o
tampo tris-HCl 20 mM, pH 7,4 para completar o volume final de cada poo para 100 L;
Correr cada uma das amostras em triplicata;
Os reagentes devem ser adicionados na seguinte ordem: 1. Amostra; 2. Tampo T r i s - H C l
20 mM, pH 7,4; 3 tripsina; e, 4 substrato;
Incubar a amostra + tampo + tripsina por 10 minutos 37 C antes da adio do substrato.
1.10. Ler a absorbncia em espectrofotmetro de microplacas 405 nm no tempo inicial - A1
(logo aps a adio do substrato). Incubar a placa 37 C e aps 20 minutos de reao repetir a
leitura no mesmo comprimento de onda - A2 (tempo final).
Dica: se o experimento estiver sendo realizado em um espectrofotmetro capaz de realizar
leituras cinticas, selecionar o modo cintico em 405 nm e realizar leituras sequenciais de 10 em 10
segundos at o tempo final de 20 minutos. Durante todo o tempo da leitura a placa deve permanecer
37 C;
1.11. Calcular a mdia aritmtica de cada uma das amostras e subtrair a absorbncia final da
inicial (A2-A1);

Biotecnologia

SUMRIO

296

1.12. Os valores de A2-A1 correspondem p-nitroanilina liberada durante a reao. Calcular


a quantidade de p-nitroanilina presente em cada poo, utilizando a equao da reta obtida pela
curva padro de p-nitroanilina. Seguir o exemplo abaixo:
A2-A1 = 0,03
Curva padro: y = 0,001 + 0,028X
0,03 - 0,001 = X

X = 1,036 nmol de p-nitroanilina/100 L

0,028
Ou seja, considerando esse exemplo hipottico, a quantidade de p-nitroanilina liberada pela
tripsina por poo (volume de 100 L) foi de 1,036 nmols. Agora esse valor pode ser convertido e
expresso em unidades de atividade enzimtica (nmol de produto formado/minuto/ mL):
1,036 nmol = 0,52 nmols/min/mL
0,1*20
Este valor significa que a tripsina presente no poo foi capaz de gerar 0,52 nmols de
p-nitroanilina por minuto e por mL de reao.
2. Anlise dos Resultados
2.1. Aps realizados todos os clculos conforme indicado acima, os resultados so expressos
pelos valores de atividade enzimtica residual. Ou seja, pela quantidade de p-nitroanilina gerada
por unidade de tempo e por volume de reao. Na presena de um inibidor de serino-proteinases,
a quantidade de p-nitroanilina diminui e, consequentemente, diminui a atividade enzimtica
residual.
Referncias
BATISTA IF, OLIVA ML, ARAUJO MS, SAMPAIO MU, RICHARDSON M, FRITZ H, SAMPAIO CA. Primary
structure of a Kunitz-type trypsin inhibitor from Enterolobium contortisiliquum seeds. Phytochemistry 1996;41(4):101722.
OLIVA ML, MENDES CR, JULIANO MA, CHAGAS JR, ROSA JC, GREENE LJ, SAMPAIO MU, SAMPAIO CA.
Characterization of a tissue kallikrein inhibitor isolated from Bauhinia bauhinioides seeds: inhibition of the hydrolysis of
kininogen related substrates. Immunopharmacology 1999;45(1-3):163-9.
SANTI L, BEYS DA SILVA WO, BERGER M, GUIMARES JA, SCHRANK A, VAINSTEIN MH. Conidial surface
proteins of Metarhizium anisopliae: Source of activities related with toxic effects, host penetration and pathogenesis.
Toxicon 2010, 1;55(4):874-80.

Biotecnologia

SUMRIO

297

15.3 ATIVIDADE PROTEOLTICA: TROMBINA + SUBSTRATO


SINTTICO
A trombina uma serino-proteinase que possui papel fundamental no processo de
coagulao sangunea e agregao plaquetria. Na cascata de coagulao sangunea, a trombina
cliva diretamente o fibrinognio formando a rede de fibrina, ativa o fator V, protena C, protena
S e, por clivar os receptores ativados por proteases (PAR), induz agregao plaquetria, alm de
possuir efeito pr-inflamatrio. Alm disso, desequilbrios nos processos endgenos que controlam
o balano entre ativao e inibio de trombina esto associados a uma srie de patologias; entre
elas, destacam-se: as doenas tromboemblicas, doenas cardiovasculares e renais, acidente
vascular cerebral, isquemias, sepse, coagulao intravascular disseminada e at mesmo cncer.
Neste protocolo, apresentamos um ensaio clssico para a medida da atividade desta enzima
bastante semelhante ao descrito anteriormente para a tripsina. As principais aplicaes so para
estudar a atividade inibitria de diferentes frmacos inibidores de proteases e na pesquisa da
atividade anticoagulante de extratos ou compostos isolados de plantas.
Por utilizar volumes pequenos de reagentes e ser realizado em microplacas, o protocolo
bastante til no screening de anticoagulantes, possibilitando o teste de diferentes amostras em
um s ensaio e com economia de reagentes. O ensaio utiliza um substrato sinttico cromognico
especfico, que se liga diretamente ao stio ativo da trombina, sendo, portanto, ideal para a pesquisa
de inibidores de stio ativo e no de exostio (ver protocolo trombina + fibrinognio). A reao
acontece de maneira semelhante descrita para tripsina, pela liberao de p-nitroanilina, que pode
ser dosada por espectrofotometria.
1. Procedimento
Curva Padro de p-Nitroanilina
1.1. Construir uma curva padro de p-nitroanilina, conforme descrito no protocolo para
tripsina.
Ensaio de Atividade Enzimtica da Trombina
1.2. Preparar uma soluo estoque de 0,3 mg/mL de trombina.
Dica: dissolver a trombina em tampo Tris-HCl 20 mM, pH 7,4, aliquotar em tubos de 1 ou
0,5 mL e manter congelado -20 C;
1.3. Preparar um soluo de trabalho de trombina na concentrao de 0,02 mg/mL.
Dica: diluir a partir da soluo estoque usando o tampo Tris-HCl 20 mM, pH 7,4 e aliquotar
em volumes pequenos em tubos de 0,5 mL. At o momento do ensaio manter no gelo (4 C). Aps o
ensaio manter congelado -20 C;
1.4. Preparar 10 mL de uma soluo do substrato S2238 (H-D-Phe-Pip-Arg-pNa) 2 mM.
Dica: dissolver o S2238 em gua miliQ. Aliquotar o substrato em tubos de 0,5 mL e manter
congelado -20 C;
1.5. Pipetar os reagentes na microplaca de 96 poos, conforme o esquema sugerido na tabela 3:
Tabela 3: Protocolo do ensaio de trombina + substrato sinttico
Identificao da
amostra

Poo

1A
1B

L
---

Biotecnologia

g/poo
---

Trombina

Substrato

Tampo (L)

90
80

(0,02 mg/mL) (S2238 2 mM, L)


L g/poo
--10
10
0,2
10

SUMRIO

298

1C

Xa

Xa

Xa

10

0,2

10

As quantidades e o nmero de amostras a serem testadas devem ser definidas previamente e dependem de
cada experimento.
*

Dicas: O volume final de cada poo deve ser de 100 L;


O volume de substrato e trombina so fixos. O volume de amostra pode variar. Utilizar o
tampo Tris-HCl 20 mM, pH 7,4 para completar o volume final de cada poo para 100 L;
Correr cada uma das amostras em triplicata;
Os reagentes devem ser adicionados na seguinte ordem: 1 Amostra; 2 Tampo Tris-HCl 20
mM, pH 7,4; 3 trombina e 4, substrato;
Incubar a amostra + tampo + trombina por 10 minutos 37 C antes da adio do substrato.
1.6. Ler a absorbncia em espectrofotmetro de microplacas 405 nm no tempo inicial - A1
(logo aps a adio do substrato). Incubar a placa 37 C e aps 30 minutos de reao repetir a
leitura no mesmo comprimento de onda - A2 (tempo final).
Dica: se o experimento estiver sendo realizado em um espectrofotmetro capaz de realizar
leituras cinticas, selecionar o modo cintico em 405 nm e realizar leituras sequenciais de 10 em 10
segundos at o tempo final de 30 minutos. Durante todo o tempo da leitura, a placa deve permanecer
37 C;
1.7. Calcular a mdia aritmtica de cada uma das amostras e subtrair a absorbncia final da
inicial (A2-A1);
1.8. Os valores de A2-A1 correspondem a p-nitroanilina liberada durante a reao. Calcular
a quantidade de p-nitroanilina presente em cada poo utilizando a equao da reta obtida pela
curva padro de p-nitroanilina, seguindo o mesmo exemplo descrito anteriormente para tripsina
e expressar o resultado final como quantidade de produto formado/ minuto/ volume de reao
(nmol /minuto/ mL).
2. Anlise dos Resultados
2.1. Aps realizados todos os clculos conforme indicado acima, os resultados so expressos
pelos valores de atividade enzimtica residual. Ou seja, pela quantidade de p-nitroanilina gerada por
unidade de tempo e por volume de reao. Na presena de um inibidor de trombina a quantidade
de p-nitroanilina diminui e, consequentemente, diminui a atividade enzimtica residual.
Referncias:
BERGER M, RECK J JR, TERRA RM, PINTO AF, TERMIGNONI C, GUIMARES JA: Lonomia obliqua caterpillar
envenomation causes platelet hypoaggregation and blood incoagulability in rats. Toxicon 2010; 55:3344.
FRANCISCHETTI IM, MONTEIRO RQ, GUIMARES JA: Identification of glycyrrhizin as a thrombin inhibitor.
Biochem Biophys Res Commun 1997; 235:259263.
MOZZICAFREDDO M, CUCCIOLONI M, ELEUTERI AM, FIORETTI E, ANGELETTI M. Flavonoids inhibit the
amidolytic activity of human thrombin. Biochimie. 2006 Sep; 88(9):1297-306.

Biotecnologia

SUMRIO

299

15.4 ATIVIDADE PROTEOLTICA: TROMBINA + FIBRINOGNIO


O protocolo apresentado a seguir, assim como o anterior, til na pesquisa de anticoagulantes
inibidores de trombina. A diferena que este protocolo utiliza o fibrinognio como substrato para
a trombina. O fibrinognio o substrato macromolecular natural da trombina. Diferentemente do
substrato sinttico cromognico, que possui menor massa molecular e especificidade direta para
o stio ativo, a clivagem do fibrinognio dependente da ligao deste no exostio-1 da trombina.
Portanto, o uso do fibrinognio como substrato tem principal aplicao no estudo do mecanismo
molecular de inibio e na busca por inibidores especficos de exostio-1. A reao acontece pela
clivagem do fibrinognio pela trombina com a formao do cogulo de fibrina. Como a fibrina
um produto insolvel, a sua formao no meio de reao pode ser facilmente medida pelo aumento
da turbidez.
1. Procedimento
1.1. Pesar, em balana analtica, exatamente 0,005 g de fibrinognio;
1.2. Manter o fibrinognio pesado, o tampo Tris-HCl 20 mM, pH 7,4 e uma soluo de BSA
1 mg/mL 37 C antes de dissolver o fibrinognio;
1.3. Estando todas as solues 37 C, adicionar ao fibrinognio 994 L do tampo Tris-HCl
20 mM, pH 7,4 e 6 L de albumina 1 mg/mL;
1.4. Agitar levemente e manter a soluo em banho-maria 37 C - at a completa dissoluo
do fibrinognio;
1.5. Aps a dissoluo, a soluo de fibrinognio instvel e no deve sofrer mudanas
bruscas de temperatura.
Dica: a soluo de fibrinognio no deve ser reutilizada;
1.6. Preparar uma soluo estoque de 0,3 mg/mL de trombina.
Dica: dissolver a trombina em tampo Tris-HCl 20 mM, pH 7,4, aliquotar em tubos de 1 ou
0,5 mL e manter congelado -20 C;
1.7. Preparar uma soluo de trabalho de trombina na concentrao de 0,02 mg/mL.
Dica: diluir a partir da soluo estoque usando o tampo Tris-HCl 20 mM, pH 7,4 e aliquotar
em volumes pequenos em tubos de 0,5 mL. At o momento do ensaio, manter no gelo (4 C). Aps
o ensaio, manter congelado -20 C;
1.8. Pipetar os reagentes na microplaca de 96 poos conforme o esquema sugerido na tabela

4:

Tabela 4: Protocolo do ensaio de trombina + fibrinognio


Poo

1A
1B
1C

Identificao da amostra
L
--Xa

g/poo
--Xa

Trombina

Substrato

(0,02 mg/mL)
L
g/poo
--10
0,2
10
0,2

(Fibrinognio 5 mg/mL, L)

Tampo (L)

60
50
Xa

40
40
40

As quantidades e o nmero de amostras a serem testadas devem ser definidas previamente, e dependem de
cada experimento.
*

Dicas: O volume final de cada poo deve ser de 100 L;

Biotecnologia

SUMRIO

300

O volume de substrato e trombina so fixos. O volume de amostra pode variar. Utilizar o


tampo Tris-HCl 20 mM, pH 7,4 para completar o volume final de cada poo para 100 L;
Correr cada uma das amostras em triplicata;
Os reagentes devem ser adicionados na seguinte ordem: 1 Amostra; 2 Tampo Tris-HCl 20
mM, pH 7,4; 3 trombina e 4 substrato;
Incubar a amostra + tampo + trombina por 10 minutos 37 C antes da adio do substrato.
1.9. Ler a absorbncia em espectrofotmetro de microplacas 650 nm no tempo inicial - A1
(logo aps a adio do substrato). Incubar a placa 37 C e aps 30 minutos de reao repetir a
leitura no mesmo comprimento de onda - A2 (tempo final).
Dica: se o experimento estiver sendo realizado em um espectrofotmetro capaz de realizar
leituras cinticas, selecionar o modo cintico em 650 nm e realizar leituras sequenciais de 14 em 14
segundos at o tempo final de 30 minutos. Durante todo o tempo da leitura a placa deve permanecer
37 C;
1.10. Calcular a mdia aritmtica de cada uma das amostras e subtrair a absorbncia final da
inicial (A2-A1);
1.11. Os valores de A2-A1 correspondem a fibrina formada durante a reao. Os resultados
podem ser expressos como unidades arbitrrias de absorbncia por tempo de reao (OD/min).
Para tanto, basta calcular a razo entre os valores de A2-A1 e o tempo total do ensaio (30 minutos).
2. Anlise dos Resultados
2.1. Os resultados podem ser apresentados como atividade residual de trombina em OD/
min (conforme indicado acima) ou tambm como percentual de inibio de trombina. Nesse ltimo
caso, considera-se como 100 % a atividade da trombina na ausncia da amostra testada e calcula-se
o percentual de inibio comparando a atividade da trombina na presena da amostra contendo o
inibidor. Obviamente, na presena de um inibidor de trombina a quantidade de fibrina formada
diminui, diminui tambm a turbidez do meio de reao e atividade enzimtica residual e aumenta
o percentual de inibio.
Referncias:
BERGER M, RECK J JR, TERRA RM, PINTO AF, TERMIGNONI C, GUIMARES JA: Lonomia obliqua caterpillar
envenomation causes platelet hypoaggregation and blood incoagulability in rats. Toxicon 2010;55:3344.
FRANCISCHETTI IM, MONTEIRO RQ, GUIMARES JA: Identification of glycyrrhizin as a thrombin inhibitor.
Biochem Biophys Res Commun 1997;235:259263
RIBEIRO JM, SCHNEIDER M, GUIMARES JA. Purification and characterization of prolixin S (nitrophorin 2), the
salivary anticoagulant of the blood-sucking bug Rhodnius prolixus. Biochem J. 1995 15;308 ( Pt 1):243-9.

Biotecnologia

SUMRIO

301

15.5 ATIVIDADE LIPOLTICA, LIPASE: TITULAO DE CIDOS


GRAXOS
Lipases so enzimas que hidrolisam lipdeos, principalmente triglicerdeos. Este mtodo se
baseia na neutralizao dos cidos graxos liberados pela reao de hidrlise da triolena (ou leo de
oliva, rico em triolena) catalisada por estas enzimas (Figura 1).
Figura 1. Reao de hidrlise de triglicerdeos.

1. Procedimento
Preparo das solues
1.1. Preparar uma soluo tampo de Tris-HCl 0,05 M, pH 8,0. Para tanto, dissolver 0,605 g
de Tris em 80 mL de gua destilada, ajustar o pH com HCl 5 M e completar o volume para 100 mL
com gua destilada;
1.2. Preparar uma soluo de HCl 5M pela adio lenta de 41,8 mL de HCl P.A. (cido
clordrico fumegante) em 58,2 mL de gua destilada;
1.3. Preparar uma soluo de fenolftalena 1 %, dissolvendo 1 g de fenolftalena em 60 mL de
etanol e completando o volume com gua destilada at 100 mL;
1.4. Preparar uma soluo de hidrxido de sdio 0,05 M (NaOH). Para tanto, dissolver 0,2 g
de NaOH em gua destilada e completar o volume para 100mL;
1.5. Preparar uma soluo de lcool polivinlico 2%, pela dissoluo de 2 g de lcool
polivinlico em 100 mL de gua destilada;
1.6. Preparar uma mistura de 50 mL de etanol + 50 mL de acetona, homogeinizar e manter a
temperatura ambiente (soluo de parada da titulao).
Mtodo do ensaio
1.7. Em um erlenmeyer de 250 mL, adicionar 2,5 mL de tampo TRIS-HCl 0,05M pH 8,0, 1
mL de triolena (pode ser usado leo de oliva) e 2 mL de lcool polivinlico 2 %;
1.8. Incubar em agitador orbital (shaker) 37 oC, 150 rpm por 1 min para atingir o equilbrio
trmico.
Dica: a amostra tambm deve estar no equilbrio trmico antes de ser adicionada ao sistema
de reao;
1.9. Adicionar 1 mL da amostra a ser testada.
Dica: para o frasco a ser lido como branco, adiciona-se 1 mL de gua ou tampo TRIS-HCl
0,05 M, pH 8,0 ao invs da amostra;
1.10. Incubar por 30 minutos, 150 rpm 37oC;

Biotecnologia

SUMRIO

302

1.11. Parar a reao adicionando 10 mL da soluo de parada;


1.12. Adicionar 1 mL fenolftalena (indicador de pH);
1.13. Titular o cido graxo liberado com o auxlio de uma bureta graduada e calibrada
contendo 0,05 M NaOH at obter o primeiro tom de colorao rsea.
Dicas: os frascos devero ser agitados manualmente enquanto o NaOH gotejado.
Anotar o volume de NaOH adicionado no primeiro surgimento da cor rsea significante (toda
soluo dever ficar rsea mesmo que brevemente), uma vez que a colorao tende a desaparecer.
Anlise dos Resultados
2.1. Uma unidade lipoltica definida como a quantidade de enzima que libera 1 mmol de cidos
graxos por minuto, sob as condies descritas acima.
2.2. Clculo:
U = (V-Vo) * 50 * fd

30
Dicas: muito importante agitar fortemente, pois a cor tende a surgir no microambiente onde
for gotejada a base, e a quantificao correta (momento de parar de adicionar a base) baseada na
cor rosa formada na soluo, e no em uma parte da mesma. Pode ser usado qualquer leo ou
gordura como substrato, mas a triolena (ou leo de oliva em sua substituio) considerada um
padro para quantificao de lipases verdadeiras.
Referncias:
BEYS DA SILVA, W. O., SANTI, L., BERGER, M., PINTO, A.F.M., GUIMARES, J.A., SCHRANK, A., VAINSTEIN,
M.H. (2009) Characterization of a spore surface lipase from the biocontrol agent Metarhizium anisopliae. Process
Biochemistry 44: 829834
SANTI L, BEYS DA SILVA WO, BERGER M, GUIMARES JA, SCHRANK A, VAINSTEIN MH. Conidial surface
proteins of Metarhizium anisopliae: Source of activities related with toxic effects, host penetration and pathogenesis.
Toxicon 2010, 1;55(4):874-80.

Biotecnologia

SUMRIO

303

15.6 ATIVIDADE LIPOLTICA, LIPASE: P-NITROFENIL-PALMITATO


Este mtodo baseia-se na hidrlise do substrato cromognico p-nitrofenil-palmitato (pNPP)
pela lipase com consequente liberao do composto de colorao amarela p-nitrofenol, conforme
demonstrado na figura 2.
Figura 2. Reao de hidrlise do substrato pNPP com liberao do composto de colorao amarela p-nitrofenol.

cido graxo

pNPP p-Nitrofenol
1. Procedimento
Preparo das solues
1.1. Preparar uma soluo tampo de TRIS-HCl 0,05 M, pH 8,0, pela dissoluo de 0,605 g de
TRIS em 80 mL de gua destilada. Ajustar o pH com HCl 5 M e completar o volume para 100 mL
com gua destilada;
1.2. Soluo 1: Preparar uma soluo a 3 mg/mL do substrato NPP. Dissolver o pNPP em
isopropanol, incubar 37oC at a completa dissoluo, antes do uso, e estocar -20oC. Estabilidade
no freezer: de 1 ms ou at 2 incubaes 37oC
1.3. Soluo 2: Em 450 mL de Tris-HCl 0,05 M, pH 8,0 adicionar 0,5 g de goma arbica e 2 g de
Triton X-100. Dissolver e estocar na geladeira. Estabilidade: de 3 semanas.
1.4. Emulso: Equilibrar as solues 1 e 2 em banho-maria 37oC por cerca de 10 minutos,
gotejar vagarosamente a soluo 1 na Soluo 2 sob forte agitao, na proporo de 1:9 (a cada 9 mL
da Soluo 2 adicionar 1 mL da Soluo 1).
Dicas: utilizar um agitador magntico para preparar a emulso. Esta emulso deve ser
preparada sempre no momento do ensaio, no podendo ser armazenada para uso posterior.
Curva Padro de p-Nitrofenol
mM.

1.5. Pesar o p-nitrofenol em balana analtica e preparar de 2 a 5 mL de uma soluo a 0,14

Dica: Preparar a soluo de p-nitrofenol no tampo Tris-HCl 0,05 M, pH 8,0 porque a cor
somente gerada em pH alcalino. Para facilitar a dissoluo pode-se adicionar um pouco de etanol
absoluto, mas sem exceder o volume final. As diluies devem ser feitas diretamente no tampo
Tris-HCl 0,05 M, pH 8,0;
1.6. Pipetar a soluo de p-nitrofenol e tampo em uma microplaca de 96 poos de fundo
chato, conforme as quantidades indicadas na tabela 5.

Biotecnologia

SUMRIO

304

Tabela 5: Curva Padro de p-Nitrofenol


Tampo p-nitrofenol p-nitrofenol
Poo
1A
1B
1C
1D
1E
1F
1G
1H
2A

(L)

(L)

(nmol/ poo)

100
97
95
90
80
70
60
50
--

-3
5
10
20
30
40
50
100

0
0,36
0,72
1,44
2,88
4,32
5,76
7,2
14,4

[p-nitrofenol]
final
(M)
0
4,2
7,2
14,0
28,0
42,0
56,0
70,0
140,0

Dica: Cada ponto da curva deve ser pipetado em triplicata na placa. O volume final
cada poo deve ser de 100 L.

de

1.7. Medir a absorbncia em espectrofotmetro de microplacas 410 nm;


1.8. Construir um grfico de regresso linear simples, colocando os valores das mdias
aritmticas das leituras de cada ponto nas ordenadas (eixo y), e os valores de quantidade de
-nitrofenol (nmol/poo) ou a concentrao de -nitrofenol (M) nas abscissas (eixo x);
1.9. Obter a equao da reta na forma de: y = ax + b. Reservar a equao para calcular os
valores de atividade enzimtica posteriormente.
Mtodo do ensaio
chato;

1.10. Adicionar 10 L da amostra a ser testada em uma microplaca de 96 poos de fundo

1.11. Adicionar 90 L da emulso (previamente equilibrada 37oC por 5 minutos, assim


como a amostra);
Dica: importante ressaltar que tanto a emulso de substrato quanto a amostra devem estar
previamente equilibradas na temperatura do ensaio, para evitar interferncia na leitura, visto que o
substrato insolvel e est na forma de emulso.
1.12. Medir a absorbncia em espectrofotmetro de microplacas a 410 nm no tempo inicial A1 (logo aps a adio da emulso). Incubar a placa 37 C e, aps 30 minutos de reao, repetir a
leitura no mesmo comprimento de onda - A2 (tempo final);
Dica: agitar rapidamente a placa antes da primeira e ltima leitura.
1.13. Calcular a mdia aritmtica de cada uma das amostras e subtrair a absorbncia final da
inicial (A2-A1);
1.14. Os valores de A2-A1 correspondem ao p-nitrofenol liberado durante a reao. Calcular
a quantidade de p-nitrofenol presente em cada poo utilizando a equao da reta obtida pela curva
padro de p-nitrofenol;
2. Anlise dos Resultados
2.1. Os resultados so expressos como atividade de lipase por meio da quantidade de
p-nitrofenol liberada por minuto por volume de reao (mol/mL/min/). Seguir o mesmo mtodo
de clculo ao descrito anteriormente para a atividade de tripsina (ver exemplo acima).

Biotecnologia

SUMRIO

305

Dica: existem outros substratos do tipo p-nitrofenil-steres que podem ser utilizados
praticamente da mesma maneira. O substrato sinttico para lipase mais utilizado o p-nitrofenilpalmitato.
Referncias:
SILVA WOB, MITIDIERI S, SCHRANK A, VAINSTEIN MH. (2005). Production and extraction of an extracellular
lipase from the entomopathogenic fungus Metarhizium anisopliae. Process Biochemistry 40: 321326.
BEYS DA SILVA, W. O., SANTI, L., BERGER, M., PINTO, A.F.M., GUIMARES, J.A., SCHRANK, A., VAINSTEIN,
M.H. (2009) Characterization of a spore surface lipase from the biocontrol agent Metarhizium anisopliae. Process
Biochemistry 44: 829834.

Biotecnologia

SUMRIO

306

15.7 ATIVIDADE AMILOLTICA


Este mtodo baseia-se na determinao da atividade amiloltica pela quantificao dos
acares redutores, liberados pela reao de hidrlise do amido catalisada por amilases.
1. Procedimentos
Preparo das solues
1.1. Preparar uma soluo de cido ctrico 0,05 M. Dissolver 1,05 g de cido ctrico em 100 mL
de gua destilada;
1.2. Preparar uma soluo de fosfato de sdio dibsico (NaH2PO4) 0,05 M. Para isso, dissolver
1,38 g de fosfato de sdio em 100 mL de gua destilada;
1.3. Preparar uma soluo tampo de citrato-fosfato 0,05 M, pH 6,0. Em uma proveta de 50
mL, adicionar 13,4 mL de cido ctrico 0,05 M e completar o volume com fosfato de sdio dibsico
0,05M. Corrigir o pH com uma soluo de cido fosfrico (H3PO4) 1:1 (v/v) e estocar a soluo
4C;
1.4. Preparar uma soluo de amido solvel 1%. Para isso, dissolver 1 g de amido em 100
mL de gua destilada, aquecer at a fervura, esfriar e completar o volume novamente para 100 mL.
Estocar 4C por no mximo uma semana;
1.5. Preparar uma soluo padro de glicose 1 %, pela dissoluo de 1 g de glicose em 100 mL
de gua destilada;
1.6. Preparar uma soluo de cido 3,5-dinitrosaliclico (DNS). Para isso, adicionar 236 mL
de gua destilada os seguintes reagentes: 3 g de hidrxido de sdio, 51 g de tartarato de sdio e
potssio, 1,38 g de metabissulfito de sdio, 0,63 g de fenol e 1,77 g de cido 3,5-dinitrosaliclico.
Curva Padro de Glicose
1.7. Construir uma curva padro de glicose conforme indicado na tabela 6.
Tabela 6. Curva padro de glicose.
Tubo
N
0
1
2
3
4
5
6
7

Soluo de glicose
1%
(L)
0
20
40
60
80
100
120
140

Volume de
gua
(L)
300
280
260
240
220
200
180
160

Conc. final de
glicose
(mol)
0
1,112
2,224
3,336
4,448
5,560
6,672
7,784

1.8. Adicionar 300 L de tampo citrato-fosfato 0,05 M, pH 6,0 e incubar em banho-maria


40 C por 30 minutos;
1.9. Adicionar 1,5 mL de reagente DNS;
1.10. Em seguida ferver por 5 minutos em banho-maria;
1.11. Adicionar 17,9 mL de gua destilada;
1.12. Resfriar em temperatura ambiente e medir a absorbncia em espectrofotmetro a 550
nm;
1.13. Colocar os dados em uma curva de quantidade de glicose (mmol) X absorbncia. Utilizar
o primeiro ponto como zero.

Biotecnologia

SUMRIO

307

Dicas: A concentrao de acares redutores ser expressa em mmol de glicose.


A faixa de concentrao da curva de calibrao poder variar para se ajustar s concentraes
encontradas nas amostras analisadas.
Ensaio de Atividade Amiloltica
1.14. Em um tubo de ensaio de cerca de 25 mL com tampa, adicionar 200 L de tampo
citrato-fosfato 0,05 M e 300 L de soluo de amido solvel 1%;
1.15. Incubar em banho-maria 40 C e deixar atingir o equilbrio trmico (aproximadamente
de 1 a 2 minutos);
1.16. Adicionar 100 L da amostra a ser testada e deixar no banho por 30 minutos na mesma
temperatura. Essa sequncia deve ser seguida para os tubos seguintes em intervalos de tempo
previamente estipulados (15 a 30 segundos);
1.17. Parar a reao adicionando 1,5 mL de reagente DNS, observando os intervalos
estipulados (15 a 30 segundos) para que o tempo de reao (30 minutos) seja o mesmo em todos os
tubos;
1.18. Em seguida ferver por 5 minutos em banho-maria e adicionar 17,9 mL de gua destilada;
1.19. Resfriar e medir a absorbncia em espectrofotmetro a 550 nm;
1.20. Determinar a concentrao de acares redutores utilizando a curva de calibrao de
glicose. Dica: Se necessrio, realizar diluio da amostra em tampo citrato-fosfato 0,05 M, pH 6,0.
2. Anlise dos Resultados
2.1. Com o auxlio da curva padro (equao da reta do tipo y = Ax + b), determinar a
quantidade (mmol) de acares redutores liberada na presena das amostras;
2.2. Converter a quantidade de glicose calculada anteriormente em atividade amiloltica,
usando a frmula abaixo. Clculo do resultado:
Atividade amiloltica (U.mL-1.min-1) =

AR * 10 * fd

30
Onde AR = concentrao de acares redutores na amostra (mmol), determinada por meio
da curva de calibrao de glicose.
fd = fator de diluio da amostra, quando houver.
Uma unidade de Atividade Amiloltica definida como a quantidade de enzima que libera 1
mmol de acares redutores por mL de amostra por minuto, sob condies padres aqui descritas.
Referncias:
MILLER, G.L. Use of dinitosalicylic acid reagent for the determination of reducing sugar. Analytical Chemistry. v.31,
p. 426-428, 1959.

Biotecnologia

SUMRIO

308

15.8 ATIVIDADE CELULSICA


Celulases so enzimas que catalisam a hidrlise de celulose, biomassa mais abundante
no planeta. Devido estrutura complexa da celulose, diferentes celulases so necessrias para
degradar completamente o polmero e liberar glicose. O ensaio de celulase pode ser feito com
substratos mais complexos, como bagao de cana-de-acar e outras biomassas vegetais e papel,
onde so requeridas diferentes tipos de celulases, ou com substratos mais especficos, identificando
apenas um tipo de celulase. Este protocolo descreve, portanto, o ensaio utilizando papel filtro, onde
possvel a deteco de atividade celulsica resultante de diferentes enzimas celulolticas.
1. Procedimento
Preparo das solues
1.1. Preparar uma soluo de cido ctrico 0,05 M. Dissolver 1,05 g de cido ctrico em 100 mL
de gua destilada;
1.2. Preparar uma soluo de fosfato de sdio dibsico (NaH2PO4) 0,05 M. Para isso, dissolver
1,38 g de fosfato de sdio em 100 mL de gua destilada;
1.3. Preparar uma soluo tampo de citrato-fosfato 0,05 M, pH 6,0. Em uma proveta de 50
mL, adicionar 13,4 mL de cido ctrico 0,05 M e completar o volume com fosfato de sdio dibsico
0,05M. Corrigir o pH com uma soluo de cido fosfrico (H3PO4) 1:1 (v/v) e estocar a soluo
4C;
1.4. Preparar uma soluo padro de glicose 5 mg/mL em gua destilada;
1.5. Preparar uma soluo de cido 3,5-dinitrosaliclico (DNS). Para isso, adicionar a 236 mL
de gua destilada os seguintes reagentes: 3 g de hidrxido de sdio, 51 g de tartarato de sdio e
potssio, 1,38 g de metabissulfito de sdio, 0,63 g de fenol e 1,77 g de cido 3,5-dinitrosaliclico.
Curva Padro de Glicose
1.6. Construir uma curva padro de glicose conforme indicado na tabela 7. Pipetar os volumes
indicados em tubos de ensaio de 25 mL;
Tabela 7. Curva padro de glicose.
Glicose 5 mg/
mL (mL)
0
0.05
0.1
0.15
0.2
0.25
0.3
0.35
0.4
0.45
0.5

Tampo citrato
(mL)
0.5
0.45
0.4
0.35
0.3
0.25
0.2
0.15
0.1
0.05
0

Glicose
(mg/mL)
0
0.5
1
1.5
2
2.5
3
3.5
4
4.5
5

Glicose
(mol)
0
1.38
2.77
4.16
5.49
6.86
8.23
9.6
10.97
12.34
13.71

1.7. Incubar os tubos 50 C por 1 hora;


1.8. Adicionar 3 mL da soluo de DNS, ferver por 5 minutos, adicionar 20 mL de gua
destilada e homogeneizar;
1.9. Resfriar em temperatura ambiente e determinar a absorbncia em espectrofotmetro a 540 nm;

Biotecnologia

SUMRIO

309

1.10. Colocar os dados em uma curva de quantidade de glicose (mmol) X absorbncia. Utilizar
o primeiro ponto como zero.
Dicas: a concentrao de acares redutores ser expressa em mmol de glicose. A faixa de
concentrao da curva de calibrao poder variar para se ajustar as concentraes encontradas nas
amostras analisadas.
Ensaio de Atividade Celulsica
1.11. Utilizando tubos de ensaio de 25 mL, adicionar 1 mL de tampo citrato, 0,5 mL da
amostra a ser testada e uma tira de papel Whatman n.1 (1 x 6 cm).
Dicas: preparar tambm dois tubos adicionais: Tubo B1 (branco da amostra) - adicionar 1 mL
de tampo citrato + 0,5 mL de amostra. Tubo B2 (branco total) - adicionar 1,5 mL de tampo citrato
+ uma tira de papel Whatman n.1 (1 x 6 cm)
1.12. Incubar os tubos 50 C por 1 hora;
1.13. Adicionar 3 mL da soluo de DNS, ferver por 5 minutos, adicionar 20 mL de gua
destilada e homogeneizar;
1.14. Resfriar em temperatura ambiente e determinar a absorbncia em espectrofotmetro a
540 nm;
1.15. Determinar a concentrao de glicose liberada utilizando a curva de calibrao de
glicose.
Dica: Se necessrio, realizar diluio da amostra em tampo citrato.
2. Anlise dos Resultados
2.1. Com o auxlio da curva padro (equao da reta do tipo y = Ax + b), determinar a
quantidade (mmol) de glicose liberada na presena das amostras;
2.2. Converter a quantidade de glicose calculada anteriormente em atividade celulsica,
usando a frmula abaixo. Clculo do resultado:
Atividade celulsica (U= mol.mL-1.min-1)

AR*2*fd

60
Onde: AR = concentrao de acares redutores (glicose) na amostra (mmol), determinada
atravs da curva de calibrao de glicose.
fd = fator de diluio, quando houver
Uma unidade (U) de atividade celulsica foi definida como 1 mol de glicose liberada por
mL por min, sendo expressa em FPU (filter paper unit ou unidade de papel filtro).
Referncias:
GHOSE, 1987. Measurement of cellulase activities. IUPAC - Pure and Applied Chemistry, 59: 257-268

Biotecnologia

SUMRIO

310

CAPTULO 16
DETECO DE ATIVIDADE ENZIMTICA ATRAVS
DE GIS DE ATIVIDADE/ZIMOGRAMAS
Jorge Almeida Guimares, Luclia Santi, Markus Berger Oliveira, Walter Orlando Beys da Silva

Diversas metodologias so conhecidas e empregadas para os zimogramas, podendo


ser totalmente nativos (sem causar nenhum dano estrutural s protenas/enzimas) ou pouco
desnaturantes (com renaturao posterior da protena a ser analizada). Tudo depende do tipo
de enzima a ser analisada. Na maioria das vezes, algum substrato para a enzima adicionado
diretamente no gel ou em um tampo de renaturao. Os gis de atividade ou zimogramas so uma
forma fcil de avaliar o tipo de protena presente em uma amostra, bem como identificando sua
massa molecular, normalmente, na forma nativa.

Biotecnologia

SUMRIO

311

16.1 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE


QUITINASES (ST LEGER ET AL. 1993)

Quitinases so enzimas que catalizam a hidrlise de quitina, polmero formado
pelo acar N-acetil-glicosamina (NaG), presente em exoesqueleto de insetos e crustceos. Este
gel considerado no desnaturante, embora utilize SDS em sua composio. O SDS removido
posteriormente e a enzima, recuperando sua forma nativa, pode agir em seu substrato (adicionado
matriz de poliacrilamida).
1. Montagem do gel
1.1 Muito parecida com o gel SDS-PAGE, descrito no captulo 6.
1.2 No caso deste gel, adicionado glicol-quitina como substrato para a enzima.
Running 12,5%
H2O destilada
1,5M tris HCl pH 8,8
SDS 10%
Glicol quitina 1%
Acrilamida/bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

3,05 mL
2,5 mL
100 L
100 L
4,2 mL
5 L
50 L

Stacking 4%
H2O destilada
0,5M tris HCl pH 6,8
SDS 10%
Acrilamida/bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

3,05 mL
1,25 mL
50 L
660 L
5 L
25 L

2. Preparao da amostra:
2.1 O volume de amostra a ser carregado no gel de aproximadamente 20L, sendo 10 L de
amostra e 10 L de tampo de amostra.
2.2 Manter os eppendorfs 100oC por 3 minutos (ou 95oC por 10 minutos)
2.3 Deixar esfriar a temperatura ambiente
2.4 Centrifugar as amostras por 3 minutos a 12.000 rpm
2.5 Aplicar no gel
3. Separao da amostra (eletroforese)
3.1 Idem ao gel SDS-PAGE
3.2 O gel dever ser migrado a uma voltagem de 150 volts (por aproximadamente 1 hora e 30
minutos 2 horas).

Biotecnologia

SUMRIO

312

Tampo de amostra
H2O destilada
0,5M tris HCl pH 6,8
SDS 10%
Glicerol
Azul de bromofenol
1%

3,8 mL
1 mL
1,6 mL
0,8 mL
0,4 mL

Tampo de corrida 5X*


Tris
15 g
Glicina
72 g
SDS
5g
H2O destilada q.s.p.
1L
*diluir para 1X na hora do uso com gua destilada. Manter na geladeira. Pode ser utilizado at 4 vezes.

4. Deteco de quitinases
4.1 Aps a eletroforese, remover o gel da cuba e acondicionar em um recipiente
4.2 Incubar o gel com 100 mL tampo acetato 100mM pH 5,3 com Triton X-100 1% (1 mL/99
mL tampo acetato) por 20 horas 30oC, com agitao.
4.3 Corar o gel com soluo de calcofluor White M2R 0,01% em 0,5M tris-HCl pH 8,9 por 10
minutos.
4.4 Descorar com gua destilada (3 x 10 minutos) e avaliar se necessita mais
4.5 Visualizar em aparelho com luz ultravioleta (UV)
Tampo acetato 100 mM pH 5.3
0,2 M cido actico
0,2 M acetato de sdio
H2O destilada q.s.p.

8,8 mL
41,2 mL
50 mL

cido actico 0,2 M


cido actico
H2O destilada q.s.p.

1,15 mL
10 mL

5. Glicol-quitina (Trudel & Asselin, 1989)


5.1 Em um graal de porcelana macerar 1 g de glicol-quitosan com o auxlio de nitrognio
lquido
5.2 Adicionar 100 mL de cido actico 10% (v/v) e incubar por 16 horas a temperatura
ambiente.
5.3 Aps esse perodo, adicionar vagarosamente 30 mL de metanol e filtrar a soluo obtida a
vcuo em papel Whatman no1. Fazer isso em capela de exausto.
5.4 Adicionar ao filtrado 7,5 mL de anidrido actico, sob agitao, e deixar solidificar por 30
minutos a temperatura ambiente.
5.5 Quebrar o gel obtido em pedaos e colocar 1 volume de metanol. Triturar em liquidificador
durante 4 minutos.
5.6 Lavar a suspenso com metanol e centrifugar a 12.000 rpm por 15 minutos.
5.7 Lavar diversas vezes com gua destilada at a neutralizao do pH.

Biotecnologia

SUMRIO

313

5.8 Ressuspender o sedimento em 1 volume de gua destilada e estocar -20oC. Esta uma
soluo estoque de 1%.
Referncias:
ST LEGER, R.J.; STAPLES, R.C.; ROBERTS, D.W. 1993. Entomopathogenic Isolates of Metarhizium anisopliae, Beauveria
bassiana, and Aspergillus flavus Produce Multiple Extracellular Chitinase Isozymes. Journal of Invertebrate Pathology
61:81-84.
TRUDEL, J.; ASSELIN, A. 1989. Detection of chitinase activity after polyacrylamide gel electrophoresis. Analytical
Biochemistry 178:362-366. Trudel, J.; Asselin, A. 1989. Detection of chitinase activity after polyacrylamide gel
electrophoresis. Analytical Biochemistry 178:362-366.

Biotecnologia

SUMRIO

314

16.2 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE


PROTEASES (MODIFICADO DE ST LEGER ET AL. 1993)
Proteases so enzimas que hidrolisam protenas. Diversas classes de proteases podem ser
encontradas, dependendo de suas caractersticas. Portanto, diversos protocolos so descritos para
zimogramas de proteases. Este protocolo, assim como o protocolo para quitinases, utiliza SDS em
sua composico que, posteriormente, dever ser removido para que a enzima recupere sua forma
nativa e possa hidrolisar o substrato.
1. Montagem do gel
Running 12%
H2O destilada
1,5M tris HCl pH 8,8
SDS 10%
Gelatina 1%
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

2,35 mL
2,5 mL
100 L
1 mL
4 mL
5 L
50 L

Stacking 4%
H2O destilada
0,5M tris HCl pH 6,8
SDS 10%
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

3,05 mL
1,25 mL
50 L
660 L
5 L
25 L

2. Preparao da amostra:
2.1 O volume de amostra a ser carregado no gel de aproximadamente 20 L, sendo 10 L
de amostra e 10 L de tampo de amostra.
2.2 Manter os eppendorfs 100oC por 3 minutos (ou 95oC por 10 minutos)
2.3 Deixar esfriar a temperatura ambiente
2.4 Centrifugar as amostras por 3 minutos a 12.000 rpm
2.5 Aplicar no gel
2.6 Separao da amostra (eletroforese)
2.7 Idem ao gel SDS-PAGE
2.8 O gel dever ser corrido a uma voltagem de 150 volts por aproximadamente 2 horas.

Biotecnologia

SUMRIO

315

Tampo de amostra
H2O destilada
0,5M tris HCl pH 6,8
SDS 10%
Glicerol
Azul de bromofenol
1%

3,8 mL
1 mL
1,6 mL
0,8 mL
0,4 mL

Tampo de corrida 5X*


Tris
Glicina
SDS
H2O destilada q.s.p.

15 g
72 g
5g
1L

*diluir para 1X na hora do uso com gua destilada. Manter na geladeira. Pode ser utilizado at 4 vezes.

3. Deteco de proteases
3.1 Aps a eletroforese, remover o gel da cuba e acondicionar em um recipiente.
3.2 Incubar o gel com 100 mL tampo tris 50 mM pH 8,0 com Triton X-100 2,5% (2,5 mL/97,5
mL tampo tris) por 16 horas a 37oC, com agitao.
3.3 Corar o gel com soluo de comassie R250 0.1% em 50% metanol.
Dica: abrir o metanol em capela de exausto.
Referncias:
ST LEGER, R.J.; STAPLES, R.C.; ROBERTS, D.W. 1993. Entomopathogenic Isolates of Metarhizium anisopliae, Beauveria
bassiana, and Aspergillus flavus Produce Multiple Extracellular Chitinase Isozymes. Journal of Invertebrate Pathology
61:81-84.

Biotecnologia

SUMRIO

316

16.3 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE


LIPASES E ESTERASES (TEO ET AL. 2003)
Lipases e esterases so enzimas lipolticas que hidrolisam a ligao ster de lipdeos.
Triglicerdeos so considerados o substrato clssico destas enzimas, porm, substratos lineares
formados a partir de lcool e cido graxo ligados por uma ligao ster tambm so alvo. Desta
maneira, existem substratos sintticos lineares cromognicos e fluorognicos, que so empregados
com sucesso para deteco e anlise de lipases e esterases. O gel utilizado no zimograma de
descrito a seguir considerado nativo, pois no utiliza nenhum interferente que possa modificar a
conformao nativa da enzima.
1. Preparao do gel
1.1 Idem ao gel SDS-PAGE, com modificaes na composio, conforme segue:
Running 10%
H2O destilada
0,5 M tris HCl pH 8,8
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

4 mL
2,5 mL
3,35 mL
5 L
50 L

Stacking 4%
H2O destilada
0,5 M tris HCl pH 6,8
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

3,1 mL
1,25 mL
660 L
5 L
25 L

2. Preparao da amostra:
2.1 O volume de amostra a ser carregado no gel de aproximadamente 20 L, sendo 10 L
de amostra e 10 L de tampo de amostra.
2.2 No ferver as amostras. Preparar em eppendorfs e aplicar diretamente no gel.
2.3 Separao da amostra (eletroforese):
2.4 Idem ao gel SDS-PAGE.
2.5 O gel dever ser corrido a uma voltagem de 150 volts at chegar ao final.
3. Deteco de lipases/esterases:
3.1 Aps a eletroforese, remover o gel da cuba e acondicionar em um recipiente.
3.2 Incubar o gel com 100 mL tampo tris 50 mM pH 8,0 com Triton X-100 2% (2 mL/98 mL
tampo tris) e 10 M metilumbeliferil (MUF)-butirato por 15 minutos 37oC.
3.3 Visualizar as bandas de atividade em luz ultravioleta (UV)
Dica 1: a fluorescncia emitida no definitiva e vai perdendo a intensidade com o passar do
tempo, portanto o registro das bandas de atividade deve ser realizado rapidamente.
Dica 2: o substrato empregado, MUF-butirato, contem uma cadeia de cido graxo de 4
carbonos, por isso, este substrato pode ser alvo tanto de esterases (que atuam sobre substratos com
cadeia de at 10 carbonos) quanto de lipases (que atuam sobre substratos com cadeia de cido
graxo maior ou menor de 10 carbonos).

Biotecnologia

SUMRIO

317

Tampo de amostra
H2O destilada
0,5 M tris HCl pH 6,8
Glicerol
Azul de bromofenol 1%

3,8 mL
1 mL
0,8 mL
0,4 mL

Tampo de corrida 1X
Tris
Glicina
H2O destilada q.s.p.

1,8 g
8,64 g
1L

Referncia:
TEO, J.W.P.; ZHANG, L-H.; POH, C.L. 2003. Cloning and characterization of a novel lipase fromVibrio harveyistrain
AP6. Gene 312:181-188.

Biotecnologia

SUMRIO

318

16.4 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE


CATALASES (ZIMMERMANN ET AL. 2006)
Catalases so enzimas importantes para todas as clulas vivas, pois catalizam a decomposio
de perxido de hidrognio em gua e oxignio. So enzimas antioxidantes, protegendo as clulas
contra danos oxidativos.
1. Preparao do gel
Running 7%
4,85 mL
1,5 M Tris HCl pH 8,8
2,5 mL
Acrilamida / bis-acrilamida (30/0,8%) 2,5 mL
TEMED
5 L
Persulfato de amnio (APS) 10%
50 L
H2O destilada

Stacking 4%
3,1 mL
0,5M tris HCl pH 6,8
1,25 mL
Acrilamida / bis-acrilamida (30/0,8%) 660 L
TEMED
5 L
Persulfato de amnio (APS) 10%
25 L
H2O destilada

2. Preparao da amostra:
2.1 O volume de amostra a ser carregado no gel de aproximadamente 20 L, sendo 10 L
de amostra e 10 L de tampo de amostra.
2.2 No ferver as amostras. Preparar em eppendorfs e aplicar diretamente no gel.
2.3 Separao das amostras:
2.4 O gel dever ser corrido a uma voltagem de 70 a 80 volts por 16 horas na geladeira.
2.5 Deteco de catalases:
2.6 Aps eletroforese, remover o gel da cuba e colocar em um recipiente limpo.
2.7 Incubar o gel com 100 mL de 0.01% perxido de hidrognio (H2O2) por 5 minutos (33 L
soluo a 30% em 100 mL de gua destilada).
2.8 Revelar com 1% cloreto de ferro (FeCl2) + 1% ferricianida de potssio (K3Fe(CN)6) por 5
minutos.
2.9 Lavar com gua e observar as bandas.
Tampo de amostra
H2O destilada

0,5 M tris HCl pH 6,8


Glicerol
Azul de bromofenol
1%

3,8 mL
1 mL
0,8 mL
0,4 mL

Tampo de corrida 1X
Tris
Glicina
H2O destilada q.s.p.

Biotecnologia

1,8 g
8,64 g
1L

SUMRIO

319

Referncia:
ZIMMERMANN, P.; HEINLEIN, C.; ORENDI, G.; ZENTGRAF, U. 2006. Senescence-specic regulation of catalases in
Arabidopsis thaliana (L.) Heynh. Plant Cell and Environment, 29:1049-1060.

Biotecnologia

SUMRIO

320

16.5 GEL DE ATIVIDADE (ZIMOGRAMA) PARA DETECO DE


SUPERXIDO DISMUTASES
Superxido dismutases (SOD) so enzimas conhecidas como antioxidantes, importantes
para a desefa de clulas expostas a oxignio. As enzimas SOD so consideradas metaloenzimas,
pois necessitam de metais cofatores para sua atividade. Com a metodologia descrita a seguir,
pode-se identificar trs tipos diferentes SOD: Mn-SOD (mitocondrial), CuZn-SOD (mais comum e
abundante em eucariontos) e Fe-SOD (encontrada em muitas bactrias e plastdeos de plantas).
1. Preparao do gel:
Running
H2O destilada
1,5 M Tris HCl pH 8,8
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

5,6 mL

3 mL
3,4 mL
5 L
50 L

Stacking 4%
H2O destilada
0,5 M Tris HCl pH 6,8
Acrilamida / bis-acrilamida (30/0,8%)
TEMED
Persulfato de amnio (APS) 10%

1,5 mL
750 L
750 L
5 L
25 L

2. Preparao da amostra:
2.1 O volume de amostra a ser carregado no gel de aproximadamente 20 L, sendo 10 L
de amostra e 10 L de tampo de amostra.
2.2 No ferver as amostras. Preparar em eppendorfs e aplicar diretamente no gel.
Dica: para cada amostra, deve-se preparar trs eppendorfs. Cada uma ser tratada de forma
diferente, para avaliar o tipo de SOD presente na amostra.
Tampo de amostra
H2O destilada
0,5 M Tris HCl pH 6,8
Glicerol
Azul de bromofenol 1%

3,8 mL
1 mL
0,8 mL
0,4 mL

Tampo de corrida 1X
Tris
Glicina
H2O destilada q.s.p.

1,8 g
8,64 g
1L

2. Separao das amostras:


2.1 O gel dever ser corrido a uma voltagem de 150 volts.
3. Deteco de SODs:
3.1 Aps eletroforese, remover o gel da cuba e colocar sobre uma placa de vidro limpa com
lcool.

Biotecnologia

SUMRIO

321

3.2 Cortar o gel, separando cada amostra, e colocar cada uma das tiras em placas de petri
para colorao ou revelao.
3.3 Uma das fatias do gel dever ser tratada anteriormente colorao:
Para Fe-SOD antes de corar o gel, tratar por 1h com a seguinte soluo:
gua oxigenada 33% (H2O2)

230 L

20 mM

Cianeto de potssio (KCN)

200 L

1 mM

0.5 M Fosfato de potssio monobsico


(K2HPO4) pH 7.8

20 L

50 mM

EDTA 0,1M q.s.p.

100 mL

3.4 Todas as fatias de gel devero passar pelo processo de colorao e revelao com as
seguintes solues:
4. Soluo de colorao SODs
Nitroblue tetrazolium (NBT) 2,45 mM

5 mg

H2O destilada q.s.p.

50 mL

- Manter o gel por 20 minutos


- Lavar com gua destilada

4.1 Para CuZn-SOD adicionar 10mM cianeto de potssio (KCN) na soluo reveladora:
Dica: preparar a soluo de revelao e dividir em dois frascos. Em 50 mL adicionar KCN
(0,037 g) para a identificao de CuZn-SOD.
5. Soluo de revelao*
Fosfato de potssio monobsico (K2HPO4)

0,627 g

Riboflavina (2,6 M) 55 mg/mL gua

3 L

TEMED 928 mM)

0,325 mL

H2O destilada q.s.p.

100 mL

*Ajustar o pH com cido fosfrico (H3PO4).

5.1 Aps o tratamento com soluo de colorao e revelao, expor o gel luz branca forte
at surgirem as bandas.
- Para Mn-SOD esta enzima no inibida.

Biotecnologia

SUMRIO

322

Apndice:
Exemplos de colorao e deteco de gis de protena
1 2 3 4 5

1- SDS-PAGE corado com Comassie Blue


2- Protease
3- Quitinase
4- Lipase
5- Catalase

Referncias:
SANTI L, BEYS DA SILVA WO, BERGER M, GUIMARES JA, SCHRANK A, VAINSTEIN MH. Conidial surface
proteins of Metarhizium anisopliae: Source of activities related with toxic effects, host penetration and pathogenesis.
Toxicon 2010, 1;55(4):874-80.

Biotecnologia

SUMRIO

323

CAPTULO 17
GERENCIAMENTO DE RESDUOS EM
LABORATRIOS DE BIOTECNOLOGIA
Ctia Viviane Gonalves

Laboratrios de pesquisas geram uma gama de resduos durante os processos desenvolvidos


em suas dependncias, os quais possuem caractersticas intrnsecas referentes sua forma de
gerao. A quantidade de resduos produzida neste segmento poderia ser considerada insignificante
quando comparada s atividades industriais. Todavia, sob o ponto de vista ambiental, podem
representar um problema expressivo, principalmente por no possurem tcnicas padronizadas
para o seu tratamento em funo da variabilidade de sua composio.
Para que o gerenciamento de resduos perigosos advindos de laboratrios seja realizado
de maneira ambientalmente correta, medidas tcnicas e administrativas devem ser implantadas,
envolvendo desde a preveno at o controle efetivo da sua gerao e disposio final. Dessa forma,
a eficiencia de qualquer programa de gerenciamento de resduos laboratoriais, esta diretamente
relacionada a adocao de uma regra bastante simples, a corresponsabilidade.
A adequada separao uma atitude que pode reduzir a quantidade de resduos perigosos,
podendo, inclusive, ser considerada um processo de minimizacao. Se existe uma separacao dos
residuos por classes ou tipos, e possivel trata-los atraves de reacoes entre si. Ressalta-se que a
segregacao dos residuos e realizada por meio de classes de incompatibilidade definidas pela NBR
12235/1992, que prope quais os resduos que devem ser armazenados separadamente.
Na escala de prioridades, o tratamento e a penultima prtica a ser realizada, podendo este
ser qumico, fsico, biologico ou termico. O objetivo do tratamento e o de eliminar ou reduzir o
potencial de periculosidade do residuo. Devido diversidade de resduos perigosos e s mais
variadas faixas de concentracao de seus constituintes, nao existe regra geral para a escolha do
tratamento adequado.

Biotecnologia

SUMRIO

324

17.1 BROMETO DE ETDIO


Eliminao de Resduos
Quando em embalagem fechada, colocar todo o material em um recipiente rotulado e
separado para eliminao por incinerao. No momento da incinerao, o material deve ser
dissolvido ou misturado com um solvente combustvel e queimado em um forno equipado com
filtros adequados. Quando em pequenas quantidades, o brometo de etdio, que normalmente
utilizado em solues aquosas muito diludas, pode ser convertido em um produto fisiologicamente
inativo.
Tcnica para Descontaminao de Brometo de Etdio (Mtodo de Lunn e Sansone)
Precaues:
1. Usar culos, luvas nitrlicas e vesturio de proteo.
2. Trabalhar em capela de exausto.
Procedimento:
1. Em 100 mL de gua destilada adicionar 100 L de brometo de etdio a 1 mg/mL, formando
uma soluo com concentrao 1 g/mL.
2. Adicionar 5 mL de cido hipofosforoso e 12 mL de nitrito de sdio a 0,5 M.
3. Manter a soluo em repouso por 20 horas.
4. Passado o repouso, medir o pH da soluo, ajustando-a para 6-8 com hidrxido de sdio
(NaOH).
5. Expor a soluo descontaminada luz UV. Caso o brometo de etdio esteja totalmente
inativo, nao ir produzir fluorescencia, podendo, ento, ser descartado sem causar danos ao
ambiente. Caso haja fluorescncia, encaminhar para incinerao.
Tcnica para Descontaminao de Brometo de Etdio (Mtodo de Armour)
Precaues:
1. Usar culos, luvas nitrlicas e vesturio de proteo.
2. Trabalhar na capela de exausto.
Procedimento:
1. Em 100 mL de gua destilada adicionar 100 L de brometo de etdio a 1 mg/mL, formando
uma soluo com concentrao 1 g/mL.
2. Adicionar 300 mL de hipoclorito de sdio a 2,5% (na soluo preparada).
3. Manter sob agitao leve por quatro horas em temperatura ambiente.
4. Manter a soluo em repouso por trs dias.
5. Passado o repouso, medir o pH da soluo, ajustando-a para 6-8 com hidrxido de sdio
(NaOH).
6. Expor a soluo descontaminada luz UV. Caso o brometo de etdio esteja totalmente
inativo, este nao produzir fluorescencia, podendo, ento, ser descartado sem causar danos ao
ambiente. Caso haja fluorescncia, encaminhar para incinerao.

Biotecnologia

SUMRIO

325

Referncias:
KAUFMAN, J. A. Waste Disposal in Academic Institutions. Chelsea: Lewis Publishers, 1990.
LUNN, G.; SANSONE, E. B. Ethidium Bromide: destruction and decontamination of solutions. Analytical
Biochemistry, London, 162: 453-458, 1987.

Biotecnologia

SUMRIO

326

17.2 ACRILAMIDA
Eliminao de Resduos
Para grandes volumes, encaminhar para ser queimado em um incinerador qumico com ps
queimador e lavador de gases. Quando em pequenas quantidades e em soluo, a acrilamida pode
ser hidrolisada, neutralizada e descartada.
Tcnica para Descontaminao de Acrilamida em soluo
Precaues:
1. Usar culos, luvas nitrlicas e vesturio de proteo.
2. Trabalhar em capela de exausto (h liberao de amnia).
Procedimento:
1. Em um bquer de 1000 L, acrescentar 500 mL da soluo contendo acrilamida e hidrolizar
com NaOH.
2. Neutralizar a soluo (obter pH entre 5-7).
3. Deixar a soluo em repouso por 1 hora e, aps ser diluda no mesmo volume de gua,
pode ser descartada sem causar danos ao ambiente.
Referncias:
ARMOUR, M.A. Hazardous Laboratory Chemicals Disposal Guide. Lewis Publishers. 3a ed., 2003.

Biotecnologia

SUMRIO

327

17.3 FENOL
Eliminao de Resduos
Quando em embalagem fechada, colocar todo o material em um recipiente rotulado e
separado para eliminao por incinerao. Quando em pequenas quantidades, o fenol pode ser
degradado atravs da reao de Fenton.
Tcnica para Descontaminao de Fenol
Precaues:
1. Usar culos, luvas butlicas e vesturio de proteo.
2. Trabalhar em capela de exausto.
Procedimento:
1. Em um balo de fundo redondo de 300 mL de trs bocas - equipado com um agitador,
um funil de adio, e termmetro preparar uma soluo de 4,7 g (0,05 mol) de fenol em 75 mL de
gua destilada.
2. Dissolver 2,35 g de sulfato ferroso heptahidratado (0,0085 mol) na mistura.
3. Ajustar o pH para 5-6 com cido sulfrico diludo.
4. Adicionar, lentamente, perxido de hidrognio (41 mL, 0,4 mol) gota a gota. A agitao
deve ocorrer durante a adio e mantida por 1 hora.
CUIDADO: A ordem importante se o H2O2 e o FESO4 forem pr-misturados ocorre uma
exploso violenta.
4. Manter a temperatura entre 50-60oC, ajustando a velocidade de adio ou utilizando banho
de gelo. Manter a agitao por mais 2 horas at a temperatura cair para 25oC.
5. Deixar a soluo em repouso por 12 horas e ento, pode ser descartado sem causar danos
ao ambiente.
Referncias:
ARMOUR, M.A. Hazardous Laboratory Chemicals Disposal Guide. Lewis Publishers. 3a ed., 2003.

Biotecnologia

SUMRIO

328